Index of /php.ihc-ru.net/manual/fr/


../
feeds/                                             30-Sep-2022 11:05                   -
images/                                            30-Sep-2022 11:05                   -
styles/                                            30-Sep-2022 11:04                   -
toc/                                               30-Sep-2022 11:05                   -
about.formats.php                                  30-Sep-2022 11:05                4158
about.generate.php                                 30-Sep-2022 11:05                2790
about.howtohelp.php                                30-Sep-2022 11:05                3824
about.more.php                                     30-Sep-2022 11:05                2026
about.notes.php                                    30-Sep-2022 11:05                2480
about.php                                          30-Sep-2022 11:05                1939
about.phpversions.php                              30-Sep-2022 11:05                3643
about.prototypes.php                               30-Sep-2022 11:05                7705
about.translations.php                             30-Sep-2022 11:05                3299
aliases.php                                        30-Sep-2022 11:05               29363
apache.configuration.php                           30-Sep-2022 11:05                5006
apache.constants.php                               30-Sep-2022 11:05                1148
apache.installation.php                            30-Sep-2022 11:05                1273
apache.requirements.php                            30-Sep-2022 11:05                1197
apache.resources.php                               30-Sep-2022 11:05                1210
apache.setup.php                                   30-Sep-2022 11:05                1592
apcu.configuration.php                             30-Sep-2022 11:04               16292
apcu.constants.php                                 30-Sep-2022 11:04                5266
apcu.installation.php                              30-Sep-2022 11:04                3535
apcu.requirements.php                              30-Sep-2022 11:04                1183
apcu.resources.php                                 30-Sep-2022 11:04                1196
apcu.setup.php                                     30-Sep-2022 11:04                1546
apcuiterator.construct.php                         30-Sep-2022 11:04                6835
apcuiterator.current.php                           30-Sep-2022 11:04                3229
apcuiterator.gettotalcount.php                     30-Sep-2022 11:04                3265
apcuiterator.gettotalhits.php                      30-Sep-2022 11:04                3403
apcuiterator.gettotalsize.php                      30-Sep-2022 11:04                3096
apcuiterator.key.php                               30-Sep-2022 11:04                2785
apcuiterator.next.php                              30-Sep-2022 11:04                3077
apcuiterator.rewind.php                            30-Sep-2022 11:04                2800
apcuiterator.valid.php                             30-Sep-2022 11:04                2866
appendices.php                                     30-Sep-2022 11:05               12551
appenditerator.append.php                          30-Sep-2022 11:05                5571
appenditerator.construct.php                       30-Sep-2022 11:05               10891
appenditerator.current.php                         30-Sep-2022 11:05                3585
appenditerator.getarrayiterator.php                30-Sep-2022 11:05                3239
appenditerator.getinneriterator.php                30-Sep-2022 11:05                6904
appenditerator.getiteratorindex.php                30-Sep-2022 11:05                7037
appenditerator.key.php                             30-Sep-2022 11:05                8307
appenditerator.next.php                            30-Sep-2022 11:05                3507
appenditerator.rewind.php                          30-Sep-2022 11:05                3462
appenditerator.valid.php                           30-Sep-2022 11:05                3288
array.configuration.php                            30-Sep-2022 11:05                1217
array.constants.php                                30-Sep-2022 11:05                8426
array.installation.php                             30-Sep-2022 11:05                1245
array.requirements.php                             30-Sep-2022 11:05                1190
array.resources.php                                30-Sep-2022 11:05                1203
array.setup.php                                    30-Sep-2022 11:05                1560
array.sorting.php                                  30-Sep-2022 11:05                6994
arrayaccess.offsetexists.php                       30-Sep-2022 11:04                9861
arrayaccess.offsetget.php                          30-Sep-2022 11:04                4884
arrayaccess.offsetset.php                          30-Sep-2022 11:04                5027
arrayaccess.offsetunset.php                        30-Sep-2022 11:04                2893
arrayiterator.append.php                           30-Sep-2022 11:05                3574
arrayiterator.asort.php                            30-Sep-2022 11:05                6197
arrayiterator.construct.php                        30-Sep-2022 11:05                3673
arrayiterator.count.php                            30-Sep-2022 11:05                3087
arrayiterator.current.php                          30-Sep-2022 11:05                5403
arrayiterator.getarraycopy.php                     30-Sep-2022 11:05                3051
arrayiterator.getflags.php                         30-Sep-2022 11:05                3111
arrayiterator.key.php                              30-Sep-2022 11:05                3805
arrayiterator.ksort.php                            30-Sep-2022 11:05                6177
arrayiterator.natcasesort.php                      30-Sep-2022 11:05                4235
arrayiterator.natsort.php                          30-Sep-2022 11:05                4000
arrayiterator.next.php                             30-Sep-2022 11:05                4743
arrayiterator.offsetexists.php                     30-Sep-2022 11:05                3243
arrayiterator.offsetget.php                        30-Sep-2022 11:05                3521
arrayiterator.offsetset.php                        30-Sep-2022 11:05                3797
arrayiterator.offsetunset.php                      30-Sep-2022 11:05                3960
arrayiterator.rewind.php                           30-Sep-2022 11:05                4671
arrayiterator.seek.php                             30-Sep-2022 11:05                2547
arrayiterator.serialize.php                        30-Sep-2022 11:05                2858
arrayiterator.setflags.php                         30-Sep-2022 11:05                4189
arrayiterator.uasort.php                           30-Sep-2022 11:05                5325
arrayiterator.uksort.php                           30-Sep-2022 11:05                5062
arrayiterator.unserialize.php                      30-Sep-2022 11:05                3064
arrayiterator.valid.php                            30-Sep-2022 11:05                4596
arrayobject.append.php                             30-Sep-2022 11:05                5622
arrayobject.asort.php                              30-Sep-2022 11:05                9034
arrayobject.construct.php                          30-Sep-2022 11:05                6133
arrayobject.count.php                              30-Sep-2022 11:05                5712
arrayobject.exchangearray.php                      30-Sep-2022 11:05                6351
arrayobject.getarraycopy.php                       30-Sep-2022 11:05                5501
arrayobject.getflags.php                           30-Sep-2022 11:05                6393
arrayobject.getiterator.php                        30-Sep-2022 11:05                5668
arrayobject.getiteratorclass.php                   30-Sep-2022 11:05                6940
arrayobject.ksort.php                              30-Sep-2022 11:05                8768
arrayobject.natcasesort.php                        30-Sep-2022 11:05                7845
arrayobject.natsort.php                            30-Sep-2022 11:05                7618
arrayobject.offsetexists.php                       30-Sep-2022 11:05                4814
arrayobject.offsetget.php                          30-Sep-2022 11:05                5137
arrayobject.offsetset.php                          30-Sep-2022 11:05                7047
arrayobject.offsetunset.php                        30-Sep-2022 11:05                4282
arrayobject.serialize.php                          30-Sep-2022 11:05                5162
arrayobject.setflags.php                           30-Sep-2022 11:05                7207
arrayobject.setiteratorclass.php                   30-Sep-2022 11:05                6253
arrayobject.uasort.php                             30-Sep-2022 11:05               10208
arrayobject.uksort.php                             30-Sep-2022 11:05                9355
arrayobject.unserialize.php                        30-Sep-2022 11:05                3595
backedenum.from.php                                30-Sep-2022 11:04                6002
backedenum.tryfrom.php                             30-Sep-2022 11:04                6304
bc.configuration.php                               30-Sep-2022 11:05                2483
bc.constants.php                                   30-Sep-2022 11:05                1122
bc.installation.php                                30-Sep-2022 11:05                1490
bc.requirements.php                                30-Sep-2022 11:05                1169
bc.resources.php                                   30-Sep-2022 11:05                1182
bc.setup.php                                       30-Sep-2022 11:05                1552
book.apache.php                                    30-Sep-2022 11:05                3457
book.apcu.php                                      30-Sep-2022 11:04                4963
book.array.php                                     30-Sep-2022 11:05               12842
book.bc.php                                        30-Sep-2022 11:05                3045
book.bson.php                                      30-Sep-2022 11:04               21181
book.bzip2.php                                     30-Sep-2022 11:04                2977
book.calendar.php                                  30-Sep-2022 11:04                4443
book.classobj.php                                  30-Sep-2022 11:05                4650
book.cmark.php                                     30-Sep-2022 11:05                8680
book.com.php                                       30-Sep-2022 11:05                8293
book.componere.php                                 30-Sep-2022 11:04                6137
book.csprng.php                                    30-Sep-2022 11:04                2275
book.ctype.php                                     30-Sep-2022 11:05                3359
book.cubrid.php                                    30-Sep-2022 11:04               16018
book.curl.php                                      30-Sep-2022 11:05                7330
book.datetime.php                                  30-Sep-2022 11:04               16729
book.dba.php                                       30-Sep-2022 11:04                3763
book.dbase.php                                     30-Sep-2022 11:04                3444
book.dio.php                                       30-Sep-2022 11:04                2984
book.dir.php                                       30-Sep-2022 11:04                3236
book.dom.php                                       30-Sep-2022 11:05               19516
book.ds.php                                        30-Sep-2022 11:05               25102
book.eio.php                                       30-Sep-2022 11:05                9058
book.enchant.php                                   30-Sep-2022 11:04                5601
book.errorfunc.php                                 30-Sep-2022 11:04                3623
book.ev.php                                        30-Sep-2022 11:05               15099
book.event.php                                     30-Sep-2022 11:05               26854
book.exec.php                                      30-Sep-2022 11:05                3460
book.exif.php                                      30-Sep-2022 11:04                2525
book.expect.php                                    30-Sep-2022 11:05                2570
book.fann.php                                      30-Sep-2022 11:05               26099
book.fdf.php                                       30-Sep-2022 11:05                6067
book.ffi.php                                       30-Sep-2022 11:04                5636
book.fileinfo.php                                  30-Sep-2022 11:04                3177
book.filesystem.php                                30-Sep-2022 11:04               10618
book.filter.php                                    30-Sep-2022 11:05                3499
book.fpm.php                                       30-Sep-2022 11:05                1982
book.ftp.php                                       30-Sep-2022 11:05                6116
book.funchand.php                                  30-Sep-2022 11:05                3823
book.gearman.php                                   30-Sep-2022 11:05               17685
book.gender.php                                    30-Sep-2022 11:04                2660
book.geoip.php                                     30-Sep-2022 11:05                4909
book.gettext.php                                   30-Sep-2022 11:04                3019
book.gmagick.php                                   30-Sep-2022 11:04               25504
book.gmp.php                                       30-Sep-2022 11:05                6899
book.gnupg.php                                     30-Sep-2022 11:05                5233
book.hash.php                                      30-Sep-2022 11:04                4573
book.hrtime.php                                    30-Sep-2022 11:04                3736
book.ibase.php                                     30-Sep-2022 11:04               13218
book.ibm-db2.php                                   30-Sep-2022 11:04                9913
book.iconv.php                                     30-Sep-2022 11:04                3453
book.igbinary.php                                  30-Sep-2022 11:05                2172
book.image.php                                     30-Sep-2022 11:04               16987
book.imagick.php                                   30-Sep-2022 11:05               66725
book.imap.php                                      30-Sep-2022 11:05               10969
book.info.php                                      30-Sep-2022 11:04                8699
book.inotify.php                                   30-Sep-2022 11:04                2620
book.intl.php                                      30-Sep-2022 11:04               47879
book.json.php                                      30-Sep-2022 11:05                2925
book.ldap.php                                      30-Sep-2022 11:05                9618
book.libxml.php                                    30-Sep-2022 11:05                3027
book.lua.php                                       30-Sep-2022 11:05                2678
book.luasandbox.php                                30-Sep-2022 11:05                5544
book.lzf.php                                       30-Sep-2022 11:04                2214
book.mail.php                                      30-Sep-2022 11:05                2086
book.mailparse.php                                 30-Sep-2022 11:05                4114
book.math.php                                      30-Sep-2022 11:05                6350
book.mbstring.php                                  30-Sep-2022 11:04               10858
book.mcrypt.php                                    30-Sep-2022 11:04                6380
book.memcache.php                                  30-Sep-2022 11:05                4659
book.memcached.php                                 30-Sep-2022 11:05                9209
book.mhash.php                                     30-Sep-2022 11:04                2502
book.misc.php                                      30-Sep-2022 11:05                5625
book.mongodb.php                                   30-Sep-2022 11:04               26232
book.mqseries.php                                  30-Sep-2022 11:05                3182
book.mysql-xdevapi.php                             30-Sep-2022 11:04               29095
book.mysql.php                                     30-Sep-2022 11:04                8728
book.mysqli.php                                    30-Sep-2022 11:04               20057
book.mysqlnd.php                                   30-Sep-2022 11:04                2500
book.network.php                                   30-Sep-2022 11:05                6112
book.oauth.php                                     30-Sep-2022 11:05                7845
book.oci8.php                                      30-Sep-2022 11:04               17715
book.opcache.php                                   30-Sep-2022 11:04                2733
book.openal.php                                    30-Sep-2022 11:04                4806
book.openssl.php                                   30-Sep-2022 11:04               11839
book.outcontrol.php                                30-Sep-2022 11:04                4437
book.parallel.php                                  30-Sep-2022 11:05                5702
book.parle.php                                     30-Sep-2022 11:05                8801
book.password.php                                  30-Sep-2022 11:04                2805
book.pcntl.php                                     30-Sep-2022 11:05                5390
book.pcre.php                                      30-Sep-2022 11:05                4070
book.pdo.php                                       30-Sep-2022 11:04                8891
book.pgsql.php                                     30-Sep-2022 11:04               13650
book.phar.php                                      30-Sep-2022 11:04               17510
book.phpdbg.php                                    30-Sep-2022 11:04                3084
book.posix.php                                     30-Sep-2022 11:05                6568
book.ps.php                                        30-Sep-2022 11:05               10249
book.pspell.php                                    30-Sep-2022 11:04                4737
book.pthreads.php                                  30-Sep-2022 11:05                5712
book.quickhash.php                                 30-Sep-2022 11:05                8899
book.radius.php                                    30-Sep-2022 11:04                5953
book.rar.php                                       30-Sep-2022 11:04                6009
book.readline.php                                  30-Sep-2022 11:04                3759
book.recode.php                                    30-Sep-2022 11:04                2316
book.reflection.php                                30-Sep-2022 11:05               41702
book.rpminfo.php                                   30-Sep-2022 11:05                2416
book.rrd.php                                       30-Sep-2022 11:05                5809
book.runkit7.php                                   30-Sep-2022 11:04                4214
book.scoutapm.php                                  30-Sep-2022 11:05                2179
book.seaslog.php                                   30-Sep-2022 11:05                5172
book.sem.php                                       30-Sep-2022 11:05                4447
book.session.php                                   30-Sep-2022 11:05                8370
book.shmop.php                                     30-Sep-2022 11:05                3005
book.simplexml.php                                 30-Sep-2022 11:05                5993
book.snmp.php                                      30-Sep-2022 11:05                6408
book.soap.php                                      30-Sep-2022 11:05                6439
book.sockets.php                                   30-Sep-2022 11:05                6964
book.sodium.php                                    30-Sep-2022 11:04               17331
book.solr.php                                      30-Sep-2022 11:05               57534
book.spl.php                                       30-Sep-2022 11:05               10294
book.sqlite3.php                                   30-Sep-2022 11:04                7574
book.sqlsrv.php                                    30-Sep-2022 11:04                6033
book.ssdeep.php                                    30-Sep-2022 11:05                2377
book.ssh2.php                                      30-Sep-2022 11:05                5864
book.stats.php                                     30-Sep-2022 11:05               11814
book.stomp.php                                     30-Sep-2022 11:05                4351
book.stream.php                                    30-Sep-2022 11:05               12025
book.strings.php                                   30-Sep-2022 11:05               14379
book.svm.php                                       30-Sep-2022 11:05                4144
book.svn.php                                       30-Sep-2022 11:05                8606
book.swoole.php                                    30-Sep-2022 11:05               37310
book.sync.php                                      30-Sep-2022 11:05                4974
book.taint.php                                     30-Sep-2022 11:05                2585
book.tcpwrap.php                                   30-Sep-2022 11:05                2039
book.tidy.php                                      30-Sep-2022 11:05                7073
book.tokenizer.php                                 30-Sep-2022 11:05                3132
book.trader.php                                    30-Sep-2022 11:05               18687
book.ui.php                                        30-Sep-2022 11:05               27925
book.uodbc.php                                     30-Sep-2022 11:04                6970
book.uopz.php                                      30-Sep-2022 11:04                5263
book.url.php                                       30-Sep-2022 11:05                3065
book.v8js.php                                      30-Sep-2022 11:05                3140
book.var.php                                       30-Sep-2022 11:05                6234
book.var_representation.php                        30-Sep-2022 11:05                2105
book.varnish.php                                   30-Sep-2022 11:05                5803
book.wddx.php                                      30-Sep-2022 11:05                2786
book.win32service.php                              30-Sep-2022 11:05                5526
book.wincache.php                                  30-Sep-2022 11:04                6116
book.wkhtmltox.php                                 30-Sep-2022 11:05                3378
book.xattr.php                                     30-Sep-2022 11:04                2553
book.xdiff.php                                     30-Sep-2022 11:04                4377
book.xhprof.php                                    30-Sep-2022 11:04                2499
book.xlswriter.php                                 30-Sep-2022 11:05                4546
book.xml.php                                       30-Sep-2022 11:05                5716
book.xmldiff.php                                   30-Sep-2022 11:05                3227
book.xmlreader.php                                 30-Sep-2022 11:05                5220
book.xmlrpc.php                                    30-Sep-2022 11:05                3926
book.xmlwriter.php                                 30-Sep-2022 11:05                7057
book.xsl.php                                       30-Sep-2022 11:05                3962
book.yac.php                                       30-Sep-2022 11:04                2819
book.yaconf.php                                    30-Sep-2022 11:05                2173
book.yaf.php                                       30-Sep-2022 11:05               37211
book.yaml.php                                      30-Sep-2022 11:05                2837
book.yar.php                                       30-Sep-2022 11:05                3779
book.yaz.php                                       30-Sep-2022 11:05                4658
book.zip.php                                       30-Sep-2022 11:04               11035
book.zlib.php                                      30-Sep-2022 11:04                5401
book.zmq.php                                       30-Sep-2022 11:05                6062
book.zookeeper.php                                 30-Sep-2022 11:05                6640
bzip2.configuration.php                            30-Sep-2022 11:04                1217
bzip2.constants.php                                30-Sep-2022 11:04                1137
bzip2.examples.php                                 30-Sep-2022 11:04                4248
bzip2.installation.php                             30-Sep-2022 11:04                1387
bzip2.requirements.php                             30-Sep-2022 11:04                1353
bzip2.resources.php                                30-Sep-2022 11:04                1266
bzip2.setup.php                                    30-Sep-2022 11:04                1578
cachingiterator.construct.php                      30-Sep-2022 11:05                2781
cachingiterator.count.php                          30-Sep-2022 11:05                2488
cachingiterator.current.php                        30-Sep-2022 11:05                2930
cachingiterator.getcache.php                       30-Sep-2022 11:05                5616
cachingiterator.getflags.php                       30-Sep-2022 11:05                2466
cachingiterator.getinneriterator.php               30-Sep-2022 11:05                2623
cachingiterator.hasnext.php                        30-Sep-2022 11:05                2501
cachingiterator.key.php                            30-Sep-2022 11:05                2254
cachingiterator.next.php                           30-Sep-2022 11:05                2455
cachingiterator.offsetexists.php                   30-Sep-2022 11:05                2763
cachingiterator.offsetget.php                      30-Sep-2022 11:05                2738
cachingiterator.offsetset.php                      30-Sep-2022 11:05                3085
cachingiterator.offsetunset.php                    30-Sep-2022 11:05                2712
cachingiterator.rewind.php                         30-Sep-2022 11:05                2453
cachingiterator.setflags.php                       30-Sep-2022 11:05                2744
cachingiterator.tostring.php                       30-Sep-2022 11:05                2532
cachingiterator.valid.php                          30-Sep-2022 11:05                2536
calendar.configuration.php                         30-Sep-2022 11:04                1238
calendar.constants.php                             30-Sep-2022 11:04               10484
calendar.installation.php                          30-Sep-2022 11:04                1516
calendar.requirements.php                          30-Sep-2022 11:04                1211
calendar.resources.php                             30-Sep-2022 11:04                1224
calendar.setup.php                                 30-Sep-2022 11:04                1616
callbackfilteriterator.accept.php                  30-Sep-2022 11:05                3410
callbackfilteriterator.construct.php               30-Sep-2022 11:05                3978
cc.license.php                                     30-Sep-2022 11:05               21012
changelog.misc.php                                 30-Sep-2022 11:05                3835
changelog.mysql.php                                30-Sep-2022 11:04                2678
changelog.mysql_xdevapi.php                        30-Sep-2022 11:04                2337
changelog.mysqli.php                               30-Sep-2022 11:04                3864
changelog.strings.php                              30-Sep-2022 11:05               12660
class.addressinfo.php                              30-Sep-2022 11:05                1768
class.apcuiterator.php                             30-Sep-2022 11:04                6849
class.appenditerator.php                           30-Sep-2022 11:05                8372
class.argumentcounterror.php                       30-Sep-2022 11:04                6685
class.arithmeticerror.php                          30-Sep-2022 11:04                6964
class.arrayaccess.php                              30-Sep-2022 11:04               13188
class.arrayiterator.php                            30-Sep-2022 11:05               16412
class.arrayobject.php                              30-Sep-2022 11:05               15507
class.assertionerror.php                           30-Sep-2022 11:04                6668
class.backedenum.php                               30-Sep-2022 11:04                4056
class.badfunctioncallexception.php                 30-Sep-2022 11:05                6771
class.badmethodcallexception.php                   30-Sep-2022 11:05                6791
class.cachingiterator.php                          30-Sep-2022 11:05               16711
class.callbackfilteriterator.php                   30-Sep-2022 11:05               12509
class.closure.php                                  30-Sep-2022 11:04                6400
class.collator.php                                 30-Sep-2022 11:04               25442
class.collectable.php                              30-Sep-2022 11:05                2463
class.com-exception.php                            30-Sep-2022 11:05                6587
class.com.php                                      30-Sep-2022 11:05               13313
class.commonmark-cql.php                           30-Sep-2022 11:05                7564
class.commonmark-interfaces-ivisitable.php         30-Sep-2022 11:05                2885
class.commonmark-interfaces-ivisitor.php           30-Sep-2022 11:05                4251
class.commonmark-node-blockquote.php               30-Sep-2022 11:05                8247
class.commonmark-node-bulletlist.php               30-Sep-2022 11:05               10124
class.commonmark-node-code.php                     30-Sep-2022 11:05                9121
class.commonmark-node-codeblock.php                30-Sep-2022 11:05               10319
class.commonmark-node-customblock.php              30-Sep-2022 11:05                8877
class.commonmark-node-custominline.php             30-Sep-2022 11:05                8857
class.commonmark-node-document.php                 30-Sep-2022 11:05                8199
class.commonmark-node-heading.php                  30-Sep-2022 11:05                9480
class.commonmark-node-htmlblock.php                30-Sep-2022 11:05                9179
class.commonmark-node-htmlinline.php               30-Sep-2022 11:05                9155
class.commonmark-node-image.php                    30-Sep-2022 11:05               10204
class.commonmark-node-item.php                     30-Sep-2022 11:05                8214
class.commonmark-node-linebreak.php                30-Sep-2022 11:05                8228
class.commonmark-node-link.php                     30-Sep-2022 11:05               10197
class.commonmark-node-orderedlist.php              30-Sep-2022 11:05               10858
class.commonmark-node-paragraph.php                30-Sep-2022 11:05                8253
class.commonmark-node-softbreak.php                30-Sep-2022 11:05                8246
class.commonmark-node-text-emphasis.php            30-Sep-2022 11:05                8275
class.commonmark-node-text-strong.php              30-Sep-2022 11:05                8264
class.commonmark-node-text.php                     30-Sep-2022 11:05                9514
class.commonmark-node-thematicbreak.php            30-Sep-2022 11:05                8275
class.commonmark-node.php                          30-Sep-2022 11:05                9156
class.commonmark-parser.php                        30-Sep-2022 11:05                3621
class.compersisthelper.php                         30-Sep-2022 11:05                6528
class.compileerror.php                             30-Sep-2022 11:04                6607
class.componere-abstract-definition.php            30-Sep-2022 11:04                4595
class.componere-definition.php                     30-Sep-2022 11:04                9384
class.componere-method.php                         30-Sep-2022 11:04                4355
class.componere-patch.php                          30-Sep-2022 11:04                7770
class.componere-value.php                          30-Sep-2022 11:04                5219
class.countable.php                                30-Sep-2022 11:05                2584
class.curlfile.php                                 30-Sep-2022 11:05                7642
class.curlhandle.php                               30-Sep-2022 11:05                1779
class.curlmultihandle.php                          30-Sep-2022 11:05                1818
class.curlsharehandle.php                          30-Sep-2022 11:05                1814
class.curlstringfile.php                           30-Sep-2022 11:05                5242
class.dateinterval.php                             30-Sep-2022 11:04               10477
class.dateperiod.php                               30-Sep-2022 11:04               13242
class.datetime.php                                 30-Sep-2022 11:04               19690
class.datetimeimmutable.php                        30-Sep-2022 11:04               20221
class.datetimeinterface.php                        30-Sep-2022 11:04               15140
class.datetimezone.php                             30-Sep-2022 11:04               13088
class.deflatecontext.php                           30-Sep-2022 11:04                1833
class.directory.php                                30-Sep-2022 11:04                5434
class.directoryiterator.php                        30-Sep-2022 11:05               23694
class.divisionbyzeroerror.php                      30-Sep-2022 11:04                6642
class.domainexception.php                          30-Sep-2022 11:05                6712
class.domattr.php                                  30-Sep-2022 11:05               21468
class.domcdatasection.php                          30-Sep-2022 11:05               22930
class.domcharacterdata.php                         30-Sep-2022 11:05               24188
class.domchildnode.php                             30-Sep-2022 11:05                3953
class.domcomment.php                               30-Sep-2022 11:05               21937
class.domdocument.php                              30-Sep-2022 11:05               55338
class.domdocumentfragment.php                      30-Sep-2022 11:05               21007
class.domdocumenttype.php                          30-Sep-2022 11:05               21217
class.domelement.php                               30-Sep-2022 11:05               36389
class.domentity.php                                30-Sep-2022 11:05               21512
class.domentityreference.php                       30-Sep-2022 11:05               17559
class.domexception.php                             30-Sep-2022 11:05                7584
class.domimplementation.php                        30-Sep-2022 11:05                5513
class.domnamednodemap.php                          30-Sep-2022 11:05                6747
class.domnode.php                                  30-Sep-2022 11:05               25810
class.domnodelist.php                              30-Sep-2022 11:05                5461
class.domnotation.php                              30-Sep-2022 11:05               17772
class.domparentnode.php                            30-Sep-2022 11:05                3043
class.domprocessinginstruction.php                 30-Sep-2022 11:05               18911
class.domtext.php                                  30-Sep-2022 11:05               24637
class.domxpath.php                                 30-Sep-2022 11:05                7764
class.dotnet.php                                   30-Sep-2022 11:05                7152
class.ds-collection.php                            30-Sep-2022 11:05                5127
class.ds-deque.php                                 30-Sep-2022 11:05               21424
class.ds-hashable.php                              30-Sep-2022 11:05                4070
class.ds-map.php                                   30-Sep-2022 11:05               22630
class.ds-pair.php                                  30-Sep-2022 11:05                4467
class.ds-priorityqueue.php                         30-Sep-2022 11:05                7919
class.ds-queue.php                                 30-Sep-2022 11:05                7481
class.ds-sequence.php                              30-Sep-2022 11:05               19156
class.ds-set.php                                   30-Sep-2022 11:05               18006
class.ds-stack.php                                 30-Sep-2022 11:05                6911
class.ds-vector.php                                30-Sep-2022 11:05               20991
class.emptyiterator.php                            30-Sep-2022 11:05                4186
class.enchantbroker.php                            30-Sep-2022 11:04                1845
class.enchantdictionary.php                        30-Sep-2022 11:04                1835
class.error.php                                    30-Sep-2022 11:04               10171
class.errorexception.php                           30-Sep-2022 11:04               13075
class.ev.php                                       30-Sep-2022 11:05               39755
class.evcheck.php                                  30-Sep-2022 11:05               10512
class.evchild.php                                  30-Sep-2022 11:05               11763
class.evembed.php                                  30-Sep-2022 11:05                9310
class.event.php                                    30-Sep-2022 11:05               18142
class.eventbase.php                                30-Sep-2022 11:05               14344
class.eventbuffer.php                              30-Sep-2022 11:05               20824
class.eventbufferevent.php                         30-Sep-2022 11:05               35110
class.eventconfig.php                              30-Sep-2022 11:05                7066
class.eventdnsbase.php                             30-Sep-2022 11:05               10456
class.eventhttp.php                                30-Sep-2022 11:05                8889
class.eventhttpconnection.php                      30-Sep-2022 11:05                9760
class.eventhttprequest.php                         30-Sep-2022 11:05               20326
class.eventlistener.php                            30-Sep-2022 11:05               12107
class.eventsslcontext.php                          30-Sep-2022 11:05               17052
class.eventutil.php                                30-Sep-2022 11:05               22715
class.evfork.php                                   30-Sep-2022 11:05                8318
class.evidle.php                                   30-Sep-2022 11:05                9559
class.evio.php                                     30-Sep-2022 11:05               12408
class.evloop.php                                   30-Sep-2022 11:05               30644
class.evperiodic.php                               30-Sep-2022 11:05               14462
class.evprepare.php                                30-Sep-2022 11:05               10656
class.evsignal.php                                 30-Sep-2022 11:05               11146
class.evstat.php                                   30-Sep-2022 11:05               13764
class.evtimer.php                                  30-Sep-2022 11:05               14018
class.evwatcher.php                                30-Sep-2022 11:05                9500
class.exception.php                                30-Sep-2022 11:04               10368
class.fannconnection.php                           30-Sep-2022 11:05                6120
class.ffi-cdata.php                                30-Sep-2022 11:04                5469
class.ffi-ctype.php                                30-Sep-2022 11:04                7847
class.ffi-exception.php                            30-Sep-2022 11:04                6409
class.ffi-parserexception.php                      30-Sep-2022 11:04                6465
class.ffi.php                                      30-Sep-2022 11:04               17744
class.fiber.php                                    30-Sep-2022 11:04                7650
class.fibererror.php                               30-Sep-2022 11:04                7318
class.filesystemiterator.php                       30-Sep-2022 11:05               30549
class.filteriterator.php                           30-Sep-2022 11:05                7975
class.finfo.php                                    30-Sep-2022 11:04                5055
class.ftp-connection.php                           30-Sep-2022 11:05                1895
class.gdfont.php                                   30-Sep-2022 11:04                1816
class.gdimage.php                                  30-Sep-2022 11:04                1728
class.gearmanclient.php                            30-Sep-2022 11:05               31493
class.gearmanexception.php                         30-Sep-2022 11:05                6657
class.gearmanjob.php                               30-Sep-2022 11:05               10382
class.gearmantask.php                              30-Sep-2022 11:05                8749
class.gearmanworker.php                            30-Sep-2022 11:05               11725
class.gender.php                                   30-Sep-2022 11:04               33128
class.generator.php                                30-Sep-2022 11:04                6988
class.globiterator.php                             30-Sep-2022 11:05               26290
class.gmagick.php                                  30-Sep-2022 11:04               78361
class.gmagickdraw.php                              30-Sep-2022 11:04               22070
class.gmagickpixel.php                             30-Sep-2022 11:04                5334
class.gmp.php                                      30-Sep-2022 11:05                3301
class.hashcontext.php                              30-Sep-2022 11:04                3249
class.hrtime-performancecounter.php                30-Sep-2022 11:04                3577
class.hrtime-stopwatch.php                         30-Sep-2022 11:04                6527
class.hrtime-unit.php                              30-Sep-2022 11:04                3887
class.imagick.php                                  30-Sep-2022 11:05              244100
class.imagickdraw.php                              30-Sep-2022 11:05               67834
class.imagickkernel.php                            30-Sep-2022 11:05                5631
class.imagickpixel.php                             30-Sep-2022 11:05               11341
class.imagickpixeliterator.php                     30-Sep-2022 11:05                8808
class.imap-connection.php                          30-Sep-2022 11:05                1898
class.infiniteiterator.php                         30-Sep-2022 11:05                5368
class.inflatecontext.php                           30-Sep-2022 11:04                1826
class.internaliterator.php                         30-Sep-2022 11:04                4793
class.intlbreakiterator.php                        30-Sep-2022 11:04               26400
class.intlcalendar.php                             30-Sep-2022 11:04               57993
class.intlchar.php                                 30-Sep-2022 11:04              340829
class.intlcodepointbreakiterator.php               30-Sep-2022 11:04               18446
class.intldateformatter.php                        30-Sep-2022 11:04               24276
class.intldatepatterngenerator.php                 30-Sep-2022 11:04                4120
class.intlexception.php                            30-Sep-2022 11:04                6812
class.intlgregoriancalendar.php                    30-Sep-2022 11:04               38870
class.intliterator.php                             30-Sep-2022 11:04                5200
class.intlpartsiterator.php                        30-Sep-2022 11:04                6789
class.intlrulebasedbreakiterator.php               30-Sep-2022 11:04               21108
class.intltimezone.php                             30-Sep-2022 11:04               19601
class.invalidargumentexception.php                 30-Sep-2022 11:05                6721
class.iterator.php                                 30-Sep-2022 11:04               12773
class.iteratoraggregate.php                        30-Sep-2022 11:04                6579
class.iteratoriterator.php                         30-Sep-2022 11:05                6553
class.jsonexception.php                            30-Sep-2022 11:05                7075
class.jsonserializable.php                         30-Sep-2022 11:05                2942
class.ldap-connection.php                          30-Sep-2022 11:05                1918
class.ldap-result-entry.php                        30-Sep-2022 11:05                1933
class.ldap-result.php                              30-Sep-2022 11:05                1910
class.lengthexception.php                          30-Sep-2022 11:05                6645
class.libxmlerror.php                              30-Sep-2022 11:05                5309
class.limititerator.php                            30-Sep-2022 11:05               12052
class.locale.php                                   30-Sep-2022 11:04               21190
class.logicexception.php                           30-Sep-2022 11:05                6755
class.lua.php                                      30-Sep-2022 11:05                7294
class.luaclosure.php                               30-Sep-2022 11:05                2567
class.luasandbox.php                               30-Sep-2022 11:05               12412
class.luasandboxerror.php                          30-Sep-2022 11:05                8679
class.luasandboxerrorerror.php                     30-Sep-2022 11:05                6714
class.luasandboxfatalerror.php                     30-Sep-2022 11:05                6836
class.luasandboxfunction.php                       30-Sep-2022 11:05                3630
class.luasandboxmemoryerror.php                    30-Sep-2022 11:05                7040
class.luasandboxruntimeerror.php                   30-Sep-2022 11:05                6856
class.luasandboxsyntaxerror.php                    30-Sep-2022 11:05                6718
class.luasandboxtimeouterror.php                   30-Sep-2022 11:05                7024
class.memcache.php                                 30-Sep-2022 11:05               15865
class.memcached.php                                30-Sep-2022 11:05               36801
class.memcachedexception.php                       30-Sep-2022 11:05                6689
class.messageformatter.php                         30-Sep-2022 11:04               11443
class.mongodb-bson-binary.php                      30-Sep-2022 11:04               14350
class.mongodb-bson-binaryinterface.php             30-Sep-2022 11:04                4513
class.mongodb-bson-dbpointer.php                   30-Sep-2022 11:04                5890
class.mongodb-bson-decimal128.php                  30-Sep-2022 11:04                7585
class.mongodb-bson-decimal128interface.php         30-Sep-2022 11:04                3766
class.mongodb-bson-int64.php                       30-Sep-2022 11:04                6649
class.mongodb-bson-javascript.php                  30-Sep-2022 11:04                8251
class.mongodb-bson-javascriptinterface.php         30-Sep-2022 11:04                4674
class.mongodb-bson-maxkey.php                      30-Sep-2022 11:04                5847
class.mongodb-bson-maxkeyinterface.php             30-Sep-2022 11:04                2153
class.mongodb-bson-minkey.php                      30-Sep-2022 11:04                5839
class.mongodb-bson-minkeyinterface.php             30-Sep-2022 11:04                2134
class.mongodb-bson-objectid.php                    30-Sep-2022 11:04                9072
class.mongodb-bson-objectidinterface.php           30-Sep-2022 11:04                4172
class.mongodb-bson-persistable.php                 30-Sep-2022 11:04                4639
class.mongodb-bson-regex.php                       30-Sep-2022 11:04                7888
class.mongodb-bson-regexinterface.php              30-Sep-2022 11:04                4558
class.mongodb-bson-serializable.php                30-Sep-2022 11:04                3845
class.mongodb-bson-symbol.php                      30-Sep-2022 11:04                5831
class.mongodb-bson-timestamp.php                   30-Sep-2022 11:04                8202
class.mongodb-bson-timestampinterface.php          30-Sep-2022 11:04                4719
class.mongodb-bson-type.php                        30-Sep-2022 11:04                2035
class.mongodb-bson-undefined.php                   30-Sep-2022 11:04                5866
class.mongodb-bson-unserializable.php              30-Sep-2022 11:04                3923
class.mongodb-bson-utcdatetime.php                 30-Sep-2022 11:04                7702
class.mongodb-bson-utcdatetimeinterface.php        30-Sep-2022 11:04                4339
class.mongodb-driver-bulkwrite.php                 30-Sep-2022 11:04               25912
class.mongodb-driver-clientencryption.php          30-Sep-2022 11:04               11867
class.mongodb-driver-command.php                   30-Sep-2022 11:04               15976
class.mongodb-driver-cursor.php                    30-Sep-2022 11:04               28704
class.mongodb-driver-cursorid.php                  30-Sep-2022 11:04                5383
class.mongodb-driver-cursorinterface.php           30-Sep-2022 11:04                5941
class.mongodb-driver-exception-authenticationex..> 30-Sep-2022 11:04                8164
class.mongodb-driver-exception-bulkwriteexcepti..> 30-Sep-2022 11:04                9063
class.mongodb-driver-exception-commandexception..> 30-Sep-2022 11:04                9754
class.mongodb-driver-exception-connectionexcept..> 30-Sep-2022 11:04                8245
class.mongodb-driver-exception-connectiontimeou..> 30-Sep-2022 11:04                8548
class.mongodb-driver-exception-encryptionexcept..> 30-Sep-2022 11:04                8094
class.mongodb-driver-exception-exception.php       30-Sep-2022 11:04                2224
class.mongodb-driver-exception-executiontimeout..> 30-Sep-2022 11:04                9199
class.mongodb-driver-exception-invalidargumente..> 30-Sep-2022 11:04                7394
class.mongodb-driver-exception-logicexception.php  30-Sep-2022 11:04                7181
class.mongodb-driver-exception-runtimeexception..> 30-Sep-2022 11:04               10776
class.mongodb-driver-exception-serverexception.php 30-Sep-2022 11:04                8171
class.mongodb-driver-exception-sslconnectionexc..> 30-Sep-2022 11:04                8532
class.mongodb-driver-exception-unexpectedvaluee..> 30-Sep-2022 11:04                7314
class.mongodb-driver-exception-writeexception.php  30-Sep-2022 11:04               11230
class.mongodb-driver-manager.php                   30-Sep-2022 11:04               19689
class.mongodb-driver-monitoring-commandfailedev..> 30-Sep-2022 11:04                7547
class.mongodb-driver-monitoring-commandstartede..> 30-Sep-2022 11:04                7049
class.mongodb-driver-monitoring-commandsubscrib..> 30-Sep-2022 11:04                6158
class.mongodb-driver-monitoring-commandsucceede..> 30-Sep-2022 11:04                7119
class.mongodb-driver-monitoring-sdamsubscriber.php 30-Sep-2022 11:04               11392
class.mongodb-driver-monitoring-serverchangedev..> 30-Sep-2022 11:04                5581
class.mongodb-driver-monitoring-serverclosedeve..> 30-Sep-2022 11:04                4228
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:04                5462
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:04                4347
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:04                5474
class.mongodb-driver-monitoring-serveropeningev..> 30-Sep-2022 11:04                4248
class.mongodb-driver-monitoring-subscriber.php     30-Sep-2022 11:04                2601
class.mongodb-driver-monitoring-topologychanged..> 30-Sep-2022 11:04                4694
class.mongodb-driver-monitoring-topologyclosede..> 30-Sep-2022 11:04                3305
class.mongodb-driver-monitoring-topologyopening..> 30-Sep-2022 11:04                3319
class.mongodb-driver-query.php                     30-Sep-2022 11:04                3132
class.mongodb-driver-readconcern.php               30-Sep-2022 11:04               16008
class.mongodb-driver-readpreference.php            30-Sep-2022 11:04               18780
class.mongodb-driver-server.php                    30-Sep-2022 11:04               24145
class.mongodb-driver-serverapi.php                 30-Sep-2022 11:04               15144
class.mongodb-driver-serverdescription.php         30-Sep-2022 11:04               14700
class.mongodb-driver-session.php                   30-Sep-2022 11:04               13719
class.mongodb-driver-topologydescription.php       30-Sep-2022 11:04               10204
class.mongodb-driver-writeconcern.php              30-Sep-2022 11:04                9239
class.mongodb-driver-writeconcernerror.php         30-Sep-2022 11:04                4167
class.mongodb-driver-writeerror.php                30-Sep-2022 11:04                4479
class.mongodb-driver-writeresult.php               30-Sep-2022 11:04                8049
class.multipleiterator.php                         30-Sep-2022 11:05               10778
class.mysql-xdevapi-baseresult.php                 30-Sep-2022 11:04                2886
class.mysql-xdevapi-client.php                     30-Sep-2022 11:04                3025
class.mysql-xdevapi-collection.php                 30-Sep-2022 11:04                9942
class.mysql-xdevapi-collectionadd.php              30-Sep-2022 11:04                2904
class.mysql-xdevapi-collectionfind.php             30-Sep-2022 11:04                8262
class.mysql-xdevapi-collectionmodify.php           30-Sep-2022 11:04                9419
class.mysql-xdevapi-collectionremove.php           30-Sep-2022 11:04                5002
class.mysql-xdevapi-columnresult.php               30-Sep-2022 11:04                6018
class.mysql-xdevapi-crudoperationbindable.php      30-Sep-2022 11:04                2881
class.mysql-xdevapi-crudoperationlimitable.php     30-Sep-2022 11:04                2887
class.mysql-xdevapi-crudoperationskippable.php     30-Sep-2022 11:04                2898
class.mysql-xdevapi-crudoperationsortable.php      30-Sep-2022 11:04                2872
class.mysql-xdevapi-databaseobject.php             30-Sep-2022 11:04                3384
class.mysql-xdevapi-docresult.php                  30-Sep-2022 11:04                3774
class.mysql-xdevapi-exception.php                  30-Sep-2022 11:04                2165
class.mysql-xdevapi-executable.php                 30-Sep-2022 11:04                2581
class.mysql-xdevapi-executionstatus.php            30-Sep-2022 11:04                4839
class.mysql-xdevapi-expression.php                 30-Sep-2022 11:04                3160
class.mysql-xdevapi-result.php                     30-Sep-2022 11:04                4100
class.mysql-xdevapi-rowresult.php                  30-Sep-2022 11:04                4697
class.mysql-xdevapi-schema.php                     30-Sep-2022 11:04                7169
class.mysql-xdevapi-schemaobject.php               30-Sep-2022 11:04                2766
class.mysql-xdevapi-session.php                    30-Sep-2022 11:04                8496
class.mysql-xdevapi-sqlstatement.php               30-Sep-2022 11:04                6218
class.mysql-xdevapi-sqlstatementresult.php         30-Sep-2022 11:04                6644
class.mysql-xdevapi-statement.php                  30-Sep-2022 11:04                4642
class.mysql-xdevapi-table.php                      30-Sep-2022 11:04                7333
class.mysql-xdevapi-tabledelete.php                30-Sep-2022 11:04                4931
class.mysql-xdevapi-tableinsert.php                30-Sep-2022 11:04                3432
class.mysql-xdevapi-tableselect.php                30-Sep-2022 11:04                8032
class.mysql-xdevapi-tableupdate.php                30-Sep-2022 11:04                5882
class.mysql-xdevapi-warning.php                    30-Sep-2022 11:04                3724
class.mysqli-driver.php                            30-Sep-2022 11:04                7872
class.mysqli-result.php                            30-Sep-2022 11:04               14161
class.mysqli-sql-exception.php                     30-Sep-2022 11:04                8143
class.mysqli-stmt.php                              30-Sep-2022 11:04               17069
class.mysqli-warning.php                           30-Sep-2022 11:04                4256
class.mysqli.php                                   30-Sep-2022 11:04               34054
class.norewinditerator.php                         30-Sep-2022 11:05                7423
class.normalizer.php                               30-Sep-2022 11:04                8294
class.numberformatter.php                          30-Sep-2022 11:04               40760
class.oauth.php                                    30-Sep-2022 11:05               17777
class.oauthexception.php                           30-Sep-2022 11:05                7827
class.oauthprovider.php                            30-Sep-2022 11:05               11808
class.ocicollection.php                            30-Sep-2022 11:04                6381
class.ocilob.php                                   30-Sep-2022 11:04               12487
class.opensslasymmetrickey.php                     30-Sep-2022 11:04                1924
class.opensslcertificate.php                       30-Sep-2022 11:04                1912
class.opensslcertificatesigningrequest.php         30-Sep-2022 11:04                1999
class.outeriterator.php                            30-Sep-2022 11:05                4373
class.outofboundsexception.php                     30-Sep-2022 11:05                6803
class.outofrangeexception.php                      30-Sep-2022 11:05                6789
class.overflowexception.php                        30-Sep-2022 11:05                6691
class.parallel-channel.php                         30-Sep-2022 11:05                7994
class.parallel-events-event-type.php               30-Sep-2022 11:05                3324
class.parallel-events-event.php                    30-Sep-2022 11:05                3299
class.parallel-events-input.php                    30-Sep-2022 11:05                4548
class.parallel-events.php                          30-Sep-2022 11:05                6665
class.parallel-future.php                          30-Sep-2022 11:05                8221
class.parallel-runtime.php                         30-Sep-2022 11:05                6144
class.parallel-sync.php                            30-Sep-2022 11:05                5217
class.parentiterator.php                           30-Sep-2022 11:05                9799
class.parle-errorinfo.php                          30-Sep-2022 11:05                3761
class.parle-lexer.php                              30-Sep-2022 11:05               11773
class.parle-lexerexception.php                     30-Sep-2022 11:05                6852
class.parle-parser.php                             30-Sep-2022 11:05               14712
class.parle-parserexception.php                    30-Sep-2022 11:05                6834
class.parle-rlexer.php                             30-Sep-2022 11:05               13414
class.parle-rparser.php                            30-Sep-2022 11:05               14863
class.parle-stack.php                              30-Sep-2022 11:05                4648
class.parle-token.php                              30-Sep-2022 11:05                4425
class.parseerror.php                               30-Sep-2022 11:04                7128
class.pdo.php                                      30-Sep-2022 11:04               13354
class.pdoexception.php                             30-Sep-2022 11:04                8601
class.pdostatement.php                             30-Sep-2022 11:04               20253
class.pgsql-connection.php                         30-Sep-2022 11:04                1941
class.pgsql-lob.php                                30-Sep-2022 11:04                1883
class.pgsql-result.php                             30-Sep-2022 11:04                1915
class.phar.php                                     30-Sep-2022 11:04               61345
class.phardata.php                                 30-Sep-2022 11:04               44902
class.pharexception.php                            30-Sep-2022 11:04                6669
class.pharfileinfo.php                             30-Sep-2022 11:04               18618
class.php-user-filter.php                          30-Sep-2022 11:05                6163
class.phptoken.php                                 30-Sep-2022 11:05                7714
class.pool.php                                     30-Sep-2022 11:05                7327
class.pspell-config.php                            30-Sep-2022 11:04                1917
class.pspell-dictionary.php                        30-Sep-2022 11:04                1954
class.quickhashinthash.php                         30-Sep-2022 11:05               12923
class.quickhashintset.php                          30-Sep-2022 11:05               11119
class.quickhashintstringhash.php                   30-Sep-2022 11:05               13737
class.quickhashstringinthash.php                   30-Sep-2022 11:05               11852
class.rangeexception.php                           30-Sep-2022 11:05                6967
class.rararchive.php                               30-Sep-2022 11:04                7255
class.rarentry.php                                 30-Sep-2022 11:04               45969
class.rarexception.php                             30-Sep-2022 11:04                7905
class.recursivearrayiterator.php                   30-Sep-2022 11:05               13881
class.recursivecachingiterator.php                 30-Sep-2022 11:05               13364
class.recursivecallbackfilteriterator.php          30-Sep-2022 11:05               14451
class.recursivedirectoryiterator.php               30-Sep-2022 11:05               29484
class.recursivefilteriterator.php                  30-Sep-2022 11:05                8629
class.recursiveiterator.php                        30-Sep-2022 11:05                5007
class.recursiveiteratoriterator.php                30-Sep-2022 11:05               13754
class.recursiveregexiterator.php                   30-Sep-2022 11:05               13425
class.recursivetreeiterator.php                    30-Sep-2022 11:05               23132
class.reflection.php                               30-Sep-2022 11:05                3236
class.reflectionattribute.php                      30-Sep-2022 11:05                6022
class.reflectionclass.php                          30-Sep-2022 11:05               32616
class.reflectionclassconstant.php                  30-Sep-2022 11:05               13763
class.reflectionenum.php                           30-Sep-2022 11:05               25878
class.reflectionenumbackedcase.php                 30-Sep-2022 11:05               11121
class.reflectionenumunitcase.php                   30-Sep-2022 11:05               10860
class.reflectionexception.php                      30-Sep-2022 11:05                6626
class.reflectionextension.php                      30-Sep-2022 11:05                9405
class.reflectionfiber.php                          30-Sep-2022 11:05                4766
class.reflectionfunction.php                       30-Sep-2022 11:05               17911
class.reflectionfunctionabstract.php               30-Sep-2022 11:05               18063
class.reflectiongenerator.php                      30-Sep-2022 11:05                6293
class.reflectionintersectiontype.php               30-Sep-2022 11:05                3337
class.reflectionmethod.php                         30-Sep-2022 11:05               27869
class.reflectionnamedtype.php                      30-Sep-2022 11:05                3640
class.reflectionobject.php                         30-Sep-2022 11:05               23537
class.reflectionparameter.php                      30-Sep-2022 11:05               14970
class.reflectionproperty.php                       30-Sep-2022 11:05               19708
class.reflectionreference.php                      30-Sep-2022 11:05                3882
class.reflectiontype.php                           30-Sep-2022 11:05                4489
class.reflectionuniontype.php                      30-Sep-2022 11:05                3223
class.reflectionzendextension.php                  30-Sep-2022 11:05                6931
class.reflector.php                                30-Sep-2022 11:05                3948
class.regexiterator.php                            30-Sep-2022 11:05               15918
class.resourcebundle.php                           30-Sep-2022 11:04                9868
class.rrdcreator.php                               30-Sep-2022 11:05                4212
class.rrdgraph.php                                 30-Sep-2022 11:05                3803
class.rrdupdater.php                               30-Sep-2022 11:05                3120
class.runtimeexception.php                         30-Sep-2022 11:05                6752
class.seaslog.php                                  30-Sep-2022 11:05               17885
class.seekableiterator.php                         30-Sep-2022 11:05               12949
class.serializable.php                             30-Sep-2022 11:04                8576
class.sessionhandler.php                           30-Sep-2022 11:05               27790
class.sessionhandlerinterface.php                  30-Sep-2022 11:05               16662
class.sessionidinterface.php                       30-Sep-2022 11:05                3187
class.sessionupdatetimestamphandlerinterface.php   30-Sep-2022 11:05                4203
class.shmop.php                                    30-Sep-2022 11:05                1744
class.simplexmlelement.php                         30-Sep-2022 11:05               13102
class.simplexmliterator.php                        30-Sep-2022 11:05               13008
class.snmp.php                                     30-Sep-2022 11:05               25223
class.snmpexception.php                            30-Sep-2022 11:05                7670
class.soapclient.php                               30-Sep-2022 11:05               29969
class.soapfault.php                                30-Sep-2022 11:05               12776
class.soapheader.php                               30-Sep-2022 11:05                5555
class.soapparam.php                                30-Sep-2022 11:05                3737
class.soapserver.php                               30-Sep-2022 11:05                9359
class.soapvar.php                                  30-Sep-2022 11:05                7055
class.socket.php                                   30-Sep-2022 11:05                1791
class.sodiumexception.php                          30-Sep-2022 11:04                6609
class.solrclient.php                               30-Sep-2022 11:05               21956
class.solrclientexception.php                      30-Sep-2022 11:05                8573
class.solrcollapsefunction.php                     30-Sep-2022 11:05               10437
class.solrdismaxquery.php                          30-Sep-2022 11:05               94833
class.solrdocument.php                             30-Sep-2022 11:05               20476
class.solrdocumentfield.php                        30-Sep-2022 11:05                4438
class.solrexception.php                            30-Sep-2022 11:05                9122
class.solrgenericresponse.php                      30-Sep-2022 11:05               10987
class.solrillegalargumentexception.php             30-Sep-2022 11:05                8672
class.solrillegaloperationexception.php            30-Sep-2022 11:05                8726
class.solrinputdocument.php                        30-Sep-2022 11:05               16792
class.solrmissingmandatoryparameterexception.php   30-Sep-2022 11:05                7859
class.solrmodifiableparams.php                     30-Sep-2022 11:05                7953
class.solrobject.php                               30-Sep-2022 11:05                5526
class.solrparams.php                               30-Sep-2022 11:05                8275
class.solrpingresponse.php                         30-Sep-2022 11:05               10273
class.solrquery.php                                30-Sep-2022 11:05              107211
class.solrqueryresponse.php                        30-Sep-2022 11:05               10916
class.solrresponse.php                             30-Sep-2022 11:05               13272
class.solrserverexception.php                      30-Sep-2022 11:05                8547
class.solrupdateresponse.php                       30-Sep-2022 11:05               10973
class.solrutils.php                                30-Sep-2022 11:05                4573
class.spldoublylinkedlist.php                      30-Sep-2022 11:05               16579
class.splfileinfo.php                              30-Sep-2022 11:05               15989
class.splfileobject.php                            30-Sep-2022 11:05               31107
class.splfixedarray.php                            30-Sep-2022 11:05               18133
class.splheap.php                                  30-Sep-2022 11:05                7700
class.splmaxheap.php                               30-Sep-2022 11:05                7056
class.splminheap.php                               30-Sep-2022 11:05                7065
class.splobjectstorage.php                         30-Sep-2022 11:05               20536
class.splobserver.php                              30-Sep-2022 11:05                2919
class.splpriorityqueue.php                         30-Sep-2022 11:05                9740
class.splqueue.php                                 30-Sep-2022 11:05               12504
class.splstack.php                                 30-Sep-2022 11:05               11467
class.splsubject.php                               30-Sep-2022 11:05                3731
class.spltempfileobject.php                        30-Sep-2022 11:05               25333
class.spoofchecker.php                             30-Sep-2022 11:04               13503
class.sqlite3.php                                  30-Sep-2022 11:04               15919
class.sqlite3result.php                            30-Sep-2022 11:04                5354
class.sqlite3stmt.php                              30-Sep-2022 11:04                7542
class.stomp.php                                    30-Sep-2022 11:05               17171
class.stompexception.php                           30-Sep-2022 11:05                5370
class.stompframe.php                               30-Sep-2022 11:05                4153
class.streamwrapper.php                            30-Sep-2022 11:05               17471
class.stringable.php                               30-Sep-2022 11:04                9026
class.svm.php                                      30-Sep-2022 11:05               16750
class.svmmodel.php                                 30-Sep-2022 11:05                6446
class.swoole-async.php                             30-Sep-2022 11:05                7051
class.swoole-atomic.php                            30-Sep-2022 11:05                4396
class.swoole-buffer.php                            30-Sep-2022 11:05                6508
class.swoole-channel.php                           30-Sep-2022 11:05                3713
class.swoole-client.php                            30-Sep-2022 11:05               14258
class.swoole-connection-iterator.php               30-Sep-2022 11:05                7036
class.swoole-coroutine.php                         30-Sep-2022 11:05               20034
class.swoole-event.php                             30-Sep-2022 11:05                6598
class.swoole-exception.php                         30-Sep-2022 11:05                4135
class.swoole-http-client.php                       30-Sep-2022 11:05               12895
class.swoole-http-request.php                      30-Sep-2022 11:05                2854
class.swoole-http-response.php                     30-Sep-2022 11:05                9462
class.swoole-http-server.php                       30-Sep-2022 11:05               21511
class.swoole-lock.php                              30-Sep-2022 11:05                4434
class.swoole-mmap.php                              30-Sep-2022 11:05                2842
class.swoole-mysql-exception.php                   30-Sep-2022 11:05                4176
class.swoole-mysql.php                             30-Sep-2022 11:05                5119
class.swoole-process.php                           30-Sep-2022 11:05               11859
class.swoole-redis-server.php                      30-Sep-2022 11:05               26086
class.swoole-serialize.php                         30-Sep-2022 11:05                3353
class.swoole-server.php                            30-Sep-2022 11:05               24758
class.swoole-table.php                             30-Sep-2022 11:05               10961
class.swoole-timer.php                             30-Sep-2022 11:05                4479
class.swoole-websocket-frame.php                   30-Sep-2022 11:05                1863
class.swoole-websocket-server.php                  30-Sep-2022 11:05                6989
class.syncevent.php                                30-Sep-2022 11:05                4503
class.syncmutex.php                                30-Sep-2022 11:05                3901
class.syncreaderwriter.php                         30-Sep-2022 11:05                4789
class.syncsemaphore.php                            30-Sep-2022 11:05                4235
class.syncsharedmemory.php                         30-Sep-2022 11:05                4941
class.sysvmessagequeue.php                         30-Sep-2022 11:05                1914
class.sysvsemaphore.php                            30-Sep-2022 11:05                1910
class.sysvsharedmemory.php                         30-Sep-2022 11:05                1919
class.thread.php                                   30-Sep-2022 11:05               10171
class.threaded.php                                 30-Sep-2022 11:05                8096
class.throwable.php                                30-Sep-2022 11:04                7103
class.tidy.php                                     30-Sep-2022 11:05               17627
class.tidynode.php                                 30-Sep-2022 11:05               10714
class.transliterator.php                           30-Sep-2022 11:04                8743
class.traversable.php                              30-Sep-2022 11:04                4050
class.typeerror.php                                30-Sep-2022 11:04                7792
class.uconverter.php                               30-Sep-2022 11:04               32825
class.ui-area.php                                  30-Sep-2022 11:05               11106
class.ui-control.php                               30-Sep-2022 11:05                5206
class.ui-controls-box.php                          30-Sep-2022 11:05                9128
class.ui-controls-button.php                       30-Sep-2022 11:05                6230
class.ui-controls-check.php                        30-Sep-2022 11:05                6956
class.ui-controls-colorbutton.php                  30-Sep-2022 11:05                6266
class.ui-controls-combo.php                        30-Sep-2022 11:05                6202
class.ui-controls-editablecombo.php                30-Sep-2022 11:05                6310
class.ui-controls-entry.php                        30-Sep-2022 11:05                8699
class.ui-controls-form.php                         30-Sep-2022 11:05                7320
class.ui-controls-grid.php                         30-Sep-2022 11:05               11289
class.ui-controls-group.php                        30-Sep-2022 11:05                7794
class.ui-controls-label.php                        30-Sep-2022 11:05                5981
class.ui-controls-multilineentry.php               30-Sep-2022 11:05                8982
class.ui-controls-picker.php                       30-Sep-2022 11:05                6864
class.ui-controls-progress.php                     30-Sep-2022 11:05                5546
class.ui-controls-radio.php                        30-Sep-2022 11:05                6181
class.ui-controls-separator.php                    30-Sep-2022 11:05                6482
class.ui-controls-slider.php                       30-Sep-2022 11:05                6513
class.ui-controls-spin.php                         30-Sep-2022 11:05                6383
class.ui-controls-tab.php                          30-Sep-2022 11:05                8245
class.ui-draw-brush-gradient.php                   30-Sep-2022 11:05                6324
class.ui-draw-brush-lineargradient.php             30-Sep-2022 11:05                5683
class.ui-draw-brush-radialgradient.php             30-Sep-2022 11:05                5811
class.ui-draw-brush.php                            30-Sep-2022 11:05                4176
class.ui-draw-color.php                            30-Sep-2022 11:05                7715
class.ui-draw-line-cap.php                         30-Sep-2022 11:05                2403
class.ui-draw-line-join.php                        30-Sep-2022 11:05                2363
class.ui-draw-matrix.php                           30-Sep-2022 11:05                5415
class.ui-draw-path.php                             30-Sep-2022 11:05                9446
class.ui-draw-pen.php                              30-Sep-2022 11:05                7923
class.ui-draw-stroke.php                           30-Sep-2022 11:05                6094
class.ui-draw-text-font-descriptor.php             30-Sep-2022 11:05                5368
class.ui-draw-text-font-italic.php                 30-Sep-2022 11:05                2593
class.ui-draw-text-font-stretch.php                30-Sep-2022 11:05                3992
class.ui-draw-text-font-weight.php                 30-Sep-2022 11:05                3971
class.ui-draw-text-font.php                        30-Sep-2022 11:05                4491
class.ui-draw-text-layout.php                      30-Sep-2022 11:05                4725
class.ui-exception-invalidargumentexception.php    30-Sep-2022 11:05                6867
class.ui-exception-runtimeexception.php            30-Sep-2022 11:05                6790
class.ui-executor.php                              30-Sep-2022 11:05                4826
class.ui-key.php                                   30-Sep-2022 11:05                9135
class.ui-menu.php                                  30-Sep-2022 11:05                5720
class.ui-menuitem.php                              30-Sep-2022 11:05                3552
class.ui-point.php                                 30-Sep-2022 11:05                5818
class.ui-size.php                                  30-Sep-2022 11:05                5914
class.ui-window.php                                30-Sep-2022 11:05               11817
class.underflowexception.php                       30-Sep-2022 11:05                6865
class.unexpectedvalueexception.php                 30-Sep-2022 11:05                6991
class.unhandledmatcherror.php                      30-Sep-2022 11:04                6645
class.unitenum.php                                 30-Sep-2022 11:04                2733
class.v8js.php                                     30-Sep-2022 11:05                7958
class.v8jsexception.php                            30-Sep-2022 11:05               10196
class.valueerror.php                               30-Sep-2022 11:04                6725
class.variant.php                                  30-Sep-2022 11:05                5790
class.varnishadmin.php                             30-Sep-2022 11:05               10252
class.varnishlog.php                               30-Sep-2022 11:05               28344
class.varnishstat.php                              30-Sep-2022 11:05                2826
class.volatile.php                                 30-Sep-2022 11:05               11464
class.vtiful-kernel-excel.php                      30-Sep-2022 11:05               10447
class.vtiful-kernel-format.php                     30-Sep-2022 11:05               13139
class.weakmap.php                                  30-Sep-2022 11:04                9482
class.weakreference.php                            30-Sep-2022 11:04                4562
class.win32serviceexception.php                    30-Sep-2022 11:05                6965
class.wkhtmltox-image-converter.php                30-Sep-2022 11:05                3825
class.wkhtmltox-pdf-converter.php                  30-Sep-2022 11:05                4230
class.wkhtmltox-pdf-object.php                     30-Sep-2022 11:05                2810
class.worker.php                                   30-Sep-2022 11:05                8250
class.xmldiff-base.php                             30-Sep-2022 11:05                4328
class.xmldiff-dom.php                              30-Sep-2022 11:05                5323
class.xmldiff-file.php                             30-Sep-2022 11:05                4934
class.xmldiff-memory.php                           30-Sep-2022 11:05                4950
class.xmlparser.php                                30-Sep-2022 11:05                1822
class.xmlreader.php                                30-Sep-2022 11:05               32939
class.xmlwriter.php                                30-Sep-2022 11:05               25657
class.xsltprocessor.php                            30-Sep-2022 11:05                9230
class.yac.php                                      30-Sep-2022 11:04                8631
class.yaconf.php                                   30-Sep-2022 11:05                3391
class.yaf-action-abstract.php                      30-Sep-2022 11:05               11690
class.yaf-application.php                          30-Sep-2022 11:05               12814
class.yaf-bootstrap-abstract.php                   30-Sep-2022 11:05                6305
class.yaf-config-abstract.php                      30-Sep-2022 11:05                5159
class.yaf-config-ini.php                           30-Sep-2022 11:05               17107
class.yaf-config-simple.php                        30-Sep-2022 11:05               12002
class.yaf-controller-abstract.php                  30-Sep-2022 11:05               19246
class.yaf-dispatcher.php                           30-Sep-2022 11:05               19893
class.yaf-exception-dispatchfailed.php             30-Sep-2022 11:05                2552
class.yaf-exception-loadfailed-action.php          30-Sep-2022 11:05                2623
class.yaf-exception-loadfailed-controller.php      30-Sep-2022 11:05                2648
class.yaf-exception-loadfailed-module.php          30-Sep-2022 11:05                2612
class.yaf-exception-loadfailed-view.php            30-Sep-2022 11:05                2552
class.yaf-exception-loadfailed.php                 30-Sep-2022 11:05                2526
class.yaf-exception-routerfailed.php               30-Sep-2022 11:05                2537
class.yaf-exception-startuperror.php               30-Sep-2022 11:05                2535
class.yaf-exception-typeerror.php                  30-Sep-2022 11:05                2506
class.yaf-exception.php                            30-Sep-2022 11:05                7536
class.yaf-loader.php                               30-Sep-2022 11:05               19116
class.yaf-plugin-abstract.php                      30-Sep-2022 11:05               18230
class.yaf-registry.php                             30-Sep-2022 11:05                5736
class.yaf-request-abstract.php                     30-Sep-2022 11:05               21864
class.yaf-request-http.php                         30-Sep-2022 11:05               20878
class.yaf-request-simple.php                       30-Sep-2022 11:05               19859
class.yaf-response-abstract.php                    30-Sep-2022 11:05               10723
class.yaf-route-interface.php                      30-Sep-2022 11:05                3468
class.yaf-route-map.php                            30-Sep-2022 11:05                6271
class.yaf-route-regex.php                          30-Sep-2022 11:05                7527
class.yaf-route-rewrite.php                        30-Sep-2022 11:05                6868
class.yaf-route-simple.php                         30-Sep-2022 11:05                6177
class.yaf-route-static.php                         30-Sep-2022 11:05                4831
class.yaf-route-supervar.php                       30-Sep-2022 11:05                4375
class.yaf-router.php                               30-Sep-2022 11:05               12436
class.yaf-session.php                              30-Sep-2022 11:05               11410
class.yaf-view-interface.php                       30-Sep-2022 11:05                5444
class.yaf-view-simple.php                          30-Sep-2022 11:05               10083
class.yar-client-exception.php                     30-Sep-2022 11:05                6061
class.yar-client.php                               30-Sep-2022 11:05                5487
class.yar-concurrent-client.php                    30-Sep-2022 11:05                6180
class.yar-server-exception.php                     30-Sep-2022 11:05                6492
class.yar-server.php                               30-Sep-2022 11:05                3307
class.ziparchive.php                               30-Sep-2022 11:04               40202
class.zmq.php                                      30-Sep-2022 11:05               35522
class.zmqcontext.php                               30-Sep-2022 11:05                5121
class.zmqdevice.php                                30-Sep-2022 11:05                7096
class.zmqpoll.php                                  30-Sep-2022 11:05                4807
class.zmqsocket.php                                30-Sep-2022 11:05               10131
class.zookeeper.php                                30-Sep-2022 11:05               46816
class.zookeeperauthenticationexception.php         30-Sep-2022 11:05                6797
class.zookeeperconfig.php                          30-Sep-2022 11:05                5386
class.zookeeperconnectionexception.php             30-Sep-2022 11:05                6792
class.zookeeperexception.php                       30-Sep-2022 11:05                6658
class.zookeepermarshallingexception.php            30-Sep-2022 11:05                6813
class.zookeepernonodeexception.php                 30-Sep-2022 11:05                6780
class.zookeeperoperationtimeoutexception.php       30-Sep-2022 11:05                6823
class.zookeepersessionexception.php                30-Sep-2022 11:05                6770
classobj.configuration.php                         30-Sep-2022 11:05                1238
classobj.constants.php                             30-Sep-2022 11:05                1167
classobj.examples.php                              30-Sep-2022 11:05               15103
classobj.installation.php                          30-Sep-2022 11:05                1266
classobj.requirements.php                          30-Sep-2022 11:05                1211
classobj.resources.php                             30-Sep-2022 11:05                1224
classobj.setup.php                                 30-Sep-2022 11:05                1598
closure.bind.php                                   30-Sep-2022 11:04                7725
closure.bindto.php                                 30-Sep-2022 11:04                9329
closure.call.php                                   30-Sep-2022 11:04                6644
closure.construct.php                              30-Sep-2022 11:04                2449
closure.fromcallable.php                           30-Sep-2022 11:04                3891
cmark.installation.php                             30-Sep-2022 11:05                1944
cmark.requirements.php                             30-Sep-2022 11:05                1275
cmark.setup.php                                    30-Sep-2022 11:05                1402
collator.asort.php                                 30-Sep-2022 11:04                9173
collator.compare.php                               30-Sep-2022 11:04               10620
collator.construct.php                             30-Sep-2022 11:04                5653
collator.create.php                                30-Sep-2022 11:04                5523
collator.getattribute.php                          30-Sep-2022 11:04                5915
collator.geterrorcode.php                          30-Sep-2022 11:04                5275
collator.geterrormessage.php                       30-Sep-2022 11:04                5347
collator.getlocale.php                             30-Sep-2022 11:04                6681
collator.getsortkey.php                            30-Sep-2022 11:04                6759
collator.getstrength.php                           30-Sep-2022 11:04                4814
collator.setattribute.php                          30-Sep-2022 11:04                6483
collator.setstrength.php                           30-Sep-2022 11:04               13247
collator.sort.php                                  30-Sep-2022 11:04                7933
collator.sortwithsortkeys.php                      30-Sep-2022 11:04                6449
collectable.isgarbage.php                          30-Sep-2022 11:05                2730
com.configuration.php                              30-Sep-2022 11:05                8365
com.constants.php                                  30-Sep-2022 11:05               19372
com.construct.php                                  30-Sep-2022 11:05                9118
com.error-handling.php                             30-Sep-2022 11:05                1566
com.examples.arrays.php                            30-Sep-2022 11:05                2350
com.examples.foreach.php                           30-Sep-2022 11:05                3089
com.examples.php                                   30-Sep-2022 11:05                1439
com.installation.php                               30-Sep-2022 11:05                1614
com.requirements.php                               30-Sep-2022 11:05                1257
com.resources.php                                  30-Sep-2022 11:05                1189
com.setup.php                                      30-Sep-2022 11:05                1551
commonmark-cql.construct.php                       30-Sep-2022 11:05                2131
commonmark-cql.invoke.php                          30-Sep-2022 11:05                3748
commonmark-interfaces-ivisitable.accept.php        30-Sep-2022 11:05                3112
commonmark-interfaces-ivisitor.enter.php           30-Sep-2022 11:05                4115
commonmark-interfaces-ivisitor.leave.php           30-Sep-2022 11:05                4117
commonmark-node-bulletlist.construct.php           30-Sep-2022 11:05                3020
commonmark-node-codeblock.construct.php            30-Sep-2022 11:05                2726
commonmark-node-heading.construct.php              30-Sep-2022 11:05                2577
commonmark-node-image.construct.php                30-Sep-2022 11:05                3109
commonmark-node-link.construct.php                 30-Sep-2022 11:05                3106
commonmark-node-orderedlist.construct.php          30-Sep-2022 11:05                3830
commonmark-node-text.construct.php                 30-Sep-2022 11:05                2610
commonmark-node.accept.php                         30-Sep-2022 11:05                2852
commonmark-node.appendchild.php                    30-Sep-2022 11:05                2714
commonmark-node.insertafter.php                    30-Sep-2022 11:05                2739
commonmark-node.insertbefore.php                   30-Sep-2022 11:05                2737
commonmark-node.prependchild.php                   30-Sep-2022 11:05                2741
commonmark-node.replace.php                        30-Sep-2022 11:05                2685
commonmark-node.unlink.php                         30-Sep-2022 11:05                2364
commonmark-parser.construct.php                    30-Sep-2022 11:05                3262
commonmark-parser.finish.php                       30-Sep-2022 11:05                2419
commonmark-parser.parse.php                        30-Sep-2022 11:05                2559
compersisthelper.construct.php                     30-Sep-2022 11:05                3466
compersisthelper.getcurfilename.php                30-Sep-2022 11:05                3040
compersisthelper.getmaxstreamsize.php              30-Sep-2022 11:05                3074
compersisthelper.initnew.php                       30-Sep-2022 11:05                2941
compersisthelper.loadfromfile.php                  30-Sep-2022 11:05                4037
compersisthelper.loadfromstream.php                30-Sep-2022 11:05                3305
compersisthelper.savetofile.php                    30-Sep-2022 11:05                5938
compersisthelper.savetostream.php                  30-Sep-2022 11:05                3332
componere-abstract-definition.addinterface.php     30-Sep-2022 11:04                3264
componere-abstract-definition.addmethod.php        30-Sep-2022 11:04                4038
componere-abstract-definition.addtrait.php         30-Sep-2022 11:04                3216
componere-abstract-definition.getreflector.php     30-Sep-2022 11:04                2362
componere-definition.addconstant.php               30-Sep-2022 11:04                4338
componere-definition.addproperty.php               30-Sep-2022 11:04                3733
componere-definition.construct.php                 30-Sep-2022 11:04                5497
componere-definition.getclosure.php                30-Sep-2022 11:04                3398
componere-definition.getclosures.php               30-Sep-2022 11:04                2630
componere-definition.isregistered.php              30-Sep-2022 11:04                2185
componere-definition.register.php                  30-Sep-2022 11:04                2408
componere-method.construct.php                     30-Sep-2022 11:04                2187
componere-method.getreflector.php                  30-Sep-2022 11:04                2165
componere-method.setprivate.php                    30-Sep-2022 11:04                2433
componere-method.setprotected.php                  30-Sep-2022 11:04                2448
componere-method.setstatic.php                     30-Sep-2022 11:04                2023
componere-patch.apply.php                          30-Sep-2022 11:04                1822
componere-patch.construct.php                      30-Sep-2022 11:04                3439
componere-patch.derive.php                         30-Sep-2022 11:04                3175
componere-patch.getclosure.php                     30-Sep-2022 11:04                2984
componere-patch.getclosures.php                    30-Sep-2022 11:04                2107
componere-patch.isapplied.php                      30-Sep-2022 11:04                1742
componere-patch.revert.php                         30-Sep-2022 11:04                1819
componere-value.construct.php                      30-Sep-2022 11:04                2627
componere-value.hasdefault.php                     30-Sep-2022 11:04                1789
componere-value.isprivate.php                      30-Sep-2022 11:04                1807
componere-value.isprotected.php                    30-Sep-2022 11:04                1817
componere-value.isstatic.php                       30-Sep-2022 11:04                1801
componere-value.setprivate.php                     30-Sep-2022 11:04                2455
componere-value.setprotected.php                   30-Sep-2022 11:04                2469
componere-value.setstatic.php                      30-Sep-2022 11:04                2039
componere.cast.php                                 30-Sep-2022 11:04                4926
componere.cast_by_ref.php                          30-Sep-2022 11:04                5103
componere.installation.php                         30-Sep-2022 11:04                1313
componere.requirements.php                         30-Sep-2022 11:04                1165
componere.setup.php                                30-Sep-2022 11:04                1441
configuration.changes.modes.php                    30-Sep-2022 11:04                4033
configuration.changes.php                          30-Sep-2022 11:04                9596
configuration.file.per-user.php                    30-Sep-2022 11:04                3352
configuration.file.php                             30-Sep-2022 11:04               10632
configuration.php                                  30-Sep-2022 11:04                1705
configure.about.php                                30-Sep-2022 11:05               13088
configure.php                                      30-Sep-2022 11:05                1413
context.curl.php                                   30-Sep-2022 11:04                9378
context.ftp.php                                    30-Sep-2022 11:04                4270
context.http.php                                   30-Sep-2022 11:04               16779
context.params.php                                 30-Sep-2022 11:04                2509
context.phar.php                                   30-Sep-2022 11:04                2809
context.php                                        30-Sep-2022 11:04                2985
context.socket.php                                 30-Sep-2022 11:04               10487
context.ssl.php                                    30-Sep-2022 11:04               11663
context.zip.php                                    30-Sep-2022 11:04                4531
control-structures.alternative-syntax.php          30-Sep-2022 11:04                7321
control-structures.break.php                       30-Sep-2022 11:04                5579
control-structures.continue.php                    30-Sep-2022 11:04                7795
control-structures.declare.php                     30-Sep-2022 11:04               10727
control-structures.do.while.php                    30-Sep-2022 11:04                5523
control-structures.else.php                        30-Sep-2022 11:04                4997
control-structures.elseif.php                      30-Sep-2022 11:04                7920
control-structures.for.php                         30-Sep-2022 11:04               12745
control-structures.foreach.php                     30-Sep-2022 11:04               23494
control-structures.goto.php                        30-Sep-2022 11:04                7265
control-structures.if.php                          30-Sep-2022 11:04                5028
control-structures.intro.php                       30-Sep-2022 11:04                2699
control-structures.match.php                       30-Sep-2022 11:04               19514
control-structures.switch.php                      30-Sep-2022 11:04               22559
control-structures.while.php                       30-Sep-2022 11:04                4839
copyright.php                                      30-Sep-2022 11:04                2057
countable.count.php                                30-Sep-2022 11:05                5582
csprng.configuration.php                           30-Sep-2022 11:04                1224
csprng.constants.php                               30-Sep-2022 11:04                1148
csprng.installation.php                            30-Sep-2022 11:04                1252
csprng.requirements.php                            30-Sep-2022 11:04                1197
csprng.resources.php                               30-Sep-2022 11:04                1210
csprng.setup.php                                   30-Sep-2022 11:04                1566
ctype.configuration.php                            30-Sep-2022 11:05                1217
ctype.constants.php                                30-Sep-2022 11:05                1139
ctype.installation.php                             30-Sep-2022 11:05                1474
ctype.requirements.php                             30-Sep-2022 11:05                1236
ctype.resources.php                                30-Sep-2022 11:05                1203
ctype.setup.php                                    30-Sep-2022 11:05                1563
cubrid.configuration.php                           30-Sep-2022 11:04                1248
cubrid.constants.php                               30-Sep-2022 11:04               15710
cubrid.examples.php                                30-Sep-2022 11:04               21867
cubrid.installation.php                            30-Sep-2022 11:04                2254
cubrid.requirements.php                            30-Sep-2022 11:04                1260
cubrid.resources.php                               30-Sep-2022 11:04                3322
cubrid.setup.php                                   30-Sep-2022 11:04                1579
cubridmysql.cubrid.php                             30-Sep-2022 11:04                5577
curl.configuration.php                             30-Sep-2022 11:05                2471
curl.constants.php                                 30-Sep-2022 11:05              101683
curl.examples-basic.php                            30-Sep-2022 11:05                4689
curl.examples.php                                  30-Sep-2022 11:05                1334
curl.installation.php                              30-Sep-2022 11:05                2557
curl.requirements.php                              30-Sep-2022 11:05                1473
curl.resources.php                                 30-Sep-2022 11:05                1412
curl.setup.php                                     30-Sep-2022 11:05                1572
curlfile.construct.php                             30-Sep-2022 11:05               21147
curlfile.getfilename.php                           30-Sep-2022 11:05                2087
curlfile.getmimetype.php                           30-Sep-2022 11:05                2083
curlfile.getpostfilename.php                       30-Sep-2022 11:05                2145
curlfile.setmimetype.php                           30-Sep-2022 11:05                2357
curlfile.setpostfilename.php                       30-Sep-2022 11:05                2410
curlstringfile.construct.php                       30-Sep-2022 11:05                6872
dateinterval.construct.php                         30-Sep-2022 11:04               13200
dateinterval.createfromdatestring.php              30-Sep-2022 11:04                8783
dateinterval.format.php                            30-Sep-2022 11:04               14888
dateperiod.construct.php                           30-Sep-2022 11:04               13868
dateperiod.getdateinterval.php                     30-Sep-2022 11:04                4737
dateperiod.getenddate.php                          30-Sep-2022 11:04                7647
dateperiod.getrecurrences.php                      30-Sep-2022 11:04                2635
dateperiod.getstartdate.php                        30-Sep-2022 11:04                5116
datetime.add.php                                   30-Sep-2022 11:04                4989
datetime.configuration.php                         30-Sep-2022 11:04                5757
datetime.constants.php                             30-Sep-2022 11:04                2559
datetime.construct.php                             30-Sep-2022 11:04                5108
datetime.createfromformat.php                      30-Sep-2022 11:04               29601
datetime.createfromimmutable.php                   30-Sep-2022 11:04                4328
datetime.createfrominterface.php                   30-Sep-2022 11:04                4891
datetime.diff.php                                  30-Sep-2022 11:04               12445
datetime.examples-arithmetic.php                   30-Sep-2022 11:04               16217
datetime.examples.php                              30-Sep-2022 11:04                1419
datetime.format.php                                30-Sep-2022 11:04               23501
datetime.formats.compound.php                      30-Sep-2022 11:04                9668
datetime.formats.date.php                          30-Sep-2022 11:04               16462
datetime.formats.php                               30-Sep-2022 11:04                7734
datetime.formats.relative.php                      30-Sep-2022 11:04               16135
datetime.formats.time.php                          30-Sep-2022 11:04                7476
datetime.getlasterrors.php                         30-Sep-2022 11:04                3525
datetime.getoffset.php                             30-Sep-2022 11:04                8259
datetime.gettimestamp.php                          30-Sep-2022 11:04                7137
datetime.gettimezone.php                           30-Sep-2022 11:04                7710
datetime.installation.php                          30-Sep-2022 11:04                1687
datetime.modify.php                                30-Sep-2022 11:04               10535
datetime.requirements.php                          30-Sep-2022 11:04                1211
datetime.resources.php                             30-Sep-2022 11:04                1224
datetime.set-state.php                             30-Sep-2022 11:04                2955
datetime.setdate.php                               30-Sep-2022 11:04                5367
datetime.setisodate.php                            30-Sep-2022 11:04                5501
datetime.settime.php                               30-Sep-2022 11:04                6747
datetime.settimestamp.php                          30-Sep-2022 11:04                5046
datetime.settimezone.php                           30-Sep-2022 11:04                9603
datetime.setup.php                                 30-Sep-2022 11:04                1627
datetime.sub.php                                   30-Sep-2022 11:04                4913
datetime.wakeup.php                                30-Sep-2022 11:04                2939
datetimeimmutable.add.php                          30-Sep-2022 11:04               10886
datetimeimmutable.construct.php                    30-Sep-2022 11:04               18400
datetimeimmutable.createfromformat.php             30-Sep-2022 11:04                4150
datetimeimmutable.createfrominterface.php          30-Sep-2022 11:04                5155
datetimeimmutable.createfrommutable.php            30-Sep-2022 11:04                4485
datetimeimmutable.getlasterrors.php                30-Sep-2022 11:04                5018
datetimeimmutable.modify.php                       30-Sep-2022 11:04                8413
datetimeimmutable.set-state.php                    30-Sep-2022 11:04                2719
datetimeimmutable.setdate.php                      30-Sep-2022 11:04                9240
datetimeimmutable.setisodate.php                   30-Sep-2022 11:04               12970
datetimeimmutable.settime.php                      30-Sep-2022 11:04               12143
datetimeimmutable.settimestamp.php                 30-Sep-2022 11:04                5914
datetimeimmutable.settimezone.php                  30-Sep-2022 11:04                6109
datetimeimmutable.sub.php                          30-Sep-2022 11:04               11080
datetimezone.construct.php                         30-Sep-2022 11:04               10223
datetimezone.getlocation.php                       30-Sep-2022 11:04                5839
datetimezone.getname.php                           30-Sep-2022 11:04                3079
datetimezone.getoffset.php                         30-Sep-2022 11:04                8164
datetimezone.gettransitions.php                    30-Sep-2022 11:04               11116
datetimezone.listabbreviations.php                 30-Sep-2022 11:04                6097
datetimezone.listidentifiers.php                   30-Sep-2022 11:04                7437
dba.configuration.php                              30-Sep-2022 11:04                2244
dba.constants.php                                  30-Sep-2022 11:04                1121
dba.example.php                                    30-Sep-2022 11:04                6903
dba.examples.php                                   30-Sep-2022 11:04                1297
dba.installation.php                               30-Sep-2022 11:04               10689
dba.requirements.php                               30-Sep-2022 11:04                7749
dba.resources.php                                  30-Sep-2022 11:04                1505
dba.setup.php                                      30-Sep-2022 11:04                1556
dbase.configuration.php                            30-Sep-2022 11:04                1217
dbase.constants.php                                30-Sep-2022 11:04                3175
dbase.installation.php                             30-Sep-2022 11:04                1713
dbase.requirements.php                             30-Sep-2022 11:04                1190
dbase.resources.php                                30-Sep-2022 11:04                1492
dbase.setup.php                                    30-Sep-2022 11:04                1577
debugger-about.php                                 30-Sep-2022 11:05                1846
debugger.php                                       30-Sep-2022 11:05                1378
dio.configuration.php                              30-Sep-2022 11:04                1203
dio.constants.php                                  30-Sep-2022 11:04                7234
dio.installation.php                               30-Sep-2022 11:04                2191
dio.requirements.php                               30-Sep-2022 11:04                1176
dio.resources.php                                  30-Sep-2022 11:04                1356
dio.setup.php                                      30-Sep-2022 11:04                1558
dir.configuration.php                              30-Sep-2022 11:04                1203
dir.constants.php                                  30-Sep-2022 11:04                2180
dir.installation.php                               30-Sep-2022 11:04                1231
dir.requirements.php                               30-Sep-2022 11:04                1176
dir.resources.php                                  30-Sep-2022 11:04                1189
dir.setup.php                                      30-Sep-2022 11:04                1551
directory.close.php                                30-Sep-2022 11:04                2149
directory.read.php                                 30-Sep-2022 11:04                2229
directory.rewind.php                               30-Sep-2022 11:04                2175
directoryiterator.construct.php                    30-Sep-2022 11:05                5926
directoryiterator.current.php                      30-Sep-2022 11:05                6416
directoryiterator.getatime.php                     30-Sep-2022 11:05                5843
directoryiterator.getbasename.php                  30-Sep-2022 11:05                6747
directoryiterator.getctime.php                     30-Sep-2022 11:05                5897
directoryiterator.getextension.php                 30-Sep-2022 11:05                6307
directoryiterator.getfilename.php                  30-Sep-2022 11:05                5440
directoryiterator.getgroup.php                     30-Sep-2022 11:05                6045
directoryiterator.getinode.php                     30-Sep-2022 11:05                4562
directoryiterator.getmtime.php                     30-Sep-2022 11:05                5753
directoryiterator.getowner.php                     30-Sep-2022 11:05                5242
directoryiterator.getpath.php                      30-Sep-2022 11:05                4913
directoryiterator.getpathname.php                  30-Sep-2022 11:05                5242
directoryiterator.getperms.php                     30-Sep-2022 11:05                6036
directoryiterator.getsize.php                      30-Sep-2022 11:05                4956
directoryiterator.gettype.php                      30-Sep-2022 11:05                5653
directoryiterator.isdir.php                        30-Sep-2022 11:05                5518
directoryiterator.isdot.php                        30-Sep-2022 11:05                5711
directoryiterator.isexecutable.php                 30-Sep-2022 11:05                5652
directoryiterator.isfile.php                       30-Sep-2022 11:05                5708
directoryiterator.islink.php                       30-Sep-2022 11:05                7394
directoryiterator.isreadable.php                   30-Sep-2022 11:05                5351
directoryiterator.iswritable.php                   30-Sep-2022 11:05                5685
directoryiterator.key.php                          30-Sep-2022 11:05                6814
directoryiterator.next.php                         30-Sep-2022 11:05                5585
directoryiterator.rewind.php                       30-Sep-2022 11:05                5493
directoryiterator.seek.php                         30-Sep-2022 11:05                5528
directoryiterator.tostring.php                     30-Sep-2022 11:05                4629
directoryiterator.valid.php                        30-Sep-2022 11:05                5757
doc.changelog.php                                  30-Sep-2022 11:05              305140
dom.configuration.php                              30-Sep-2022 11:05                1203
dom.constants.php                                  30-Sep-2022 11:05               14634
dom.examples.php                                   30-Sep-2022 11:05                2988
dom.installation.php                               30-Sep-2022 11:05                1302
dom.requirements.php                               30-Sep-2022 11:05                1500
dom.resources.php                                  30-Sep-2022 11:05                1189
dom.setup.php                                      30-Sep-2022 11:05                1543
domattr.construct.php                              30-Sep-2022 11:05                5649
domattr.isid.php                                   30-Sep-2022 11:05                5093
domcdatasection.construct.php                      30-Sep-2022 11:05                5210
domcharacterdata.appenddata.php                    30-Sep-2022 11:05                3758
domcharacterdata.deletedata.php                    30-Sep-2022 11:05                4883
domcharacterdata.insertdata.php                    30-Sep-2022 11:05                4509
domcharacterdata.replacedata.php                   30-Sep-2022 11:05                5255
domcharacterdata.substringdata.php                 30-Sep-2022 11:05                4866
domchildnode.after.php                             30-Sep-2022 11:05                3507
domchildnode.before.php                            30-Sep-2022 11:05                3316
domchildnode.remove.php                            30-Sep-2022 11:05                3120
domchildnode.replacewith.php                       30-Sep-2022 11:05                3722
domcomment.construct.php                           30-Sep-2022 11:05                5115
domdocument.construct.php                          30-Sep-2022 11:05                4347
domdocument.createattribute.php                    30-Sep-2022 11:05                6007
domdocument.createattributens.php                  30-Sep-2022 11:05                6898
domdocument.createcdatasection.php                 30-Sep-2022 11:05                5669
domdocument.createcomment.php                      30-Sep-2022 11:05                6084
domdocument.createdocumentfragment.php             30-Sep-2022 11:05                5983
domdocument.createelement.php                      30-Sep-2022 11:05               11795
domdocument.createelementns.php                    30-Sep-2022 11:05               14424
domdocument.createentityreference.php              30-Sep-2022 11:05                6305
domdocument.createprocessinginstruction.php        30-Sep-2022 11:05                6583
domdocument.createtextnode.php                     30-Sep-2022 11:05                6069
domdocument.getelementbyid.php                     30-Sep-2022 11:05                7780
domdocument.getelementsbytagname.php               30-Sep-2022 11:05                6256
domdocument.getelementsbytagnamens.php             30-Sep-2022 11:05                7785
domdocument.importnode.php                         30-Sep-2022 11:05                9150
domdocument.load.php                               30-Sep-2022 11:05                6379
domdocument.loadhtml.php                           30-Sep-2022 11:05                7136
domdocument.loadhtmlfile.php                       30-Sep-2022 11:05                6833
domdocument.loadxml.php                            30-Sep-2022 11:05                7098
domdocument.normalizedocument.php                  30-Sep-2022 11:05                3008
domdocument.registernodeclass.php                  30-Sep-2022 11:05               19782
domdocument.relaxngvalidate.php                    30-Sep-2022 11:05                3929
domdocument.relaxngvalidatesource.php              30-Sep-2022 11:05                3973
domdocument.save.php                               30-Sep-2022 11:05                7604
domdocument.savehtml.php                           30-Sep-2022 11:05                7488
domdocument.savehtmlfile.php                       30-Sep-2022 11:05                8212
domdocument.savexml.php                            30-Sep-2022 11:05                9126
domdocument.schemavalidate.php                     30-Sep-2022 11:05                4272
domdocument.schemavalidatesource.php               30-Sep-2022 11:05                4317
domdocument.validate.php                           30-Sep-2022 11:05                6091
domdocument.xinclude.php                           30-Sep-2022 11:05                7260
domdocumentfragment.appendxml.php                  30-Sep-2022 11:05                5341
domdocumentfragment.construct.php                  30-Sep-2022 11:05                2090
domelement.construct.php                           30-Sep-2022 11:05                6686
domelement.getattribute.php                        30-Sep-2022 11:05                3488
domelement.getattributenode.php                    30-Sep-2022 11:05                4020
domelement.getattributenodens.php                  30-Sep-2022 11:05                4436
domelement.getattributens.php                      30-Sep-2022 11:05                3998
domelement.getelementsbytagname.php                30-Sep-2022 11:05                3801
domelement.getelementsbytagnamens.php              30-Sep-2022 11:05                4378
domelement.hasattribute.php                        30-Sep-2022 11:05                3693
domelement.hasattributens.php                      30-Sep-2022 11:05                4082
domelement.removeattribute.php                     30-Sep-2022 11:05                3851
domelement.removeattributenode.php                 30-Sep-2022 11:05                4316
domelement.removeattributens.php                   30-Sep-2022 11:05                4276
domelement.setattribute.php                        30-Sep-2022 11:05                6067
domelement.setattributenode.php                    30-Sep-2022 11:05                4019
domelement.setattributenodens.php                  30-Sep-2022 11:05                4023
domelement.setattributens.php                      30-Sep-2022 11:05                5008
domelement.setidattribute.php                      30-Sep-2022 11:05                4652
domelement.setidattributenode.php                  30-Sep-2022 11:05                4710
domelement.setidattributens.php                    30-Sep-2022 11:05                5047
domentityreference.construct.php                   30-Sep-2022 11:05                4900
domimplementation.construct.php                    30-Sep-2022 11:05                2211
domimplementation.createdocument.php               30-Sep-2022 11:05                6872
domimplementation.createdocumenttype.php           30-Sep-2022 11:05                9478
domimplementation.hasfeature.php                   30-Sep-2022 11:05                9895
domnamednodemap.count.php                          30-Sep-2022 11:05                2432
domnamednodemap.getnameditem.php                   30-Sep-2022 11:05                3335
domnamednodemap.getnameditemns.php                 30-Sep-2022 11:05                3583
domnamednodemap.item.php                           30-Sep-2022 11:05                2865
domnode.appendchild.php                            30-Sep-2022 11:05                8636
domnode.c14n.php                                   30-Sep-2022 11:05                4486
domnode.c14nfile.php                               30-Sep-2022 11:05                4678
domnode.clonenode.php                              30-Sep-2022 11:05                2623
domnode.getlineno.php                              30-Sep-2022 11:05                4842
domnode.getnodepath.php                            30-Sep-2022 11:05                5244
domnode.hasattributes.php                          30-Sep-2022 11:05                2801
domnode.haschildnodes.php                          30-Sep-2022 11:05                2774
domnode.insertbefore.php                           30-Sep-2022 11:05                5108
domnode.isdefaultnamespace.php                     30-Sep-2022 11:05                2728
domnode.issamenode.php                             30-Sep-2022 11:05                2656
domnode.issupported.php                            30-Sep-2022 11:05                3680
domnode.lookupnamespaceuri.php                     30-Sep-2022 11:05                3013
domnode.lookupprefix.php                           30-Sep-2022 11:05                3004
domnode.normalize.php                              30-Sep-2022 11:05                2811
domnode.removechild.php                            30-Sep-2022 11:05                6939
domnode.replacechild.php                           30-Sep-2022 11:05                5479
domnodelist.count.php                              30-Sep-2022 11:05                2332
domnodelist.item.php                               30-Sep-2022 11:05                6865
domparentnode.append.php                           30-Sep-2022 11:05                3007
domparentnode.prepend.php                          30-Sep-2022 11:05                3040
domprocessinginstruction.construct.php             30-Sep-2022 11:05                6612
domtext.construct.php                              30-Sep-2022 11:05                4868
domtext.iselementcontentwhitespace.php             30-Sep-2022 11:05                2477
domtext.iswhitespaceinelementcontent.php           30-Sep-2022 11:05                2618
domtext.splittext.php                              30-Sep-2022 11:05                3200
domxpath.construct.php                             30-Sep-2022 11:05                2756
domxpath.evaluate.php                              30-Sep-2022 11:05                7609
domxpath.query.php                                 30-Sep-2022 11:05               12368
domxpath.registernamespace.php                     30-Sep-2022 11:05                3141
domxpath.registerphpfunctions.php                  30-Sep-2022 11:05               14441
dotnet.construct.php                               30-Sep-2022 11:05                2981
ds-collection.clear.php                            30-Sep-2022 11:05                4005
ds-collection.copy.php                             30-Sep-2022 11:05                4449
ds-collection.isempty.php                          30-Sep-2022 11:05                4265
ds-collection.toarray.php                          30-Sep-2022 11:05                4172
ds-deque.allocate.php                              30-Sep-2022 11:05                4629
ds-deque.apply.php                                 30-Sep-2022 11:05                5113
ds-deque.capacity.php                              30-Sep-2022 11:05                3937
ds-deque.clear.php                                 30-Sep-2022 11:05                3870
ds-deque.construct.php                             30-Sep-2022 11:05                4431
ds-deque.contains.php                              30-Sep-2022 11:05                7533
ds-deque.copy.php                                  30-Sep-2022 11:05                4249
ds-deque.count.php                                 30-Sep-2022 11:05                1529
ds-deque.filter.php                                30-Sep-2022 11:05                7546
ds-deque.find.php                                  30-Sep-2022 11:05                5499
ds-deque.first.php                                 30-Sep-2022 11:05                3853
ds-deque.get.php                                   30-Sep-2022 11:05                6711
ds-deque.insert.php                                30-Sep-2022 11:05                7053
ds-deque.isempty.php                               30-Sep-2022 11:05                4112
ds-deque.join.php                                  30-Sep-2022 11:05                5785
ds-deque.jsonserialize.php                         30-Sep-2022 11:05                1809
ds-deque.last.php                                  30-Sep-2022 11:05                3841
ds-deque.map.php                                   30-Sep-2022 11:05                5479
ds-deque.merge.php                                 30-Sep-2022 11:05                4938
ds-deque.pop.php                                   30-Sep-2022 11:05                4338
ds-deque.push.php                                  30-Sep-2022 11:05                4746
ds-deque.reduce.php                                30-Sep-2022 11:05                8721
ds-deque.remove.php                                30-Sep-2022 11:05                4901
ds-deque.reverse.php                               30-Sep-2022 11:05                3706
ds-deque.reversed.php                              30-Sep-2022 11:05                4064
ds-deque.rotate.php                                30-Sep-2022 11:05                5123
ds-deque.set.php                                   30-Sep-2022 11:05                6190
ds-deque.shift.php                                 30-Sep-2022 11:05                4439
ds-deque.slice.php                                 30-Sep-2022 11:05                7259
ds-deque.sort.php                                  30-Sep-2022 11:05                7519
ds-deque.sorted.php                                30-Sep-2022 11:05                7563
ds-deque.sum.php                                   30-Sep-2022 11:05                5168
ds-deque.toarray.php                               30-Sep-2022 11:05                4002
ds-deque.unshift.php                               30-Sep-2022 11:05                4826
ds-hashable.equals.php                             30-Sep-2022 11:05                3404
ds-hashable.hash.php                               30-Sep-2022 11:05                8559
ds-map.allocate.php                                30-Sep-2022 11:05                4495
ds-map.apply.php                                   30-Sep-2022 11:05                5885
ds-map.capacity.php                                30-Sep-2022 11:05                3222
ds-map.clear.php                                   30-Sep-2022 11:05                4426
ds-map.construct.php                               30-Sep-2022 11:05                4963
ds-map.copy.php                                    30-Sep-2022 11:05                4179
ds-map.count.php                                   30-Sep-2022 11:05                1490
ds-map.diff.php                                    30-Sep-2022 11:05                5665
ds-map.filter.php                                  30-Sep-2022 11:05                8411
ds-map.first.php                                   30-Sep-2022 11:05                4141
ds-map.get.php                                     30-Sep-2022 11:05                8725
ds-map.haskey.php                                  30-Sep-2022 11:05                4659
ds-map.hasvalue.php                                30-Sep-2022 11:05                4703
ds-map.intersect.php                               30-Sep-2022 11:05                6186
ds-map.isempty.php                                 30-Sep-2022 11:05                4364
ds-map.jsonserialize.php                           30-Sep-2022 11:05                1787
ds-map.keys.php                                    30-Sep-2022 11:05                4016
ds-map.ksort.php                                   30-Sep-2022 11:05                8251
ds-map.ksorted.php                                 30-Sep-2022 11:05                8357
ds-map.last.php                                    30-Sep-2022 11:05                4126
ds-map.map.php                                     30-Sep-2022 11:05                6519
ds-map.merge.php                                   30-Sep-2022 11:05                5903
ds-map.pairs.php                                   30-Sep-2022 11:05                4407
ds-map.put.php                                     30-Sep-2022 11:05               14906
ds-map.putall.php                                  30-Sep-2022 11:05                5533
ds-map.reduce.php                                  30-Sep-2022 11:05                9771
ds-map.remove.php                                  30-Sep-2022 11:05                7145
ds-map.reverse.php                                 30-Sep-2022 11:05                4188
ds-map.reversed.php                                30-Sep-2022 11:05                4304
ds-map.skip.php                                    30-Sep-2022 11:05                4625
ds-map.slice.php                                   30-Sep-2022 11:05                8160
ds-map.sort.php                                    30-Sep-2022 11:05                8169
ds-map.sorted.php                                  30-Sep-2022 11:05                8336
ds-map.sum.php                                     30-Sep-2022 11:05                5695
ds-map.toarray.php                                 30-Sep-2022 11:05                5023
ds-map.union.php                                   30-Sep-2022 11:05                6170
ds-map.values.php                                  30-Sep-2022 11:05                4010
ds-map.xor.php                                     30-Sep-2022 11:05                5727
ds-pair.clear.php                                  30-Sep-2022 11:05                3766
ds-pair.construct.php                              30-Sep-2022 11:05                2640
ds-pair.copy.php                                   30-Sep-2022 11:05                4168
ds-pair.isempty.php                                30-Sep-2022 11:05                4057
ds-pair.jsonserialize.php                          30-Sep-2022 11:05                1807
ds-pair.toarray.php                                30-Sep-2022 11:05                3927
ds-priorityqueue.allocate.php                      30-Sep-2022 11:05                4795
ds-priorityqueue.capacity.php                      30-Sep-2022 11:05                3431
ds-priorityqueue.clear.php                         30-Sep-2022 11:05                4537
ds-priorityqueue.construct.php                     30-Sep-2022 11:05                2946
ds-priorityqueue.copy.php                          30-Sep-2022 11:05                4552
ds-priorityqueue.count.php                         30-Sep-2022 11:05                1638
ds-priorityqueue.isempty.php                       30-Sep-2022 11:05                5032
ds-priorityqueue.jsonserialize.php                 30-Sep-2022 11:05                1927
ds-priorityqueue.peek.php                          30-Sep-2022 11:05                4841
ds-priorityqueue.pop.php                           30-Sep-2022 11:05                5611
ds-priorityqueue.push.php                          30-Sep-2022 11:05                5628
ds-priorityqueue.toarray.php                       30-Sep-2022 11:05                5111
ds-queue.allocate.php                              30-Sep-2022 11:05                4822
ds-queue.capacity.php                              30-Sep-2022 11:05                3943
ds-queue.clear.php                                 30-Sep-2022 11:05                3855
ds-queue.construct.php                             30-Sep-2022 11:05                4429
ds-queue.copy.php                                  30-Sep-2022 11:05                4386
ds-queue.count.php                                 30-Sep-2022 11:05                1526
ds-queue.isempty.php                               30-Sep-2022 11:05                4128
ds-queue.jsonserialize.php                         30-Sep-2022 11:05                1815
ds-queue.peek.php                                  30-Sep-2022 11:05                4425
ds-queue.pop.php                                   30-Sep-2022 11:05                4959
ds-queue.push.php                                  30-Sep-2022 11:05                4781
ds-queue.toarray.php                               30-Sep-2022 11:05                4162
ds-sequence.allocate.php                           30-Sep-2022 11:05                4533
ds-sequence.apply.php                              30-Sep-2022 11:05                5228
ds-sequence.capacity.php                           30-Sep-2022 11:05                4502
ds-sequence.contains.php                           30-Sep-2022 11:05                7660
ds-sequence.filter.php                             30-Sep-2022 11:05                7685
ds-sequence.find.php                               30-Sep-2022 11:05                5611
ds-sequence.first.php                              30-Sep-2022 11:05                3968
ds-sequence.get.php                                30-Sep-2022 11:05                6839
ds-sequence.insert.php                             30-Sep-2022 11:05                7172
ds-sequence.join.php                               30-Sep-2022 11:05                5881
ds-sequence.last.php                               30-Sep-2022 11:05                3935
ds-sequence.map.php                                30-Sep-2022 11:05                5608
ds-sequence.merge.php                              30-Sep-2022 11:05                5064
ds-sequence.pop.php                                30-Sep-2022 11:05                4450
ds-sequence.push.php                               30-Sep-2022 11:05                4868
ds-sequence.reduce.php                             30-Sep-2022 11:05                8840
ds-sequence.remove.php                             30-Sep-2022 11:05                5013
ds-sequence.reverse.php                            30-Sep-2022 11:05                3819
ds-sequence.reversed.php                           30-Sep-2022 11:05                4187
ds-sequence.rotate.php                             30-Sep-2022 11:05                5260
ds-sequence.set.php                                30-Sep-2022 11:05                6314
ds-sequence.shift.php                              30-Sep-2022 11:05                4551
ds-sequence.slice.php                              30-Sep-2022 11:05                7424
ds-sequence.sort.php                               30-Sep-2022 11:05                7646
ds-sequence.sorted.php                             30-Sep-2022 11:05                7690
ds-sequence.sum.php                                30-Sep-2022 11:05                5293
ds-sequence.unshift.php                            30-Sep-2022 11:05                4937
ds-set.add.php                                     30-Sep-2022 11:05               13090
ds-set.allocate.php                                30-Sep-2022 11:05                4508
ds-set.capacity.php                                30-Sep-2022 11:05                3896
ds-set.clear.php                                   30-Sep-2022 11:05                3801
ds-set.construct.php                               30-Sep-2022 11:05                4383
ds-set.contains.php                                30-Sep-2022 11:05                7490
ds-set.copy.php                                    30-Sep-2022 11:05                4325
ds-set.count.php                                   30-Sep-2022 11:05                1490
ds-set.diff.php                                    30-Sep-2022 11:05                4895
ds-set.filter.php                                  30-Sep-2022 11:05                7494
ds-set.first.php                                   30-Sep-2022 11:05                3806
ds-set.get.php                                     30-Sep-2022 11:05                6655
ds-set.intersect.php                               30-Sep-2022 11:05                5126
ds-set.isempty.php                                 30-Sep-2022 11:05                4070
ds-set.join.php                                    30-Sep-2022 11:05                5731
ds-set.jsonserialize.php                           30-Sep-2022 11:05                1781
ds-set.last.php                                    30-Sep-2022 11:05                3807
ds-set.merge.php                                   30-Sep-2022 11:05                4864
ds-set.reduce.php                                  30-Sep-2022 11:05                8667
ds-set.remove.php                                  30-Sep-2022 11:05                5257
ds-set.reverse.php                                 30-Sep-2022 11:05                3654
ds-set.reversed.php                                30-Sep-2022 11:05                4002
ds-set.slice.php                                   30-Sep-2022 11:05                7173
ds-set.sort.php                                    30-Sep-2022 11:05                7455
ds-set.sorted.php                                  30-Sep-2022 11:05                7499
ds-set.sum.php                                     30-Sep-2022 11:05                5108
ds-set.toarray.php                                 30-Sep-2022 11:05                3948
ds-set.union.php                                   30-Sep-2022 11:05                5089
ds-set.xor.php                                     30-Sep-2022 11:05                5061
ds-stack.allocate.php                              30-Sep-2022 11:05                2737
ds-stack.capacity.php                              30-Sep-2022 11:05                2093
ds-stack.clear.php                                 30-Sep-2022 11:05                3851
ds-stack.construct.php                             30-Sep-2022 11:05                4395
ds-stack.copy.php                                  30-Sep-2022 11:05                4386
ds-stack.count.php                                 30-Sep-2022 11:05                1526
ds-stack.isempty.php                               30-Sep-2022 11:05                4128
ds-stack.jsonserialize.php                         30-Sep-2022 11:05                1815
ds-stack.peek.php                                  30-Sep-2022 11:05                4419
ds-stack.pop.php                                   30-Sep-2022 11:05                4953
ds-stack.push.php                                  30-Sep-2022 11:05                4781
ds-stack.toarray.php                               30-Sep-2022 11:05                3989
ds-vector.allocate.php                             30-Sep-2022 11:05                4450
ds-vector.apply.php                                30-Sep-2022 11:05                5139
ds-vector.capacity.php                             30-Sep-2022 11:05                4407
ds-vector.clear.php                                30-Sep-2022 11:05                3882
ds-vector.construct.php                            30-Sep-2022 11:05                4463
ds-vector.contains.php                             30-Sep-2022 11:05                7563
ds-vector.copy.php                                 30-Sep-2022 11:05                4410
ds-vector.count.php                                30-Sep-2022 11:05                1543
ds-vector.filter.php                               30-Sep-2022 11:05                7580
ds-vector.find.php                                 30-Sep-2022 11:05                5524
ds-vector.first.php                                30-Sep-2022 11:05                3879
ds-vector.get.php                                  30-Sep-2022 11:05                6742
ds-vector.insert.php                               30-Sep-2022 11:05                7083
ds-vector.isempty.php                              30-Sep-2022 11:05                4136
ds-vector.join.php                                 30-Sep-2022 11:05                5812
ds-vector.jsonserialize.php                        30-Sep-2022 11:05                1823
ds-vector.last.php                                 30-Sep-2022 11:05                3866
ds-vector.map.php                                  30-Sep-2022 11:05                5511
ds-vector.merge.php                                30-Sep-2022 11:05                4969
ds-vector.pop.php                                  30-Sep-2022 11:05                4363
ds-vector.push.php                                 30-Sep-2022 11:05                4775
ds-vector.reduce.php                               30-Sep-2022 11:05                8749
ds-vector.remove.php                               30-Sep-2022 11:05                4926
ds-vector.reverse.php                              30-Sep-2022 11:05                3732
ds-vector.reversed.php                             30-Sep-2022 11:05                4094
ds-vector.rotate.php                               30-Sep-2022 11:05                5157
ds-vector.set.php                                  30-Sep-2022 11:05                6221
ds-vector.shift.php                                30-Sep-2022 11:05                4464
ds-vector.slice.php                                30-Sep-2022 11:05                7305
ds-vector.sort.php                                 30-Sep-2022 11:05                7551
ds-vector.sorted.php                               30-Sep-2022 11:05                7595
ds-vector.sum.php                                  30-Sep-2022 11:05                5198
ds-vector.toarray.php                              30-Sep-2022 11:05                4027
ds-vector.unshift.php                              30-Sep-2022 11:05                4856
ds.constants.php                                   30-Sep-2022 11:05                1122
ds.examples.php                                    30-Sep-2022 11:05                4914
ds.installation.php                                30-Sep-2022 11:05                2487
ds.requirements.php                                30-Sep-2022 11:05                1166
ds.setup.php                                       30-Sep-2022 11:05                1378
eio.configuration.php                              30-Sep-2022 11:05                1201
eio.constants.php                                  30-Sep-2022 11:05               16773
eio.examples.php                                   30-Sep-2022 11:05               30152
eio.installation.php                               30-Sep-2022 11:05                1881
eio.requirements.php                               30-Sep-2022 11:05                1310
eio.resources.php                                  30-Sep-2022 11:05                1250
eio.setup.php                                      30-Sep-2022 11:05                1552
emptyiterator.current.php                          30-Sep-2022 11:05                2801
emptyiterator.key.php                              30-Sep-2022 11:05                2726
emptyiterator.next.php                             30-Sep-2022 11:05                2443
emptyiterator.rewind.php                           30-Sep-2022 11:05                2504
emptyiterator.valid.php                            30-Sep-2022 11:05                2480
enchant.configuration.php                          30-Sep-2022 11:04                1231
enchant.constants.php                              30-Sep-2022 11:04                2587
enchant.examples.php                               30-Sep-2022 11:04                5881
enchant.installation.php                           30-Sep-2022 11:04                3449
enchant.requirements.php                           30-Sep-2022 11:04                1840
enchant.resources.php                              30-Sep-2022 11:04                1357
enchant.setup.php                                  30-Sep-2022 11:04                1603
error.clone.php                                    30-Sep-2022 11:04                2822
error.construct.php                                30-Sep-2022 11:04                3277
error.getcode.php                                  30-Sep-2022 11:04                4084
error.getfile.php                                  30-Sep-2022 11:04                3843
error.getline.php                                  30-Sep-2022 11:04                4173
error.getmessage.php                               30-Sep-2022 11:04                3963
error.getprevious.php                              30-Sep-2022 11:04                6927
error.gettrace.php                                 30-Sep-2022 11:04                4301
error.gettraceasstring.php                         30-Sep-2022 11:04                4365
error.tostring.php                                 30-Sep-2022 11:04                4104
errorexception.construct.php                       30-Sep-2022 11:04                5559
errorexception.getseverity.php                     30-Sep-2022 11:04                4446
errorfunc.configuration.php                        30-Sep-2022 11:04               24575
errorfunc.constants.php                            30-Sep-2022 11:04               10999
errorfunc.examples.php                             30-Sep-2022 11:04               23791
errorfunc.installation.php                         30-Sep-2022 11:04                1273
errorfunc.requirements.php                         30-Sep-2022 11:04                1218
errorfunc.resources.php                            30-Sep-2022 11:04                1231
errorfunc.setup.php                                30-Sep-2022 11:04                1623
ev.backend.php                                     30-Sep-2022 11:05                3525
ev.configuration.php                               30-Sep-2022 11:05                1196
ev.depth.php                                       30-Sep-2022 11:05                3386
ev.embeddablebackends.php                          30-Sep-2022 11:05                7152
ev.examples.php                                    30-Sep-2022 11:05               49403
ev.feedsignal.php                                  30-Sep-2022 11:05                3534
ev.feedsignalevent.php                             30-Sep-2022 11:05                3175
ev.global.constants.php                            30-Sep-2022 11:05                1306
ev.installation.php                                30-Sep-2022 11:05                1851
ev.iteration.php                                   30-Sep-2022 11:05                2722
ev.now.php                                         30-Sep-2022 11:05                3151
ev.nowupdate.php                                   30-Sep-2022 11:05                3348
ev.periodic-modes.php                              30-Sep-2022 11:05                8181
ev.recommendedbackends.php                         30-Sep-2022 11:05                8088
ev.requirements.php                                30-Sep-2022 11:05                1237
ev.resources.php                                   30-Sep-2022 11:05                1189
ev.resume.php                                      30-Sep-2022 11:05                3979
ev.run.php                                         30-Sep-2022 11:05                5167
ev.setup.php                                       30-Sep-2022 11:05                1510
ev.sleep.php                                       30-Sep-2022 11:05                2345
ev.stop.php                                        30-Sep-2022 11:05                2922
ev.supportedbackends.php                           30-Sep-2022 11:05                7228
ev.suspend.php                                     30-Sep-2022 11:05                3678
ev.time.php                                        30-Sep-2022 11:05                2685
ev.verify.php                                      30-Sep-2022 11:05                2295
ev.watcher-callbacks.php                           30-Sep-2022 11:05                4375
ev.watchers.php                                    30-Sep-2022 11:05                3653
evcheck.construct.php                              30-Sep-2022 11:05                3760
evcheck.createstopped.php                          30-Sep-2022 11:05                3618
evchild.construct.php                              30-Sep-2022 11:05                6746
evchild.createstopped.php                          30-Sep-2022 11:05                5108
evchild.set.php                                    30-Sep-2022 11:05                3118
evembed.construct.php                              30-Sep-2022 11:05                8723
evembed.createstopped.php                          30-Sep-2022 11:05                4796
evembed.set.php                                    30-Sep-2022 11:05                2513
evembed.sweep.php                                  30-Sep-2022 11:05                3110
event.add.php                                      30-Sep-2022 11:05               11448
event.addsignal.php                                30-Sep-2022 11:05                1633
event.addtimer.php                                 30-Sep-2022 11:05                1642
event.callbacks.php                                30-Sep-2022 11:05                5766
event.configuration.php                            30-Sep-2022 11:05                1217
event.construct.php                                30-Sep-2022 11:05                5061
event.constructing.signal.events.php               30-Sep-2022 11:05                7188
event.del.php                                      30-Sep-2022 11:05                2538
event.delsignal.php                                30-Sep-2022 11:05                1633
event.deltimer.php                                 30-Sep-2022 11:05                1630
event.examples.php                                 30-Sep-2022 11:05              201983
event.flags.php                                    30-Sep-2022 11:05                2660
event.free.php                                     30-Sep-2022 11:05                3068
event.getsupportedmethods.php                      30-Sep-2022 11:05                2626
event.installation.php                             30-Sep-2022 11:05                1874
event.pending.php                                  30-Sep-2022 11:05                2679
event.persistence.php                              30-Sep-2022 11:05                3161
event.requirements.php                             30-Sep-2022 11:05                1494
event.resources.php                                30-Sep-2022 11:05                1173
event.set.php                                      30-Sep-2022 11:05                4743
event.setpriority.php                              30-Sep-2022 11:05                2457
event.settimer.php                                 30-Sep-2022 11:05                4209
event.setup.php                                    30-Sep-2022 11:05                1549
event.signal.php                                   30-Sep-2022 11:05                4473
event.timer.php                                    30-Sep-2022 11:05                3788
eventbase.construct.php                            30-Sep-2022 11:05                2804
eventbase.dispatch.php                             30-Sep-2022 11:05                3316
eventbase.exit.php                                 30-Sep-2022 11:05                3067
eventbase.free.php                                 30-Sep-2022 11:05                3398
eventbase.getfeatures.php                          30-Sep-2022 11:05                6175
eventbase.getmethod.php                            30-Sep-2022 11:05                4843
eventbase.gettimeofdaycached.php                   30-Sep-2022 11:05                2737
eventbase.gotexit.php                              30-Sep-2022 11:05                3501
eventbase.gotstop.php                              30-Sep-2022 11:05                3464
eventbase.loop.php                                 30-Sep-2022 11:05                3530
eventbase.priorityinit.php                         30-Sep-2022 11:05                2969
eventbase.reinit.php                               30-Sep-2022 11:05                2302
eventbase.stop.php                                 30-Sep-2022 11:05                2913
eventbuffer.add.php                                30-Sep-2022 11:05                2941
eventbuffer.addbuffer.php                          30-Sep-2022 11:05                3374
eventbuffer.appendfrom.php                         30-Sep-2022 11:05                5015
eventbuffer.construct.php                          30-Sep-2022 11:05                2159
eventbuffer.copyout.php                            30-Sep-2022 11:05                3901
eventbuffer.drain.php                              30-Sep-2022 11:05                3467
eventbuffer.enablelocking.php                      30-Sep-2022 11:05                2981
eventbuffer.expand.php                             30-Sep-2022 11:05                2735
eventbuffer.freeze.php                             30-Sep-2022 11:05                3088
eventbuffer.lock.php                               30-Sep-2022 11:05                3161
eventbuffer.prepend.php                            30-Sep-2022 11:05                3487
eventbuffer.prependbuffer.php                      30-Sep-2022 11:05                3746
eventbuffer.pullup.php                             30-Sep-2022 11:05                4765
eventbuffer.read.php                               30-Sep-2022 11:05                5055
eventbuffer.readfrom.php                           30-Sep-2022 11:05                4468
eventbuffer.readline.php                           30-Sep-2022 11:05                4288
eventbuffer.search.php                             30-Sep-2022 11:05                8888
eventbuffer.searcheol.php                          30-Sep-2022 11:05                4732
eventbuffer.substr.php                             30-Sep-2022 11:05                3373
eventbuffer.unfreeze.php                           30-Sep-2022 11:05                3084
eventbuffer.unlock.php                             30-Sep-2022 11:05                2746
eventbuffer.write.php                              30-Sep-2022 11:05                3433
eventbufferevent.about.callbacks.php               30-Sep-2022 11:05                5885
eventbufferevent.close.php                         30-Sep-2022 11:05                2543
eventbufferevent.connect.php                       30-Sep-2022 11:05               27607
eventbufferevent.connecthost.php                   30-Sep-2022 11:05               19031
eventbufferevent.construct.php                     30-Sep-2022 11:05                7294
eventbufferevent.createpair.php                    30-Sep-2022 11:05                4129
eventbufferevent.disable.php                       30-Sep-2022 11:05                3297
eventbufferevent.enable.php                        30-Sep-2022 11:05                3543
eventbufferevent.free.php                          30-Sep-2022 11:05                3057
eventbufferevent.getdnserrorstring.php             30-Sep-2022 11:05                3111
eventbufferevent.getenabled.php                    30-Sep-2022 11:05                3274
eventbufferevent.getinput.php                      30-Sep-2022 11:05                5361
eventbufferevent.getoutput.php                     30-Sep-2022 11:05                8614
eventbufferevent.read.php                          30-Sep-2022 11:05                3030
eventbufferevent.readbuffer.php                    30-Sep-2022 11:05                3149
eventbufferevent.setcallbacks.php                  30-Sep-2022 11:05                4956
eventbufferevent.setpriority.php                   30-Sep-2022 11:05                2864
eventbufferevent.settimeouts.php                   30-Sep-2022 11:05                3136
eventbufferevent.setwatermark.php                  30-Sep-2022 11:05                4002
eventbufferevent.sslerror.php                      30-Sep-2022 11:05                6572
eventbufferevent.sslfilter.php                     30-Sep-2022 11:05               41468
eventbufferevent.sslgetcipherinfo.php              30-Sep-2022 11:05                2901
eventbufferevent.sslgetciphername.php              30-Sep-2022 11:05                2763
eventbufferevent.sslgetcipherversion.php           30-Sep-2022 11:05                2825
eventbufferevent.sslgetprotocol.php                30-Sep-2022 11:05                2711
eventbufferevent.sslrenegotiate.php                30-Sep-2022 11:05                2971
eventbufferevent.sslsocket.php                     30-Sep-2022 11:05                5639
eventbufferevent.write.php                         30-Sep-2022 11:05                3070
eventbufferevent.writebuffer.php                   30-Sep-2022 11:05                3333
eventconfig.avoidmethod.php                        30-Sep-2022 11:05                4379
eventconfig.construct.php                          30-Sep-2022 11:05                4583
eventconfig.requirefeatures.php                    30-Sep-2022 11:05                6284
eventconfig.setflags.php                           30-Sep-2022 11:05                3211
eventconfig.setmaxdispatchinterval.php             30-Sep-2022 11:05                4566
eventdnsbase.addnameserverip.php                   30-Sep-2022 11:05                2831
eventdnsbase.addsearch.php                         30-Sep-2022 11:05                2574
eventdnsbase.clearsearch.php                       30-Sep-2022 11:05                2888
eventdnsbase.construct.php                         30-Sep-2022 11:05                3278
eventdnsbase.countnameservers.php                  30-Sep-2022 11:05                2551
eventdnsbase.loadhosts.php                         30-Sep-2022 11:05                2611
eventdnsbase.parseresolvconf.php                   30-Sep-2022 11:05                4176
eventdnsbase.setoption.php                         30-Sep-2022 11:05                3194
eventdnsbase.setsearchndots.php                    30-Sep-2022 11:05                2797
eventhttp.accept.php                               30-Sep-2022 11:05               13455
eventhttp.addserveralias.php                       30-Sep-2022 11:05                6576
eventhttp.bind.php                                 30-Sep-2022 11:05                7972
eventhttp.construct.php                            30-Sep-2022 11:05               20162
eventhttp.removeserveralias.php                    30-Sep-2022 11:05                3143
eventhttp.setallowedmethods.php                    30-Sep-2022 11:05                3368
eventhttp.setcallback.php                          30-Sep-2022 11:05               20083
eventhttp.setdefaultcallback.php                   30-Sep-2022 11:05                8099
eventhttp.setmaxbodysize.php                       30-Sep-2022 11:05                2937
eventhttp.setmaxheaderssize.php                    30-Sep-2022 11:05                2827
eventhttp.settimeout.php                           30-Sep-2022 11:05                2527
eventhttpconnection.construct.php                  30-Sep-2022 11:05                5242
eventhttpconnection.getbase.php                    30-Sep-2022 11:05                2603
eventhttpconnection.getpeer.php                    30-Sep-2022 11:05                2919
eventhttpconnection.makerequest.php                30-Sep-2022 11:05               12684
eventhttpconnection.setclosecallback.php           30-Sep-2022 11:05               11928
eventhttpconnection.setlocaladdress.php            30-Sep-2022 11:05                3254
eventhttpconnection.setlocalport.php               30-Sep-2022 11:05                3104
eventhttpconnection.setmaxbodysize.php             30-Sep-2022 11:05                3145
eventhttpconnection.setmaxheaderssize.php          30-Sep-2022 11:05                3168
eventhttpconnection.setretries.php                 30-Sep-2022 11:05                2719
eventhttpconnection.settimeout.php                 30-Sep-2022 11:05                2651
eventhttprequest.addheader.php                     30-Sep-2022 11:05                3735
eventhttprequest.cancel.php                        30-Sep-2022 11:05                2872
eventhttprequest.clearheaders.php                  30-Sep-2022 11:05                2841
eventhttprequest.closeconnection.php               30-Sep-2022 11:05                2405
eventhttprequest.construct.php                     30-Sep-2022 11:05               12881
eventhttprequest.findheader.php                    30-Sep-2022 11:05                3424
eventhttprequest.free.php                          30-Sep-2022 11:05                2327
eventhttprequest.getbufferevent.php                30-Sep-2022 11:05                3787
eventhttprequest.getcommand.php                    30-Sep-2022 11:05                2690
eventhttprequest.getconnection.php                 30-Sep-2022 11:05                4664
eventhttprequest.gethost.php                       30-Sep-2022 11:05                2884
eventhttprequest.getinputbuffer.php                30-Sep-2022 11:05                2815
eventhttprequest.getinputheaders.php               30-Sep-2022 11:05                2904
eventhttprequest.getoutputbuffer.php               30-Sep-2022 11:05                2858
eventhttprequest.getoutputheaders.php              30-Sep-2022 11:05                2860
eventhttprequest.getresponsecode.php               30-Sep-2022 11:05                3178
eventhttprequest.geturi.php                        30-Sep-2022 11:05                3122
eventhttprequest.removeheader.php                  30-Sep-2022 11:05                3370
eventhttprequest.senderror.php                     30-Sep-2022 11:05                5750
eventhttprequest.sendreply.php                     30-Sep-2022 11:05                3995
eventhttprequest.sendreplychunk.php                30-Sep-2022 11:05                3547
eventhttprequest.sendreplyend.php                  30-Sep-2022 11:05                3080
eventhttprequest.sendreplystart.php                30-Sep-2022 11:05                4367
eventlistener.construct.php                        30-Sep-2022 11:05               28014
eventlistener.disable.php                          30-Sep-2022 11:05                2773
eventlistener.enable.php                           30-Sep-2022 11:05                2762
eventlistener.getbase.php                          30-Sep-2022 11:05                2404
eventlistener.getsocketname.php                    30-Sep-2022 11:05                3251
eventlistener.setcallback.php                      30-Sep-2022 11:05                5898
eventlistener.seterrorcallback.php                 30-Sep-2022 11:05                4361
eventsslcontext.construct.php                      30-Sep-2022 11:05                5842
eventutil.construct.php                            30-Sep-2022 11:05                2363
eventutil.getlastsocketerrno.php                   30-Sep-2022 11:05                3364
eventutil.getlastsocketerror.php                   30-Sep-2022 11:05                3236
eventutil.getsocketfd.php                          30-Sep-2022 11:05                3243
eventutil.getsocketname.php                        30-Sep-2022 11:05                3668
eventutil.setsocketoption.php                      30-Sep-2022 11:05                5596
eventutil.sslrandpoll.php                          30-Sep-2022 11:05                2326
evfork.construct.php                               30-Sep-2022 11:05                3749
evfork.createstopped.php                           30-Sep-2022 11:05                3819
evidle.construct.php                               30-Sep-2022 11:05                3802
evidle.createstopped.php                           30-Sep-2022 11:05                4151
evio.construct.php                                 30-Sep-2022 11:05                4870
evio.createstopped.php                             30-Sep-2022 11:05                5254
evio.set.php                                       30-Sep-2022 11:05                2836
evloop.backend.php                                 30-Sep-2022 11:05                2721
evloop.check.php                                   30-Sep-2022 11:05                3213
evloop.child.php                                   30-Sep-2022 11:05                3550
evloop.construct.php                               30-Sep-2022 11:05                4055
evloop.defaultloop.php                             30-Sep-2022 11:05                4679
evloop.embed.php                                   30-Sep-2022 11:05                3641
evloop.fork.php                                    30-Sep-2022 11:05                3410
evloop.idle.php                                    30-Sep-2022 11:05                3421
evloop.invokepending.php                           30-Sep-2022 11:05                2310
evloop.io.php                                      30-Sep-2022 11:05                3850
evloop.loopfork.php                                30-Sep-2022 11:05                2571
evloop.now.php                                     30-Sep-2022 11:05                2949
evloop.nowupdate.php                               30-Sep-2022 11:05                3270
evloop.periodic.php                                30-Sep-2022 11:05                3880
evloop.prepare.php                                 30-Sep-2022 11:05                3424
evloop.resume.php                                  30-Sep-2022 11:05                2882
evloop.run.php                                     30-Sep-2022 11:05                5120
evloop.signal.php                                  30-Sep-2022 11:05                3668
evloop.stat.php                                    30-Sep-2022 11:05                3789
evloop.stop.php                                    30-Sep-2022 11:05                3051
evloop.suspend.php                                 30-Sep-2022 11:05                2874
evloop.timer.php                                   30-Sep-2022 11:05                3809
evloop.verify.php                                  30-Sep-2022 11:05                2661
evperiodic.again.php                               30-Sep-2022 11:05                2561
evperiodic.at.php                                  30-Sep-2022 11:05                2596
evperiodic.construct.php                           30-Sep-2022 11:05               10364
evperiodic.createstopped.php                       30-Sep-2022 11:05                5801
evperiodic.set.php                                 30-Sep-2022 11:05                3140
evprepare.construct.php                            30-Sep-2022 11:05                3477
evprepare.createstopped.php                        30-Sep-2022 11:05                4345
evsignal.construct.php                             30-Sep-2022 11:05                5606
evsignal.createstopped.php                         30-Sep-2022 11:05                4857
evsignal.set.php                                   30-Sep-2022 11:05                2437
evstat.attr.php                                    30-Sep-2022 11:05                8923
evstat.construct.php                               30-Sep-2022 11:05                7487
evstat.createstopped.php                           30-Sep-2022 11:05                5104
evstat.prev.php                                    30-Sep-2022 11:05                3002
evstat.set.php                                     30-Sep-2022 11:05                2719
evstat.stat.php                                    30-Sep-2022 11:05                2939
evtimer.again.php                                  30-Sep-2022 11:05                3156
evtimer.construct.php                              30-Sep-2022 11:05               14056
evtimer.createstopped.php                          30-Sep-2022 11:05                8708
evtimer.set.php                                    30-Sep-2022 11:05                2933
evwatcher.clear.php                                30-Sep-2022 11:05                2915
evwatcher.construct.php                            30-Sep-2022 11:05                2099
evwatcher.feed.php                                 30-Sep-2022 11:05                2613
evwatcher.getloop.php                              30-Sep-2022 11:05                2313
evwatcher.invoke.php                               30-Sep-2022 11:05                2640
evwatcher.keepalive.php                            30-Sep-2022 11:05                5039
evwatcher.setcallback.php                          30-Sep-2022 11:05                2615
evwatcher.start.php                                30-Sep-2022 11:05                2518
evwatcher.stop.php                                 30-Sep-2022 11:05                2495
example.xml-external-entity.php                    30-Sep-2022 11:05               26251
example.xml-map-tags.php                           30-Sep-2022 11:05                9135
example.xml-structure.php                          30-Sep-2022 11:05                7074
example.xmlwriter-namespace.php                    30-Sep-2022 11:05                5526
example.xmlwriter-oop.php                          30-Sep-2022 11:05                3424
example.xmlwriter-simple.php                       30-Sep-2022 11:05                8976
exception.clone.php                                30-Sep-2022 11:04                2882
exception.construct.php                            30-Sep-2022 11:04                3685
exception.getcode.php                              30-Sep-2022 11:04                4791
exception.getfile.php                              30-Sep-2022 11:04                3968
exception.getline.php                              30-Sep-2022 11:04                4294
exception.getmessage.php                           30-Sep-2022 11:04                4091
exception.getprevious.php                          30-Sep-2022 11:04                7210
exception.gettrace.php                             30-Sep-2022 11:04                4443
exception.gettraceasstring.php                     30-Sep-2022 11:04                4505
exception.tostring.php                             30-Sep-2022 11:04                4266
exec.configuration.php                             30-Sep-2022 11:05                1210
exec.constants.php                                 30-Sep-2022 11:05                1197
exec.installation.php                              30-Sep-2022 11:05                1238
exec.requirements.php                              30-Sep-2022 11:05                1183
exec.resources.php                                 30-Sep-2022 11:05                1361
exec.setup.php                                     30-Sep-2022 11:05                1581
exif.configuration.php                             30-Sep-2022 11:04                7447
exif.constants.php                                 30-Sep-2022 11:04                1903
exif.installation.php                              30-Sep-2022 11:04                1788
exif.requirements.php                              30-Sep-2022 11:04                1847
exif.resources.php                                 30-Sep-2022 11:04                1196
exif.setup.php                                     30-Sep-2022 11:04                1573
expect.configuration.php                           30-Sep-2022 11:05                5348
expect.constants.php                               30-Sep-2022 11:05                3306
expect.examples-usage.php                          30-Sep-2022 11:05               17477
expect.examples.php                                30-Sep-2022 11:05                1388
expect.installation.php                            30-Sep-2022 11:05                2597
expect.requirements.php                            30-Sep-2022 11:05                1313
expect.resources.php                               30-Sep-2022 11:05                1436
expect.setup.php                                   30-Sep-2022 11:05                1599
ext-weakmap.construct.php                          30-Sep-2022 11:04                1860
extensions.alphabetical.php                        30-Sep-2022 11:05               20799
extensions.membership.php                          30-Sep-2022 11:05               20602
extensions.php                                     30-Sep-2022 11:05                1684
extensions.state.php                               30-Sep-2022 11:05                2668
fann.configuration.php                             30-Sep-2022 11:05                1210
fann.constants.php                                 30-Sep-2022 11:05               17659
fann.examples-1.php                                30-Sep-2022 11:05                9049
fann.examples.php                                  30-Sep-2022 11:05                1315
fann.installation.php                              30-Sep-2022 11:05                5033
fann.requirements.php                              30-Sep-2022 11:05                1147
fann.resources.php                                 30-Sep-2022 11:05                1155
fann.setup.php                                     30-Sep-2022 11:05                1540
fannconnection.construct.php                       30-Sep-2022 11:05                2865
fannconnection.getfromneuron.php                   30-Sep-2022 11:05                2304
fannconnection.gettoneuron.php                     30-Sep-2022 11:05                2270
fannconnection.getweight.php                       30-Sep-2022 11:05                2263
fannconnection.setweight.php                       30-Sep-2022 11:05                2912
faq.build.php                                      30-Sep-2022 11:05               24300
faq.com.php                                        30-Sep-2022 11:05               12592
faq.databases.php                                  30-Sep-2022 11:05                8476
faq.general.php                                    30-Sep-2022 11:05                5069
faq.html.php                                       30-Sep-2022 11:05               22115
faq.installation.php                               30-Sep-2022 11:05               27761
faq.mailinglist.php                                30-Sep-2022 11:05               12307
faq.misc.php                                       30-Sep-2022 11:05                4658
faq.obtaining.php                                  30-Sep-2022 11:05               11063
faq.passwords.php                                  30-Sep-2022 11:05               10152
faq.php                                            30-Sep-2022 11:05                2111
faq.using.php                                      30-Sep-2022 11:05               24082
fdf.configuration.php                              30-Sep-2022 11:05                1203
fdf.constants.php                                  30-Sep-2022 11:05                6329
fdf.examples.php                                   30-Sep-2022 11:05                7356
fdf.installation.php                               30-Sep-2022 11:05                3614
fdf.requirements.php                               30-Sep-2022 11:05                1557
fdf.resources.php                                  30-Sep-2022 11:05                1786
fdf.setup.php                                      30-Sep-2022 11:05                1551
features.commandline.differences.php               30-Sep-2022 11:04               12705
features.commandline.ini.php                       30-Sep-2022 11:04                2225
features.commandline.interactive.php               30-Sep-2022 11:04                9492
features.commandline.introduction.php              30-Sep-2022 11:04                6783
features.commandline.io-streams.php                30-Sep-2022 11:04                6124
features.commandline.options.php                   30-Sep-2022 11:04               27125
features.commandline.php                           30-Sep-2022 11:04                2047
features.commandline.usage.php                     30-Sep-2022 11:04               14839
features.commandline.webserver.php                 30-Sep-2022 11:04               13820
features.connection-handling.php                   30-Sep-2022 11:04                5893
features.cookies.php                               30-Sep-2022 11:04                3075
features.dtrace.dtrace.php                         30-Sep-2022 11:04               13923
features.dtrace.introduction.php                   30-Sep-2022 11:04                3313
features.dtrace.php                                30-Sep-2022 11:04                1617
features.dtrace.systemtap.php                      30-Sep-2022 11:04                8024
features.file-upload.common-pitfalls.php           30-Sep-2022 11:04                5361
features.file-upload.errors.php                    30-Sep-2022 11:04                3908
features.file-upload.errors.seealso.php            30-Sep-2022 11:04                1360
features.file-upload.multiple.php                  30-Sep-2022 11:04                6954
features.file-upload.php                           30-Sep-2022 11:04                2003
features.file-upload.post-method.php               30-Sep-2022 11:04               17354
features.file-upload.put-method.php                30-Sep-2022 11:04                6396
features.gc.collecting-cycles.php                  30-Sep-2022 11:04                8510
features.gc.performance-considerations.php         30-Sep-2022 11:04               14845
features.gc.php                                    30-Sep-2022 11:04                1848
features.gc.refcounting-basics.php                 30-Sep-2022 11:04               22359
features.http-auth.php                             30-Sep-2022 11:04               25711
features.persistent-connections.php                30-Sep-2022 11:04                8158
features.php                                       30-Sep-2022 11:04                4300
features.remote-files.php                          30-Sep-2022 11:04                8584
features.session.security.management.php           30-Sep-2022 11:05               29471
features.sessions.php                              30-Sep-2022 11:04                1412
features.xforms.php                                30-Sep-2022 11:04                5512
ffi-ctype.getalignment.php                         30-Sep-2022 11:04                2294
ffi-ctype.getarrayelementtype.php                  30-Sep-2022 11:04                2438
ffi-ctype.getarraylength.php                       30-Sep-2022 11:04                2337
ffi-ctype.getattributes.php                        30-Sep-2022 11:04                2313
ffi-ctype.getenumkind.php                          30-Sep-2022 11:04                2289
ffi-ctype.getfuncabi.php                           30-Sep-2022 11:04                2297
ffi-ctype.getfuncparametercount.php                30-Sep-2022 11:04                2403
ffi-ctype.getfuncparametertype.php                 30-Sep-2022 11:04                2641
ffi-ctype.getfuncreturntype.php                    30-Sep-2022 11:04                2420
ffi-ctype.getkind.php                              30-Sep-2022 11:04                2251
ffi-ctype.getname.php                              30-Sep-2022 11:04                2255
ffi-ctype.getpointertype.php                       30-Sep-2022 11:04                2364
ffi-ctype.getsize.php                              30-Sep-2022 11:04                2269
ffi-ctype.getstructfieldnames.php                  30-Sep-2022 11:04                2379
ffi-ctype.getstructfieldoffset.php                 30-Sep-2022 11:04                2577
ffi-ctype.getstructfieldtype.php                   30-Sep-2022 11:04                2597
ffi.addr.php                                       30-Sep-2022 11:04                2762
ffi.alignof.php                                    30-Sep-2022 11:04                2834
ffi.arraytype.php                                  30-Sep-2022 11:04                4453
ffi.cast.php                                       30-Sep-2022 11:04                4899
ffi.cdef.php                                       30-Sep-2022 11:04                4133
ffi.configuration.php                              30-Sep-2022 11:04                4155
ffi.constants.php                                  30-Sep-2022 11:04                1121
ffi.examples-basic.php                             30-Sep-2022 11:04               17212
ffi.examples-callback.php                          30-Sep-2022 11:04                5052
ffi.examples-complete.php                          30-Sep-2022 11:04                5821
ffi.examples.php                                   30-Sep-2022 11:04                1472
ffi.free.php                                       30-Sep-2022 11:04                2389
ffi.installation.php                               30-Sep-2022 11:04                1410
ffi.isnull.php                                     30-Sep-2022 11:04                2363
ffi.load.php                                       30-Sep-2022 11:04                4155
ffi.memcmp.php                                     30-Sep-2022 11:04                3753
ffi.memcpy.php                                     30-Sep-2022 11:04                3131
ffi.memset.php                                     30-Sep-2022 11:04                2973
ffi.new.php                                        30-Sep-2022 11:04                5284
ffi.requirements.php                               30-Sep-2022 11:04                1243
ffi.resources.php                                  30-Sep-2022 11:04                1189
ffi.scope.php                                      30-Sep-2022 11:04                3067
ffi.setup.php                                      30-Sep-2022 11:04                1538
ffi.sizeof.php                                     30-Sep-2022 11:04                2675
ffi.string.php                                     30-Sep-2022 11:04                3646
ffi.type.php                                       30-Sep-2022 11:04                3527
ffi.typeof.php                                     30-Sep-2022 11:04                2826
fiber.construct.php                                30-Sep-2022 11:04                2328
fiber.getcurrent.php                               30-Sep-2022 11:04                2382
fiber.getreturn.php                                30-Sep-2022 11:04                2603
fiber.isrunning.php                                30-Sep-2022 11:04                2548
fiber.isstarted.php                                30-Sep-2022 11:04                2162
fiber.issuspended.php                              30-Sep-2022 11:04                2177
fiber.isterminated.php                             30-Sep-2022 11:04                2234
fiber.resume.php                                   30-Sep-2022 11:04                3292
fiber.start.php                                    30-Sep-2022 11:04                3020
fiber.suspend.php                                  30-Sep-2022 11:04                4059
fiber.throw.php                                    30-Sep-2022 11:04                3162
fibererror.construct.php                           30-Sep-2022 11:04                2171
fileinfo.configuration.php                         30-Sep-2022 11:04                1238
fileinfo.constants.php                             30-Sep-2022 11:04                4960
fileinfo.installation.php                          30-Sep-2022 11:04                1748
fileinfo.requirements.php                          30-Sep-2022 11:04                1211
fileinfo.resources.php                             30-Sep-2022 11:04                1433
fileinfo.setup.php                                 30-Sep-2022 11:04                1615
filesystem.configuration.php                       30-Sep-2022 11:04                7322
filesystem.constants.php                           30-Sep-2022 11:04                8837
filesystem.installation.php                        30-Sep-2022 11:04                1280
filesystem.requirements.php                        30-Sep-2022 11:04                1225
filesystem.resources.php                           30-Sep-2022 11:04                1398
filesystem.setup.php                               30-Sep-2022 11:04                1657
filesystemiterator.construct.php                   30-Sep-2022 11:05                7177
filesystemiterator.current.php                     30-Sep-2022 11:05                5582
filesystemiterator.getflags.php                    30-Sep-2022 11:05                3203
filesystemiterator.key.php                         30-Sep-2022 11:05                5476
filesystemiterator.next.php                        30-Sep-2022 11:05                4563
filesystemiterator.rewind.php                      30-Sep-2022 11:05                5164
filesystemiterator.setflags.php                    30-Sep-2022 11:05                6925
filter.configuration.php                           30-Sep-2022 11:05                5030
filter.constants.php                               30-Sep-2022 11:05               18485
filter.examples.php                                30-Sep-2022 11:05                1419
filter.examples.sanitization.php                   30-Sep-2022 11:05                6177
filter.examples.validation.php                     30-Sep-2022 11:05               11060
filter.filters.flags.php                           30-Sep-2022 11:05               11785
filter.filters.misc.php                            30-Sep-2022 11:05                1855
filter.filters.php                                 30-Sep-2022 11:05                1589
filter.filters.sanitize.php                        30-Sep-2022 11:05               10416
filter.filters.validate.php                        30-Sep-2022 11:05               11486
filter.installation.php                            30-Sep-2022 11:05                1308
filter.requirements.php                            30-Sep-2022 11:05                1197
filter.resources.php                               30-Sep-2022 11:05                1187
filter.setup.php                                   30-Sep-2022 11:05                1580
filteriterator.accept.php                          30-Sep-2022 11:05                5508
filteriterator.construct.php                       30-Sep-2022 11:05                3116
filteriterator.current.php                         30-Sep-2022 11:05                3176
filteriterator.getinneriterator.php                30-Sep-2022 11:05                2550
filteriterator.key.php                             30-Sep-2022 11:05                3087
filteriterator.next.php                            30-Sep-2022 11:05                3052
filteriterator.rewind.php                          30-Sep-2022 11:05                3265
filteriterator.valid.php                           30-Sep-2022 11:05                2485
filters.compression.php                            30-Sep-2022 11:05               17192
filters.convert.php                                30-Sep-2022 11:05               12520
filters.encryption.php                             30-Sep-2022 11:05               46251
filters.php                                        30-Sep-2022 11:05                3379
filters.string.php                                 30-Sep-2022 11:05               11049
finfo.buffer.php                                   30-Sep-2022 11:04                2439
finfo.construct.php                                30-Sep-2022 11:04                2768
finfo.file.php                                     30-Sep-2022 11:04                2430
finfo.set-flags.php                                30-Sep-2022 11:04                1951
fpm.observability.php                              30-Sep-2022 11:05                1351
fpm.setup.php                                      30-Sep-2022 11:05                1310
fpm.status.php                                     30-Sep-2022 11:05                9926
ftp.configuration.php                              30-Sep-2022 11:05                1203
ftp.constants.php                                  30-Sep-2022 11:05                4108
ftp.examples-basic.php                             30-Sep-2022 11:05                5482
ftp.examples.php                                   30-Sep-2022 11:05                1325
ftp.installation.php                               30-Sep-2022 11:05                1447
ftp.requirements.php                               30-Sep-2022 11:05                1176
ftp.resources.php                                  30-Sep-2022 11:05                1510
ftp.setup.php                                      30-Sep-2022 11:05                1552
funchand.configuration.php                         30-Sep-2022 11:05                1238
funchand.constants.php                             30-Sep-2022 11:05                1199
funchand.installation.php                          30-Sep-2022 11:05                1266
funchand.requirements.php                          30-Sep-2022 11:05                1211
funchand.resources.php                             30-Sep-2022 11:05                1224
funchand.setup.php                                 30-Sep-2022 11:05                1605
funcref.php                                        30-Sep-2022 11:05               14542
function.abs.php                                   30-Sep-2022 11:05                5241
function.acos.php                                  30-Sep-2022 11:05                3377
function.acosh.php                                 30-Sep-2022 11:05                3119
function.addcslashes.php                           30-Sep-2022 11:05                8405
function.addslashes.php                            30-Sep-2022 11:05                6866
function.apache-child-terminate.php                30-Sep-2022 11:05                3386
function.apache-get-modules.php                    30-Sep-2022 11:05                3268
function.apache-get-version.php                    30-Sep-2022 11:05                3849
function.apache-getenv.php                         30-Sep-2022 11:05                5032
function.apache-lookup-uri.php                     30-Sep-2022 11:05                6012
function.apache-note.php                           30-Sep-2022 11:05                7118
function.apache-request-headers.php                30-Sep-2022 11:05                5835
function.apache-response-headers.php               30-Sep-2022 11:05                4404
function.apache-setenv.php                         30-Sep-2022 11:05                5522
function.apcu-add.php                              30-Sep-2022 11:04                8714
function.apcu-cache-info.php                       30-Sep-2022 11:04                6689
function.apcu-cas.php                              30-Sep-2022 11:04                8987
function.apcu-clear-cache.php                      30-Sep-2022 11:04                2558
function.apcu-dec.php                              30-Sep-2022 11:04                8141
function.apcu-delete.php                           30-Sep-2022 11:04                6296
function.apcu-enabled.php                          30-Sep-2022 11:04                2259
function.apcu-entry.php                            30-Sep-2022 11:04                9322
function.apcu-exists.php                           30-Sep-2022 11:04                7344
function.apcu-fetch.php                            30-Sep-2022 11:04                5819
function.apcu-inc.php                              30-Sep-2022 11:04                8128
function.apcu-key-info.php                         30-Sep-2022 11:04                4854
function.apcu-sma-info.php                         30-Sep-2022 11:04                4392
function.apcu-store.php                            30-Sep-2022 11:04                7458
function.array-change-key-case.php                 30-Sep-2022 11:05                5584
function.array-chunk.php                           30-Sep-2022 11:05                7431
function.array-column.php                          30-Sep-2022 11:05               18361
function.array-combine.php                         30-Sep-2022 11:05                7057
function.array-count-values.php                    30-Sep-2022 11:05                5606
function.array-diff-assoc.php                      30-Sep-2022 11:05               11308
function.array-diff-key.php                        30-Sep-2022 11:05               13415
function.array-diff-uassoc.php                     30-Sep-2022 11:05               12241
function.array-diff-ukey.php                       30-Sep-2022 11:05               12426
function.array-diff.php                            30-Sep-2022 11:05               13083
function.array-fill-keys.php                       30-Sep-2022 11:05                5323
function.array-fill.php                            30-Sep-2022 11:05                8012
function.array-filter.php                          30-Sep-2022 11:05               17275
function.array-flip.php                            30-Sep-2022 11:05                7214
function.array-intersect-assoc.php                 30-Sep-2022 11:05                9176
function.array-intersect-key.php                   30-Sep-2022 11:05               10727
function.array-intersect-uassoc.php                30-Sep-2022 11:05                8750
function.array-intersect-ukey.php                  30-Sep-2022 11:05               12156
function.array-intersect.php                       30-Sep-2022 11:05                7057
function.array-is-list.php                         30-Sep-2022 11:05                7086
function.array-key-exists.php                      30-Sep-2022 11:05                8858
function.array-key-first.php                       30-Sep-2022 11:05                7328
function.array-key-last.php                        30-Sep-2022 11:05                3177
function.array-keys.php                            30-Sep-2022 11:05                8529
function.array-map.php                             30-Sep-2022 11:05               29118
function.array-merge-recursive.php                 30-Sep-2022 11:05                7049
function.array-merge.php                           30-Sep-2022 11:05               12887
function.array-multisort.php                       30-Sep-2022 11:05               24197
function.array-pad.php                             30-Sep-2022 11:05                7337
function.array-pop.php                             30-Sep-2022 11:05                5731
function.array-product.php                         30-Sep-2022 11:05                4480
function.array-push.php                            30-Sep-2022 11:05                7302
function.array-rand.php                            30-Sep-2022 11:05                6899
function.array-reduce.php                          30-Sep-2022 11:05               10432
function.array-replace-recursive.php               30-Sep-2022 11:05               11437
function.array-replace.php                         30-Sep-2022 11:05                6890
function.array-reverse.php                         30-Sep-2022 11:05                6153
function.array-search.php                          30-Sep-2022 11:05                8384
function.array-shift.php                           30-Sep-2022 11:05                5904
function.array-slice.php                           30-Sep-2022 11:05               14479
function.array-splice.php                          30-Sep-2022 11:05               18497
function.array-sum.php                             30-Sep-2022 11:05                5202
function.array-udiff-assoc.php                     30-Sep-2022 11:05               14913
function.array-udiff-uassoc.php                    30-Sep-2022 11:05               16578
function.array-udiff.php                           30-Sep-2022 11:05               29755
function.array-uintersect-assoc.php                30-Sep-2022 11:05                8286
function.array-uintersect-uassoc.php               30-Sep-2022 11:05                8636
function.array-uintersect.php                      30-Sep-2022 11:05                7806
function.array-unique.php                          30-Sep-2022 11:05                9595
function.array-unshift.php                         30-Sep-2022 11:05                6400
function.array-values.php                          30-Sep-2022 11:05                4536
function.array-walk-recursive.php                  30-Sep-2022 11:05                7838
function.array-walk.php                            30-Sep-2022 11:05               14237
function.array.php                                 30-Sep-2022 11:05               12435
function.arsort.php                                30-Sep-2022 11:05                8298
function.asin.php                                  30-Sep-2022 11:05                3426
function.asinh.php                                 30-Sep-2022 11:05                3185
function.asort.php                                 30-Sep-2022 11:05                8288
function.assert-options.php                        30-Sep-2022 11:04               12315
function.assert.php                                30-Sep-2022 11:04               28028
function.atan.php                                  30-Sep-2022 11:05                3395
function.atan2.php                                 30-Sep-2022 11:05                3228
function.atanh.php                                 30-Sep-2022 11:05                3150
function.autoload.php                              30-Sep-2022 11:05                3141
function.base-convert.php                          30-Sep-2022 11:05                6610
function.base64-decode.php                         30-Sep-2022 11:05                4899
function.base64-encode.php                         30-Sep-2022 11:05                4826
function.basename.php                              30-Sep-2022 11:04                7606
function.bcadd.php                                 30-Sep-2022 11:05                5878
function.bccomp.php                                30-Sep-2022 11:05                5915
function.bcdiv.php                                 30-Sep-2022 11:05                5399
function.bcmod.php                                 30-Sep-2022 11:05                7601
function.bcmul.php                                 30-Sep-2022 11:05                7388
function.bcpow.php                                 30-Sep-2022 11:05                7372
function.bcpowmod.php                              30-Sep-2022 11:05                7502
function.bcscale.php                               30-Sep-2022 11:05                5489
function.bcsqrt.php                                30-Sep-2022 11:05                4958
function.bcsub.php                                 30-Sep-2022 11:05                5927
function.bin2hex.php                               30-Sep-2022 11:05                4710
function.bind-textdomain-codeset.php               30-Sep-2022 11:04                4342
function.bindec.php                                30-Sep-2022 11:05               16391
function.bindtextdomain.php                        30-Sep-2022 11:04                5275
function.boolval.php                               30-Sep-2022 11:05               10962
function.bzclose.php                               30-Sep-2022 11:04                3014
function.bzcompress.php                            30-Sep-2022 11:04                5010
function.bzdecompress.php                          30-Sep-2022 11:04                6328
function.bzerrno.php                               30-Sep-2022 11:04                3176
function.bzerror.php                               30-Sep-2022 11:04                4566
function.bzerrstr.php                              30-Sep-2022 11:04                3182
function.bzflush.php                               30-Sep-2022 11:04                3297
function.bzopen.php                                30-Sep-2022 11:04                5354
function.bzread.php                                30-Sep-2022 11:04                7008
function.bzwrite.php                               30-Sep-2022 11:04                6243
function.cal-days-in-month.php                     30-Sep-2022 11:04                4526
function.cal-from-jd.php                           30-Sep-2022 11:04                7103
function.cal-info.php                              30-Sep-2022 11:04                5842
function.cal-to-jd.php                             30-Sep-2022 11:04                5658
function.call-user-func-array.php                  30-Sep-2022 11:05               14590
function.call-user-func.php                        30-Sep-2022 11:05               15262
function.ceil.php                                  30-Sep-2022 11:05                5065
function.chdir.php                                 30-Sep-2022 11:04                5512
function.checkdate.php                             30-Sep-2022 11:04                5173
function.checkdnsrr.php                            30-Sep-2022 11:05                4922
function.chgrp.php                                 30-Sep-2022 11:04                6809
function.chmod.php                                 30-Sep-2022 11:04                9157
function.chop.php                                  30-Sep-2022 11:05                2042
function.chown.php                                 30-Sep-2022 11:04                6763
function.chr.php                                   30-Sep-2022 11:05                9886
function.chroot.php                                30-Sep-2022 11:04                4653
function.chunk-split.php                           30-Sep-2022 11:05                5300
function.class-alias.php                           30-Sep-2022 11:05                7414
function.class-exists.php                          30-Sep-2022 11:05                7123
function.class-implements.php                      30-Sep-2022 11:05                6412
function.class-parents.php                         30-Sep-2022 11:05                6127
function.class-uses.php                            30-Sep-2022 11:05                6074
function.clearstatcache.php                        30-Sep-2022 11:04               10715
function.cli-get-process-title.php                 30-Sep-2022 11:04                4531
function.cli-set-process-title.php                 30-Sep-2022 11:04                5867
function.closedir.php                              30-Sep-2022 11:04                4862
function.closelog.php                              30-Sep-2022 11:05                2964
function.com-create-guid.php                       30-Sep-2022 11:05                2869
function.com-event-sink.php                        30-Sep-2022 11:05               10784
function.com-get-active-object.php                 30-Sep-2022 11:05                5731
function.com-load-typelib.php                      30-Sep-2022 11:05                5053
function.com-message-pump.php                      30-Sep-2022 11:05                4098
function.com-print-typeinfo.php                    30-Sep-2022 11:05                4907
function.commonmark-parse.php                      30-Sep-2022 11:05                3527
function.commonmark-render-html.php                30-Sep-2022 11:05                3970
function.commonmark-render-latex.php               30-Sep-2022 11:05                4246
function.commonmark-render-man.php                 30-Sep-2022 11:05                4228
function.commonmark-render-xml.php                 30-Sep-2022 11:05                3927
function.commonmark-render.php                     30-Sep-2022 11:05                4174
function.compact.php                               30-Sep-2022 11:05                7832
function.connection-aborted.php                    30-Sep-2022 11:05                3043
function.connection-status.php                     30-Sep-2022 11:05                3161
function.constant.php                              30-Sep-2022 11:05                7758
function.convert-cyr-string.php                    30-Sep-2022 11:05                5364
function.convert-uudecode.php                      30-Sep-2022 11:05                4549
function.convert-uuencode.php                      30-Sep-2022 11:05                5489
function.copy.php                                  30-Sep-2022 11:04                5973
function.cos.php                                   30-Sep-2022 11:05                3877
function.cosh.php                                  30-Sep-2022 11:05                3124
function.count-chars.php                           30-Sep-2022 11:05                7400
function.count.php                                 30-Sep-2022 11:05               16838
function.crc32.php                                 30-Sep-2022 11:05                7617
function.create-function.php                       30-Sep-2022 11:05               19311
function.crypt.php                                 30-Sep-2022 11:05               20649
function.ctype-alnum.php                           30-Sep-2022 11:05                6881
function.ctype-alpha.php                           30-Sep-2022 11:05                7258
function.ctype-cntrl.php                           30-Sep-2022 11:05                6909
function.ctype-digit.php                           30-Sep-2022 11:05                9320
function.ctype-graph.php                           30-Sep-2022 11:05                7580
function.ctype-lower.php                           30-Sep-2022 11:05                6908
function.ctype-print.php                           30-Sep-2022 11:05                7683
function.ctype-punct.php                           30-Sep-2022 11:05                6865
function.ctype-space.php                           30-Sep-2022 11:05                7988
function.ctype-upper.php                           30-Sep-2022 11:05                6911
function.ctype-xdigit.php                          30-Sep-2022 11:05                6709
function.cubrid-affected-rows.php                  30-Sep-2022 11:04                9491
function.cubrid-bind.php                           30-Sep-2022 11:04               22032
function.cubrid-client-encoding.php                30-Sep-2022 11:04                5508
function.cubrid-close-prepare.php                  30-Sep-2022 11:04                6816
function.cubrid-close-request.php                  30-Sep-2022 11:04                6799
function.cubrid-close.php                          30-Sep-2022 11:04                6711
function.cubrid-col-get.php                        30-Sep-2022 11:04                8929
function.cubrid-col-size.php                       30-Sep-2022 11:04                8914
function.cubrid-column-names.php                   30-Sep-2022 11:04                8883
function.cubrid-column-types.php                   30-Sep-2022 11:04                8861
function.cubrid-commit.php                         30-Sep-2022 11:04               16368
function.cubrid-connect-with-url.php               30-Sep-2022 11:04               16493
function.cubrid-connect.php                        30-Sep-2022 11:04               12537
function.cubrid-current-oid.php                    30-Sep-2022 11:04                6069
function.cubrid-data-seek.php                      30-Sep-2022 11:04                7319
function.cubrid-db-name.php                        30-Sep-2022 11:04                6607
function.cubrid-disconnect.php                     30-Sep-2022 11:04                7550
function.cubrid-drop.php                           30-Sep-2022 11:04               11639
function.cubrid-errno.php                          30-Sep-2022 11:04                6829
function.cubrid-error-code-facility.php            30-Sep-2022 11:04                6108
function.cubrid-error-code.php                     30-Sep-2022 11:04                6026
function.cubrid-error-msg.php                      30-Sep-2022 11:04                5449
function.cubrid-error.php                          30-Sep-2022 11:04                6710
function.cubrid-execute.php                        30-Sep-2022 11:04               14833
function.cubrid-fetch-array.php                    30-Sep-2022 11:04               10422
function.cubrid-fetch-assoc.php                    30-Sep-2022 11:04                9501
function.cubrid-fetch-field.php                    30-Sep-2022 11:04               14566
function.cubrid-fetch-lengths.php                  30-Sep-2022 11:04                6189
function.cubrid-fetch-object.php                   30-Sep-2022 11:04               12313
function.cubrid-fetch-row.php                      30-Sep-2022 11:04                9341
function.cubrid-fetch.php                          30-Sep-2022 11:04               10775
function.cubrid-field-flags.php                    30-Sep-2022 11:04                7986
function.cubrid-field-len.php                      30-Sep-2022 11:04                8407
function.cubrid-field-name.php                     30-Sep-2022 11:04                7230
function.cubrid-field-seek.php                     30-Sep-2022 11:04               11044
function.cubrid-field-table.php                    30-Sep-2022 11:04                7472
function.cubrid-field-type.php                     30-Sep-2022 11:04                7507
function.cubrid-free-result.php                    30-Sep-2022 11:04                5787
function.cubrid-get-autocommit.php                 30-Sep-2022 11:04                3692
function.cubrid-get-charset.php                    30-Sep-2022 11:04                5120
function.cubrid-get-class-name.php                 30-Sep-2022 11:04                6296
function.cubrid-get-client-info.php                30-Sep-2022 11:04                8458
function.cubrid-get-db-parameter.php               30-Sep-2022 11:04               15080
function.cubrid-get-query-timeout.php              30-Sep-2022 11:04                6806
function.cubrid-get-server-info.php                30-Sep-2022 11:04                8687
function.cubrid-get.php                            30-Sep-2022 11:04               10809
function.cubrid-insert-id.php                      30-Sep-2022 11:04                7462
function.cubrid-is-instance.php                    30-Sep-2022 11:04                7423
function.cubrid-list-dbs.php                       30-Sep-2022 11:04                4496
function.cubrid-load-from-glo.php                  30-Sep-2022 11:04                6928
function.cubrid-lob-close.php                      30-Sep-2022 11:04                7464
function.cubrid-lob-export.php                     30-Sep-2022 11:04                7992
function.cubrid-lob-get.php                        30-Sep-2022 11:04                7927
function.cubrid-lob-send.php                       30-Sep-2022 11:04                7124
function.cubrid-lob-size.php                       30-Sep-2022 11:04                6062
function.cubrid-lob2-bind.php                      30-Sep-2022 11:04                9962
function.cubrid-lob2-close.php                     30-Sep-2022 11:04                3336
function.cubrid-lob2-export.php                    30-Sep-2022 11:04                9062
function.cubrid-lob2-import.php                    30-Sep-2022 11:04                8918
function.cubrid-lob2-new.php                       30-Sep-2022 11:04                3825
function.cubrid-lob2-read.php                      30-Sep-2022 11:04               14763
function.cubrid-lob2-seek.php                      30-Sep-2022 11:04               11799
function.cubrid-lob2-seek64.php                    30-Sep-2022 11:04               13590
function.cubrid-lob2-size.php                      30-Sep-2022 11:04                4411
function.cubrid-lob2-size64.php                    30-Sep-2022 11:04                4699
function.cubrid-lob2-tell.php                      30-Sep-2022 11:04                4434
function.cubrid-lob2-tell64.php                    30-Sep-2022 11:04                4741
function.cubrid-lob2-write.php                     30-Sep-2022 11:04               14630
function.cubrid-lock-read.php                      30-Sep-2022 11:04                9260
function.cubrid-lock-write.php                     30-Sep-2022 11:04                9690
function.cubrid-move-cursor.php                    30-Sep-2022 11:04                9542
function.cubrid-new-glo.php                        30-Sep-2022 11:04                7052
function.cubrid-next-result.php                    30-Sep-2022 11:04               17473
function.cubrid-num-cols.php                       30-Sep-2022 11:04                6035
function.cubrid-num-fields.php                     30-Sep-2022 11:04                5716
function.cubrid-num-rows.php                       30-Sep-2022 11:04                7490
function.cubrid-pconnect-with-url.php              30-Sep-2022 11:04               16184
function.cubrid-pconnect.php                       30-Sep-2022 11:04               12545
function.cubrid-ping.php                           30-Sep-2022 11:04                6387
function.cubrid-prepare.php                        30-Sep-2022 11:04               10357
function.cubrid-put.php                            30-Sep-2022 11:04               11860
function.cubrid-query.php                          30-Sep-2022 11:04               16019
function.cubrid-real-escape-string.php             30-Sep-2022 11:04                8413
function.cubrid-result.php                         30-Sep-2022 11:04                7565
function.cubrid-rollback.php                       30-Sep-2022 11:04               15512
function.cubrid-save-to-glo.php                    30-Sep-2022 11:04                6779
function.cubrid-schema.php                         30-Sep-2022 11:04               20673
function.cubrid-send-glo.php                       30-Sep-2022 11:04                6212
function.cubrid-seq-drop.php                       30-Sep-2022 11:04                9778
function.cubrid-seq-insert.php                     30-Sep-2022 11:04               10157
function.cubrid-seq-put.php                        30-Sep-2022 11:04               10128
function.cubrid-set-add.php                        30-Sep-2022 11:04                9480
function.cubrid-set-autocommit.php                 30-Sep-2022 11:04                4073
function.cubrid-set-db-parameter.php               30-Sep-2022 11:04                8165
function.cubrid-set-drop.php                       30-Sep-2022 11:04                9435
function.cubrid-set-query-timeout.php              30-Sep-2022 11:04                3449
function.cubrid-unbuffered-query.php               30-Sep-2022 11:04                7327
function.cubrid-version.php                        30-Sep-2022 11:04                8964
function.curl-close.php                            30-Sep-2022 11:05                6152
function.curl-copy-handle.php                      30-Sep-2022 11:05                6457
function.curl-errno.php                            30-Sep-2022 11:05                6136
function.curl-error.php                            30-Sep-2022 11:05                6079
function.curl-escape.php                           30-Sep-2022 11:05                7531
function.curl-exec.php                             30-Sep-2022 11:05                7166
function.curl-getinfo.php                          30-Sep-2022 11:05               31328
function.curl-init.php                             30-Sep-2022 11:05                6987
function.curl-multi-add-handle.php                 30-Sep-2022 11:05               10477
function.curl-multi-close.php                      30-Sep-2022 11:05                9913
function.curl-multi-errno.php                      30-Sep-2022 11:05                3762
function.curl-multi-exec.php                       30-Sep-2022 11:05               10603
function.curl-multi-getcontent.php                 30-Sep-2022 11:05                4005
function.curl-multi-info-read.php                  30-Sep-2022 11:05               12393
function.curl-multi-init.php                       30-Sep-2022 11:05                9145
function.curl-multi-remove-handle.php              30-Sep-2022 11:05                5299
function.curl-multi-select.php                     30-Sep-2022 11:05                4316
function.curl-multi-setopt.php                     30-Sep-2022 11:05               10445
function.curl-multi-strerror.php                   30-Sep-2022 11:05                7360
function.curl-pause.php                            30-Sep-2022 11:05                3538
function.curl-reset.php                            30-Sep-2022 11:05                6695
function.curl-setopt-array.php                     30-Sep-2022 11:05                7780
function.curl-setopt.php                           30-Sep-2022 11:05              131917
function.curl-share-close.php                      30-Sep-2022 11:05                8404
function.curl-share-errno.php                      30-Sep-2022 11:05                3864
function.curl-share-init.php                       30-Sep-2022 11:05                8017
function.curl-share-setopt.php                     30-Sep-2022 11:05               10558
function.curl-share-strerror.php                   30-Sep-2022 11:05                3327
function.curl-strerror.php                         30-Sep-2022 11:05                6330
function.curl-unescape.php                         30-Sep-2022 11:05                8013
function.curl-version.php                          30-Sep-2022 11:05                7575
function.curl_upkeep.php                           30-Sep-2022 11:05                6859
function.current.php                               30-Sep-2022 11:05               10723
function.date-add.php                              30-Sep-2022 11:04                1691
function.date-create-from-format.php               30-Sep-2022 11:04                1866
function.date-create-immutable-from-format.php     30-Sep-2022 11:04                1978
function.date-create-immutable.php                 30-Sep-2022 11:04                1870
function.date-create.php                           30-Sep-2022 11:04                1744
function.date-date-set.php                         30-Sep-2022 11:04                1750
function.date-default-timezone-get.php             30-Sep-2022 11:04                7272
function.date-default-timezone-set.php             30-Sep-2022 11:04                5903
function.date-diff.php                             30-Sep-2022 11:04                1710
function.date-format.php                           30-Sep-2022 11:04                1718
function.date-get-last-errors.php                  30-Sep-2022 11:04                1847
function.date-interval-create-from-date-string.php 30-Sep-2022 11:04                1994
function.date-interval-format.php                  30-Sep-2022 11:04                1845
function.date-isodate-set.php                      30-Sep-2022 11:04                1773
function.date-modify.php                           30-Sep-2022 11:04                1722
function.date-offset-get.php                       30-Sep-2022 11:04                1766
function.date-parse-from-format.php                30-Sep-2022 11:04                5969
function.date-parse.php                            30-Sep-2022 11:04                7039
function.date-sub.php                              30-Sep-2022 11:04                2281
function.date-sun-info.php                         30-Sep-2022 11:04               12132
function.date-sunrise.php                          30-Sep-2022 11:04               13688
function.date-sunset.php                           30-Sep-2022 11:04               13778
function.date-time-set.php                         30-Sep-2022 11:04                1736
function.date-timestamp-get.php                    30-Sep-2022 11:04                1795
function.date-timestamp-set.php                    30-Sep-2022 11:04                1803
function.date-timezone-get.php                     30-Sep-2022 11:04                1793
function.date-timezone-set.php                     30-Sep-2022 11:04                1764
function.date.php                                  30-Sep-2022 11:04               22985
function.db2-autocommit.php                        30-Sep-2022 11:04               11290
function.db2-bind-param.php                        30-Sep-2022 11:04               23564
function.db2-client-info.php                       30-Sep-2022 11:04               13299
function.db2-close.php                             30-Sep-2022 11:04                5702
function.db2-column-privileges.php                 30-Sep-2022 11:04                8382
function.db2-columns.php                           30-Sep-2022 11:04               10329
function.db2-commit.php                            30-Sep-2022 11:04                3626
function.db2-conn-error.php                        30-Sep-2022 11:04                7066
function.db2-conn-errormsg.php                     30-Sep-2022 11:04                6870
function.db2-connect.php                           30-Sep-2022 11:04               43465
function.db2-cursor-type.php                       30-Sep-2022 11:04                3115
function.db2-escape-string.php                     30-Sep-2022 11:04                8244
function.db2-exec.php                              30-Sep-2022 11:04               29840
function.db2-execute.php                           30-Sep-2022 11:04               28901
function.db2-fetch-array.php                       30-Sep-2022 11:04               12019
function.db2-fetch-assoc.php                       30-Sep-2022 11:04               11950
function.db2-fetch-both.php                        30-Sep-2022 11:04               12581
function.db2-fetch-object.php                      30-Sep-2022 11:04                9555
function.db2-fetch-row.php                         30-Sep-2022 11:04               17249
function.db2-field-display-size.php                30-Sep-2022 11:04                4971
function.db2-field-name.php                        30-Sep-2022 11:04                4825
function.db2-field-num.php                         30-Sep-2022 11:04                4862
function.db2-field-precision.php                   30-Sep-2022 11:04                4870
function.db2-field-scale.php                       30-Sep-2022 11:04                4849
function.db2-field-type.php                        30-Sep-2022 11:04                4848
function.db2-field-width.php                       30-Sep-2022 11:04                5091
function.db2-foreign-keys.php                      30-Sep-2022 11:04                8812
function.db2-free-result.php                       30-Sep-2022 11:04                3233
function.db2-free-stmt.php                         30-Sep-2022 11:04                3212
function.db2-get-option.php                        30-Sep-2022 11:04               25795
function.db2-last-insert-id.php                    30-Sep-2022 11:04                8594
function.db2-lob-read.php                          30-Sep-2022 11:04               18198
function.db2-next-result.php                       30-Sep-2022 11:04                9249
function.db2-num-fields.php                        30-Sep-2022 11:04                7440
function.db2-num-rows.php                          30-Sep-2022 11:04                4443
function.db2-pclose.php                            30-Sep-2022 11:04                5794
function.db2-pconnect.php                          30-Sep-2022 11:04               34851
function.db2-prepare.php                           30-Sep-2022 11:04               11126
function.db2-primary-keys.php                      30-Sep-2022 11:04                7524
function.db2-procedure-columns.php                 30-Sep-2022 11:04               11801
function.db2-procedures.php                        30-Sep-2022 11:04                8161
function.db2-result.php                            30-Sep-2022 11:04                8323
function.db2-rollback.php                          30-Sep-2022 11:04               10098
function.db2-server-info.php                       30-Sep-2022 11:04               27114
function.db2-set-option.php                        30-Sep-2022 11:04               68515
function.db2-special-columns.php                   30-Sep-2022 11:04               10318
function.db2-statistics.php                        30-Sep-2022 11:04               12691
function.db2-stmt-error.php                        30-Sep-2022 11:04                4494
function.db2-stmt-errormsg.php                     30-Sep-2022 11:04                4123
function.db2-table-privileges.php                  30-Sep-2022 11:04                8205
function.db2-tables.php                            30-Sep-2022 11:04                8190
function.dba-close.php                             30-Sep-2022 11:04                3271
function.dba-delete.php                            30-Sep-2022 11:04                4108
function.dba-exists.php                            30-Sep-2022 11:04                4026
function.dba-fetch.php                             30-Sep-2022 11:04                5537
function.dba-firstkey.php                          30-Sep-2022 11:04                3664
function.dba-handlers.php                          30-Sep-2022 11:04                5732
function.dba-insert.php                            30-Sep-2022 11:04                4670
function.dba-key-split.php                         30-Sep-2022 11:04                3741
function.dba-list.php                              30-Sep-2022 11:04                2223
function.dba-nextkey.php                           30-Sep-2022 11:04                3591
function.dba-open.php                              30-Sep-2022 11:04               12188
function.dba-optimize.php                          30-Sep-2022 11:04                3133
function.dba-popen.php                             30-Sep-2022 11:04                6597
function.dba-replace.php                           30-Sep-2022 11:04                4435
function.dba-sync.php                              30-Sep-2022 11:04                3180
function.dbase-add-record.php                      30-Sep-2022 11:04                7374
function.dbase-close.php                           30-Sep-2022 11:04                5325
function.dbase-create.php                          30-Sep-2022 11:04                8665
function.dbase-delete-record.php                   30-Sep-2022 11:04                4970
function.dbase-get-header-info.php                 30-Sep-2022 11:04                7263
function.dbase-get-record-with-names.php           30-Sep-2022 11:04                9096
function.dbase-get-record.php                      30-Sep-2022 11:04                5640
function.dbase-numfields.php                       30-Sep-2022 11:04                6296
function.dbase-numrecords.php                      30-Sep-2022 11:04                7842
function.dbase-open.php                            30-Sep-2022 11:04                6440
function.dbase-pack.php                            30-Sep-2022 11:04                6881
function.dbase-replace-record.php                  30-Sep-2022 11:04               10050
function.dcgettext.php                             30-Sep-2022 11:04                3270
function.dcngettext.php                            30-Sep-2022 11:04                3824
function.debug-backtrace.php                       30-Sep-2022 11:04                9647
function.debug-print-backtrace.php                 30-Sep-2022 11:04                6580
function.debug-zval-dump.php                       30-Sep-2022 11:05               10510
function.decbin.php                                30-Sep-2022 11:05                8872
function.dechex.php                                30-Sep-2022 11:05                7384
function.decoct.php                                30-Sep-2022 11:05                4797
function.define.php                                30-Sep-2022 11:05               11892
function.defined.php                               30-Sep-2022 11:05                5321
function.deflate-add.php                           30-Sep-2022 11:04                5074
function.deflate-init.php                          30-Sep-2022 11:04                7130
function.deg2rad.php                               30-Sep-2022 11:05                3925
function.delete.php                                30-Sep-2022 11:04                2455
function.dgettext.php                              30-Sep-2022 11:04                3104
function.die.php                                   30-Sep-2022 11:05                1547
function.dio-close.php                             30-Sep-2022 11:04                3915
function.dio-fcntl.php                             30-Sep-2022 11:04                9285
function.dio-open.php                              30-Sep-2022 11:04                7430
function.dio-read.php                              30-Sep-2022 11:04                3423
function.dio-seek.php                              30-Sep-2022 11:04                7571
function.dio-stat.php                              30-Sep-2022 11:04                4108
function.dio-tcsetattr.php                         30-Sep-2022 11:04                7064
function.dio-truncate.php                          30-Sep-2022 11:04                3516
function.dio-write.php                             30-Sep-2022 11:04                3752
function.dir.php                                   30-Sep-2022 11:04                7055
function.dirname.php                               30-Sep-2022 11:04                9816
function.disk-free-space.php                       30-Sep-2022 11:04                5498
function.disk-total-space.php                      30-Sep-2022 11:04                5235
function.diskfreespace.php                         30-Sep-2022 11:04                1758
function.dl.php                                    30-Sep-2022 11:04               10095
function.dngettext.php                             30-Sep-2022 11:04                3654
function.dns-check-record.php                      30-Sep-2022 11:05                1712
function.dns-get-mx.php                            30-Sep-2022 11:05                1682
function.dns-get-record.php                        30-Sep-2022 11:05               23159
function.dom-import-simplexml.php                  30-Sep-2022 11:05                7102
function.doubleval.php                             30-Sep-2022 11:05                1667
function.each.php                                  30-Sep-2022 11:05               11719
function.easter-date.php                           30-Sep-2022 11:04               12036
function.easter-days.php                           30-Sep-2022 11:04                7231
function.echo.php                                  30-Sep-2022 11:05               20386
function.eio-busy.php                              30-Sep-2022 11:05                4638
function.eio-cancel.php                            30-Sep-2022 11:05                7696
function.eio-chmod.php                             30-Sep-2022 11:05                6077
function.eio-chown.php                             30-Sep-2022 11:05                6197
function.eio-close.php                             30-Sep-2022 11:05                5571
function.eio-custom.php                            30-Sep-2022 11:05               10816
function.eio-dup2.php                              30-Sep-2022 11:05                5642
function.eio-event-loop.php                        30-Sep-2022 11:05                5905
function.eio-fallocate.php                         30-Sep-2022 11:05                7250
function.eio-fchmod.php                            30-Sep-2022 11:05                6104
function.eio-fchown.php                            30-Sep-2022 11:05                6331
function.eio-fdatasync.php                         30-Sep-2022 11:05                5521
function.eio-fstat.php                             30-Sep-2022 11:05               12293
function.eio-fstatvfs.php                          30-Sep-2022 11:05                5747
function.eio-fsync.php                             30-Sep-2022 11:05                5623
function.eio-ftruncate.php                         30-Sep-2022 11:05                6050
function.eio-futime.php                            30-Sep-2022 11:05                6470
function.eio-get-event-stream.php                  30-Sep-2022 11:05                8761
function.eio-get-last-error.php                    30-Sep-2022 11:05                3120
function.eio-grp-add.php                           30-Sep-2022 11:05               12450
function.eio-grp-cancel.php                        30-Sep-2022 11:05                3141
function.eio-grp-limit.php                         30-Sep-2022 11:05                2977
function.eio-grp.php                               30-Sep-2022 11:05               12578
function.eio-init.php                              30-Sep-2022 11:05                2664
function.eio-link.php                              30-Sep-2022 11:05               12869
function.eio-lstat.php                             30-Sep-2022 11:05               10059
function.eio-mkdir.php                             30-Sep-2022 11:05                9341
function.eio-mknod.php                             30-Sep-2022 11:05               11414
function.eio-nop.php                               30-Sep-2022 11:05                5223
function.eio-npending.php                          30-Sep-2022 11:05                3014
function.eio-nready.php                            30-Sep-2022 11:05                2782
function.eio-nreqs.php                             30-Sep-2022 11:05                5675
function.eio-nthreads.php                          30-Sep-2022 11:05                3592
function.eio-open.php                              30-Sep-2022 11:05               12379
function.eio-poll.php                              30-Sep-2022 11:05                5986
function.eio-read.php                              30-Sep-2022 11:05               13428
function.eio-readahead.php                         30-Sep-2022 11:05                6168
function.eio-readdir.php                           30-Sep-2022 11:05               16956
function.eio-readlink.php                          30-Sep-2022 11:05               12558
function.eio-realpath.php                          30-Sep-2022 11:05                5199
function.eio-rename.php                            30-Sep-2022 11:05                9375
function.eio-rmdir.php                             30-Sep-2022 11:05                8285
function.eio-seek.php                              30-Sep-2022 11:05                6629
function.eio-sendfile.php                          30-Sep-2022 11:05                6384
function.eio-set-max-idle.php                      30-Sep-2022 11:05                3179
function.eio-set-max-parallel.php                  30-Sep-2022 11:05                3223
function.eio-set-max-poll-reqs.php                 30-Sep-2022 11:05                2442
function.eio-set-max-poll-time.php                 30-Sep-2022 11:05                2536
function.eio-set-min-parallel.php                  30-Sep-2022 11:05                3212
function.eio-stat.php                              30-Sep-2022 11:05               10115
function.eio-statvfs.php                           30-Sep-2022 11:05                8431
function.eio-symlink.php                           30-Sep-2022 11:05               10997
function.eio-sync-file-range.php                   30-Sep-2022 11:05                7051
function.eio-sync.php                              30-Sep-2022 11:05                2765
function.eio-syncfs.php                            30-Sep-2022 11:05                5125
function.eio-truncate.php                          30-Sep-2022 11:05                5916
function.eio-unlink.php                            30-Sep-2022 11:05                5152
function.eio-utime.php                             30-Sep-2022 11:05                5996
function.eio-write.php                             30-Sep-2022 11:05                6714
function.empty.php                                 30-Sep-2022 11:05                9912
function.enchant-broker-describe.php               30-Sep-2022 11:04                6092
function.enchant-broker-dict-exists.php            30-Sep-2022 11:04                5575
function.enchant-broker-free-dict.php              30-Sep-2022 11:04                4772
function.enchant-broker-free.php                   30-Sep-2022 11:04                4292
function.enchant-broker-get-dict-path.php          30-Sep-2022 11:04                5112
function.enchant-broker-get-error.php              30-Sep-2022 11:04                3569
function.enchant-broker-init.php                   30-Sep-2022 11:04                3452
function.enchant-broker-list-dicts.php             30-Sep-2022 11:04                6901
function.enchant-broker-request-dict.php           30-Sep-2022 11:04                7177
function.enchant-broker-request-pwl-dict.php       30-Sep-2022 11:04                5391
function.enchant-broker-set-dict-path.php          30-Sep-2022 11:04                5332
function.enchant-broker-set-ordering.php           30-Sep-2022 11:04                4649
function.enchant-dict-add-to-personal.php          30-Sep-2022 11:04                2238
function.enchant-dict-add-to-session.php           30-Sep-2022 11:04                4401
function.enchant-dict-add.php                      30-Sep-2022 11:04                6342
function.enchant-dict-check.php                    30-Sep-2022 11:04                3990
function.enchant-dict-describe.php                 30-Sep-2022 11:04                6524
function.enchant-dict-get-error.php                30-Sep-2022 11:04                3793
function.enchant-dict-is-added.php                 30-Sep-2022 11:04                4299
function.enchant-dict-is-in-session.php            30-Sep-2022 11:04                2224
function.enchant-dict-quick-check.php              30-Sep-2022 11:04                8089
function.enchant-dict-store-replacement.php        30-Sep-2022 11:04                4557
function.enchant-dict-suggest.php                  30-Sep-2022 11:04                7768
function.end.php                                   30-Sep-2022 11:05                6100
function.enum-exists.php                           30-Sep-2022 11:05                5135
function.error-clear-last.php                      30-Sep-2022 11:04                4615
function.error-get-last.php                        30-Sep-2022 11:04                4816
function.error-log.php                             30-Sep-2022 11:04               10835
function.error-reporting.php                       30-Sep-2022 11:04                9348
function.escapeshellarg.php                        30-Sep-2022 11:05                5669
function.escapeshellcmd.php                        30-Sep-2022 11:05                7904
function.eval.php                                  30-Sep-2022 11:05                8876
function.exec.php                                  30-Sep-2022 11:05                9341
function.exif-imagetype.php                        30-Sep-2022 11:04                8552
function.exif-read-data.php                        30-Sep-2022 11:04               23275
function.exif-tagname.php                          30-Sep-2022 11:04                4704
function.exif-thumbnail.php                        30-Sep-2022 11:04                9282
function.exit.php                                  30-Sep-2022 11:05                9775
function.exp.php                                   30-Sep-2022 11:05                4217
function.expect-expectl.php                        30-Sep-2022 11:05               11809
function.expect-popen.php                          30-Sep-2022 11:05                4592
function.explode.php                               30-Sep-2022 11:05               15910
function.expm1.php                                 30-Sep-2022 11:05                3237
function.extension-loaded.php                      30-Sep-2022 11:04                5610
function.extract.php                               30-Sep-2022 11:05               13786
function.ezmlm-hash.php                            30-Sep-2022 11:05                4732
function.fann-cascadetrain-on-data.php             30-Sep-2022 11:05                6121
function.fann-cascadetrain-on-file.php             30-Sep-2022 11:05                5191
function.fann-clear-scaling-params.php             30-Sep-2022 11:05                2466
function.fann-copy.php                             30-Sep-2022 11:05                3128
function.fann-create-from-file.php                 30-Sep-2022 11:05                3185
function.fann-create-shortcut-array.php            30-Sep-2022 11:05                4085
function.fann-create-shortcut.php                  30-Sep-2022 11:05                4902
function.fann-create-sparse-array.php              30-Sep-2022 11:05                4536
function.fann-create-sparse.php                    30-Sep-2022 11:05                5186
function.fann-create-standard-array.php            30-Sep-2022 11:05                4264
function.fann-create-standard.php                  30-Sep-2022 11:05                4931
function.fann-create-train-from-callback.php       30-Sep-2022 11:05                9675
function.fann-create-train.php                     30-Sep-2022 11:05                4549
function.fann-descale-input.php                    30-Sep-2022 11:05                3609
function.fann-descale-output.php                   30-Sep-2022 11:05                3618
function.fann-descale-train.php                    30-Sep-2022 11:05                3616
function.fann-destroy-train.php                    30-Sep-2022 11:05                2466
function.fann-destroy.php                          30-Sep-2022 11:05                2465
function.fann-duplicate-train-data.php             30-Sep-2022 11:05                2660
function.fann-get-activation-function.php          30-Sep-2022 11:05                5142
function.fann-get-activation-steepness.php         30-Sep-2022 11:05                5535
function.fann-get-bias-array.php                   30-Sep-2022 11:05                2439
function.fann-get-bit-fail-limit.php               30-Sep-2022 11:05                3593
function.fann-get-bit-fail.php                     30-Sep-2022 11:05                4895
function.fann-get-cascade-activation-functions-..> 30-Sep-2022 11:05                3688
function.fann-get-cascade-activation-functions.php 30-Sep-2022 11:05                4144
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:05                3744
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:05                3893
function.fann-get-cascade-candidate-change-frac..> 30-Sep-2022 11:05                5020
function.fann-get-cascade-candidate-limit.php      30-Sep-2022 11:05                3369
function.fann-get-cascade-candidate-stagnation-..> 30-Sep-2022 11:05                4133
function.fann-get-cascade-max-cand-epochs.php      30-Sep-2022 11:05                3261
function.fann-get-cascade-max-out-epochs.php       30-Sep-2022 11:05                3184
function.fann-get-cascade-min-cand-epochs.php      30-Sep-2022 11:05                3578
function.fann-get-cascade-min-out-epochs.php       30-Sep-2022 11:05                3537
function.fann-get-cascade-num-candidate-groups.php 30-Sep-2022 11:05                3649
function.fann-get-cascade-num-candidates.php       30-Sep-2022 11:05                5834
function.fann-get-cascade-output-change-fractio..> 30-Sep-2022 11:05                4951
function.fann-get-cascade-output-stagnation-epo..> 30-Sep-2022 11:05                4078
function.fann-get-cascade-weight-multiplier.php    30-Sep-2022 11:05                3332
function.fann-get-connection-array.php             30-Sep-2022 11:05                2491
function.fann-get-connection-rate.php              30-Sep-2022 11:05                2580
function.fann-get-errno.php                        30-Sep-2022 11:05                3095
function.fann-get-errstr.php                       30-Sep-2022 11:05                3114
function.fann-get-layer-array.php                  30-Sep-2022 11:05                2540
function.fann-get-learning-momentum.php            30-Sep-2022 11:05                3581
function.fann-get-learning-rate.php                30-Sep-2022 11:05                3435
function.fann-get-mse.php                          30-Sep-2022 11:05                3056
function.fann-get-network-type.php                 30-Sep-2022 11:05                2507
function.fann-get-num-input.php                    30-Sep-2022 11:05                2436
function.fann-get-num-layers.php                   30-Sep-2022 11:05                2470
function.fann-get-num-output.php                   30-Sep-2022 11:05                2452
function.fann-get-quickprop-decay.php              30-Sep-2022 11:05                3197
function.fann-get-quickprop-mu.php                 30-Sep-2022 11:05                3175
function.fann-get-rprop-decrease-factor.php        30-Sep-2022 11:05                3277
function.fann-get-rprop-delta-max.php              30-Sep-2022 11:05                3337
function.fann-get-rprop-delta-min.php              30-Sep-2022 11:05                3122
function.fann-get-rprop-delta-zero.php             30-Sep-2022 11:05                3540
function.fann-get-rprop-increase-factor.php        30-Sep-2022 11:05                3268
function.fann-get-sarprop-step-error-shift.php     30-Sep-2022 11:05                3652
function.fann-get-sarprop-step-error-threshold-..> 30-Sep-2022 11:05                3755
function.fann-get-sarprop-temperature.php          30-Sep-2022 11:05                3426
function.fann-get-sarprop-weight-decay-shift.php   30-Sep-2022 11:05                3553
function.fann-get-total-connections.php            30-Sep-2022 11:05                2637
function.fann-get-total-neurons.php                30-Sep-2022 11:05                2707
function.fann-get-train-error-function.php         30-Sep-2022 11:05                3498
function.fann-get-train-stop-function.php          30-Sep-2022 11:05                3488
function.fann-get-training-algorithm.php           30-Sep-2022 11:05                3674
function.fann-init-weights.php                     30-Sep-2022 11:05                4379
function.fann-length-train-data.php                30-Sep-2022 11:05                2635
function.fann-merge-train-data.php                 30-Sep-2022 11:05                2864
function.fann-num-input-train-data.php             30-Sep-2022 11:05                3425
function.fann-num-output-train-data.php            30-Sep-2022 11:05                3411
function.fann-print-error.php                      30-Sep-2022 11:05                2850
function.fann-randomize-weights.php                30-Sep-2022 11:05                3684
function.fann-read-train-from-file.php             30-Sep-2022 11:05                5102
function.fann-reset-errno.php                      30-Sep-2022 11:05                3104
function.fann-reset-errstr.php                     30-Sep-2022 11:05                3079
function.fann-reset-mse.php                        30-Sep-2022 11:05                3295
function.fann-run.php                              30-Sep-2022 11:05                2663
function.fann-save-train.php                       30-Sep-2022 11:05                3317
function.fann-save.php                             30-Sep-2022 11:05                4209
function.fann-scale-input-train-data.php           30-Sep-2022 11:05                4182
function.fann-scale-input.php                      30-Sep-2022 11:05                3773
function.fann-scale-output-train-data.php          30-Sep-2022 11:05                4210
function.fann-scale-output.php                     30-Sep-2022 11:05                3761
function.fann-scale-train-data.php                 30-Sep-2022 11:05                4207
function.fann-scale-train.php                      30-Sep-2022 11:05                3651
function.fann-set-activation-function-hidden.php   30-Sep-2022 11:05                4391
function.fann-set-activation-function-layer.php    30-Sep-2022 11:05                4947
function.fann-set-activation-function-output.php   30-Sep-2022 11:05                4417
function.fann-set-activation-function.php          30-Sep-2022 11:05                6326
function.fann-set-activation-steepness-hidden.php  30-Sep-2022 11:05                4653
function.fann-set-activation-steepness-layer.php   30-Sep-2022 11:05                5140
function.fann-set-activation-steepness-output.php  30-Sep-2022 11:05                4653
function.fann-set-activation-steepness.php         30-Sep-2022 11:05                6114
function.fann-set-bit-fail-limit.php               30-Sep-2022 11:05                3225
function.fann-set-callback.php                     30-Sep-2022 11:05                5645
function.fann-set-cascade-activation-functions.php 30-Sep-2022 11:05                3905
function.fann-set-cascade-activation-steepnesse..> 30-Sep-2022 11:05                4112
function.fann-set-cascade-candidate-change-frac..> 30-Sep-2022 11:05                3573
function.fann-set-cascade-candidate-limit.php      30-Sep-2022 11:05                3347
function.fann-set-cascade-candidate-stagnation-..> 30-Sep-2022 11:05                3638
function.fann-set-cascade-max-cand-epochs.php      30-Sep-2022 11:05                3375
function.fann-set-cascade-max-out-epochs.php       30-Sep-2022 11:05                3332
function.fann-set-cascade-min-cand-epochs.php      30-Sep-2022 11:05                3693
function.fann-set-cascade-min-out-epochs.php       30-Sep-2022 11:05                3685
function.fann-set-cascade-num-candidate-groups.php 30-Sep-2022 11:05                3433
function.fann-set-cascade-output-change-fractio..> 30-Sep-2022 11:05                3539
function.fann-set-cascade-output-stagnation-epo..> 30-Sep-2022 11:05                3605
function.fann-set-cascade-weight-multiplier.php    30-Sep-2022 11:05                3347
function.fann-set-error-log.php                    30-Sep-2022 11:05                2841
function.fann-set-input-scaling-params.php         30-Sep-2022 11:05                4411
function.fann-set-learning-momentum.php            30-Sep-2022 11:05                3698
function.fann-set-learning-rate.php                30-Sep-2022 11:05                3624
function.fann-set-output-scaling-params.php        30-Sep-2022 11:05                4413
function.fann-set-quickprop-decay.php              30-Sep-2022 11:05                3281
function.fann-set-quickprop-mu.php                 30-Sep-2022 11:05                3116
function.fann-set-rprop-decrease-factor.php        30-Sep-2022 11:05                3389
function.fann-set-rprop-delta-max.php              30-Sep-2022 11:05                3536
function.fann-set-rprop-delta-min.php              30-Sep-2022 11:05                3311
function.fann-set-rprop-delta-zero.php             30-Sep-2022 11:05                3718
function.fann-set-rprop-increase-factor.php        30-Sep-2022 11:05                3427
function.fann-set-sarprop-step-error-shift.php     30-Sep-2022 11:05                3826
function.fann-set-sarprop-step-error-threshold-..> 30-Sep-2022 11:05                3992
function.fann-set-sarprop-temperature.php          30-Sep-2022 11:05                3638
function.fann-set-sarprop-weight-decay-shift.php   30-Sep-2022 11:05                3782
function.fann-set-scaling-params.php               30-Sep-2022 11:05                5490
function.fann-set-train-error-function.php         30-Sep-2022 11:05                3674
function.fann-set-train-stop-function.php          30-Sep-2022 11:05                3675
function.fann-set-training-algorithm.php           30-Sep-2022 11:05                3574
function.fann-set-weight-array.php                 30-Sep-2022 11:05                3005
function.fann-set-weight.php                       30-Sep-2022 11:05                3310
function.fann-shuffle-train-data.php               30-Sep-2022 11:05                2733
function.fann-subset-train-data.php                30-Sep-2022 11:05                3975
function.fann-test-data.php                        30-Sep-2022 11:05                4127
function.fann-test.php                             30-Sep-2022 11:05                4543
function.fann-train-epoch.php                      30-Sep-2022 11:05                4669
function.fann-train-on-data.php                    30-Sep-2022 11:05                6475
function.fann-train-on-file.php                    30-Sep-2022 11:05                6518
function.fann-train.php                            30-Sep-2022 11:05                4572
function.fastcgi-finish-request.php                30-Sep-2022 11:05                2489
function.fbird-add-user.php                        30-Sep-2022 11:04                2313
function.fbird-affected-rows.php                   30-Sep-2022 11:04                2328
function.fbird-backup.php                          30-Sep-2022 11:04                1727
function.fbird-blob-add.php                        30-Sep-2022 11:04                2686
function.fbird-blob-cancel.php                     30-Sep-2022 11:04                3543
function.fbird-blob-close.php                      30-Sep-2022 11:04                2717
function.fbird-blob-create.php                     30-Sep-2022 11:04                2717
function.fbird-blob-echo.php                       30-Sep-2022 11:04                2490
function.fbird-blob-get.php                        30-Sep-2022 11:04                2483
function.fbird-blob-import.php                     30-Sep-2022 11:04                2713
function.fbird-blob-info.php                       30-Sep-2022 11:04                1759
function.fbird-blob-open.php                       30-Sep-2022 11:04                2480
function.fbird-close.php                           30-Sep-2022 11:04                2251
function.fbird-commit-ret.php                      30-Sep-2022 11:04                1752
function.fbird-commit.php                          30-Sep-2022 11:04                1720
function.fbird-connect.php                         30-Sep-2022 11:04                2257
function.fbird-db-info.php                         30-Sep-2022 11:04                1733
function.fbird-delete-user.php                     30-Sep-2022 11:04                2325
function.fbird-drop-db.php                         30-Sep-2022 11:04                2273
function.fbird-errcode.php                         30-Sep-2022 11:04                2081
function.fbird-errmsg.php                          30-Sep-2022 11:04                2074
function.fbird-execute.php                         30-Sep-2022 11:04                2086
function.fbird-fetch-assoc.php                     30-Sep-2022 11:04                2341
function.fbird-fetch-object.php                    30-Sep-2022 11:04                2352
function.fbird-fetch-row.php                       30-Sep-2022 11:04                2329
function.fbird-field-info.php                      30-Sep-2022 11:04                2156
function.fbird-free-event-handler.php              30-Sep-2022 11:04                2260
function.fbird-free-query.php                      30-Sep-2022 11:04                1788
function.fbird-free-result.php                     30-Sep-2022 11:04                1773
function.fbird-gen-id.php                          30-Sep-2022 11:04                1730
function.fbird-maintain-db.php                     30-Sep-2022 11:04                1775
function.fbird-modify-user.php                     30-Sep-2022 11:04                2341
function.fbird-name-result.php                     30-Sep-2022 11:04                2324
function.fbird-num-fields.php                      30-Sep-2022 11:04                2145
function.fbird-num-params.php                      30-Sep-2022 11:04                2319
function.fbird-param-info.php                      30-Sep-2022 11:04                2324
function.fbird-pconnect.php                        30-Sep-2022 11:04                2274
function.fbird-prepare.php                         30-Sep-2022 11:04                1723
function.fbird-query.php                           30-Sep-2022 11:04                2620
function.fbird-restore.php                         30-Sep-2022 11:04                1730
function.fbird-rollback-ret.php                    30-Sep-2022 11:04                1782
function.fbird-rollback.php                        30-Sep-2022 11:04                1754
function.fbird-server-info.php                     30-Sep-2022 11:04                1785
function.fbird-service-attach.php                  30-Sep-2022 11:04                1824
function.fbird-service-detach.php                  30-Sep-2022 11:04                1836
function.fbird-set-event-handler.php               30-Sep-2022 11:04                2434
function.fbird-trans.php                           30-Sep-2022 11:04                1729
function.fbird-wait-event.php                      30-Sep-2022 11:04                2359
function.fclose.php                                30-Sep-2022 11:04                4280
function.fdatasync.php                             30-Sep-2022 11:04                6015
function.fdf-add-doc-javascript.php                30-Sep-2022 11:05                5452
function.fdf-add-template.php                      30-Sep-2022 11:05                2532
function.fdf-close.php                             30-Sep-2022 11:05                3050
function.fdf-create.php                            30-Sep-2022 11:05                5626
function.fdf-enum-values.php                       30-Sep-2022 11:05                2380
function.fdf-errno.php                             30-Sep-2022 11:05                2830
function.fdf-error.php                             30-Sep-2022 11:05                3169
function.fdf-get-ap.php                            30-Sep-2022 11:05                3984
function.fdf-get-attachment.php                    30-Sep-2022 11:05                6118
function.fdf-get-encoding.php                      30-Sep-2022 11:05                3425
function.fdf-get-file.php                          30-Sep-2022 11:05                3251
function.fdf-get-flags.php                         30-Sep-2022 11:05                2154
function.fdf-get-opt.php                           30-Sep-2022 11:05                2298
function.fdf-get-status.php                        30-Sep-2022 11:05                3250
function.fdf-get-value.php                         30-Sep-2022 11:05                4688
function.fdf-get-version.php                       30-Sep-2022 11:05                3671
function.fdf-header.php                            30-Sep-2022 11:05                2410
function.fdf-next-field-name.php                   30-Sep-2022 11:05                5602
function.fdf-open-string.php                       30-Sep-2022 11:05                5064
function.fdf-open.php                              30-Sep-2022 11:05                6082
function.fdf-remove-item.php                       30-Sep-2022 11:05                2184
function.fdf-save-string.php                       30-Sep-2022 11:05                5975
function.fdf-save.php                              30-Sep-2022 11:05                3947
function.fdf-set-ap.php                            30-Sep-2022 11:05                4128
function.fdf-set-encoding.php                      30-Sep-2022 11:05                3665
function.fdf-set-file.php                          30-Sep-2022 11:05                6792
function.fdf-set-flags.php                         30-Sep-2022 11:05                4174
function.fdf-set-javascript-action.php             30-Sep-2022 11:05                4368
function.fdf-set-on-import-javascript.php          30-Sep-2022 11:05                2977
function.fdf-set-opt.php                           30-Sep-2022 11:05                4405
function.fdf-set-status.php                        30-Sep-2022 11:05                3637
function.fdf-set-submit-form-action.php            30-Sep-2022 11:05                4602
function.fdf-set-target-frame.php                  30-Sep-2022 11:05                3746
function.fdf-set-value.php                         30-Sep-2022 11:05                5361
function.fdf-set-version.php                       30-Sep-2022 11:05                3845
function.fdiv.php                                  30-Sep-2022 11:05                5969
function.feof.php                                  30-Sep-2022 11:04                7853
function.fflush.php                                30-Sep-2022 11:04                5509
function.fgetc.php                                 30-Sep-2022 11:04                6490
function.fgetcsv.php                               30-Sep-2022 11:04               13287
function.fgets.php                                 30-Sep-2022 11:04                8775
function.fgetss.php                                30-Sep-2022 11:04                9783
function.file-exists.php                           30-Sep-2022 11:04                7304
function.file-get-contents.php                     30-Sep-2022 11:04               18652
function.file-put-contents.php                     30-Sep-2022 11:04               13480
function.file.php                                  30-Sep-2022 11:04               11765
function.fileatime.php                             30-Sep-2022 11:04                7250
function.filectime.php                             30-Sep-2022 11:04                7208
function.filegroup.php                             30-Sep-2022 11:04                5731
function.fileinode.php                             30-Sep-2022 11:04                5326
function.filemtime.php                             30-Sep-2022 11:04                6839
function.fileowner.php                             30-Sep-2022 11:04                5689
function.fileperms.php                             30-Sep-2022 11:04               18085
function.filesize.php                              30-Sep-2022 11:04                5805
function.filetype.php                              30-Sep-2022 11:04                6823
function.filter-has-var.php                        30-Sep-2022 11:05                2886
function.filter-id.php                             30-Sep-2022 11:05                2808
function.filter-input-array.php                    30-Sep-2022 11:05               14021
function.filter-input.php                          30-Sep-2022 11:05                7788
function.filter-list.php                           30-Sep-2022 11:05                3654
function.filter-var-array.php                      30-Sep-2022 11:05               13555
function.filter-var.php                            30-Sep-2022 11:05               13831
function.finfo-buffer.php                          30-Sep-2022 11:04                7775
function.finfo-close.php                           30-Sep-2022 11:04                3420
function.finfo-file.php                            30-Sep-2022 11:04                8426
function.finfo-open.php                            30-Sep-2022 11:04               10070
function.finfo-set-flags.php                       30-Sep-2022 11:04                4474
function.floatval.php                              30-Sep-2022 11:05                6540
function.flock.php                                 30-Sep-2022 11:04               13155
function.floor.php                                 30-Sep-2022 11:05                5321
function.flush.php                                 30-Sep-2022 11:04                5061
function.fmod.php                                  30-Sep-2022 11:05                4914
function.fnmatch.php                               30-Sep-2022 11:04                7841
function.fopen.php                                 30-Sep-2022 11:04               23721
function.forward-static-call-array.php             30-Sep-2022 11:05               10176
function.forward-static-call.php                   30-Sep-2022 11:05                9678
function.fpassthru.php                             30-Sep-2022 11:04                7451
function.fpm-get-status.php                        30-Sep-2022 11:05                2489
function.fprintf.php                               30-Sep-2022 11:05               19890
function.fputcsv.php                               30-Sep-2022 11:04               10273
function.fputs.php                                 30-Sep-2022 11:04                1646
function.fread.php                                 30-Sep-2022 11:04               15365
function.frenchtojd.php                            30-Sep-2022 11:04                4222
function.fscanf.php                                30-Sep-2022 11:04                9663
function.fseek.php                                 30-Sep-2022 11:04                7679
function.fsockopen.php                             30-Sep-2022 11:05               17530
function.fstat.php                                 30-Sep-2022 11:04                6120
function.fsync.php                                 30-Sep-2022 11:04                5778
function.ftell.php                                 30-Sep-2022 11:04                6318
function.ftok.php                                  30-Sep-2022 11:05                3637
function.ftp-alloc.php                             30-Sep-2022 11:05                8534
function.ftp-append.php                            30-Sep-2022 11:05                4258
function.ftp-cdup.php                              30-Sep-2022 11:05                6845
function.ftp-chdir.php                             30-Sep-2022 11:05                7902
function.ftp-chmod.php                             30-Sep-2022 11:05                7670
function.ftp-close.php                             30-Sep-2022 11:05                6114
function.ftp-connect.php                           30-Sep-2022 11:05                6626
function.ftp-delete.php                            30-Sep-2022 11:05                6380
function.ftp-exec.php                              30-Sep-2022 11:05                6927
function.ftp-fget.php                              30-Sep-2022 11:05               10307
function.ftp-fput.php                              30-Sep-2022 11:05                9703
function.ftp-get-option.php                        30-Sep-2022 11:05                5950
function.ftp-get.php                               30-Sep-2022 11:05                9571
function.ftp-login.php                             30-Sep-2022 11:05                7026
function.ftp-mdtm.php                              30-Sep-2022 11:05                7618
function.ftp-mkdir.php                             30-Sep-2022 11:05                7217
function.ftp-mlsd.php                              30-Sep-2022 11:05                9225
function.ftp-nb-continue.php                       30-Sep-2022 11:05                5735
function.ftp-nb-fget.php                           30-Sep-2022 11:05               10701
function.ftp-nb-fput.php                           30-Sep-2022 11:05               10430
function.ftp-nb-get.php                            30-Sep-2022 11:05               14911
function.ftp-nb-put.php                            30-Sep-2022 11:05               12227
function.ftp-nlist.php                             30-Sep-2022 11:05                6998
function.ftp-pasv.php                              30-Sep-2022 11:05                7520
function.ftp-put.php                               30-Sep-2022 11:05                9208
function.ftp-pwd.php                               30-Sep-2022 11:05                6180
function.ftp-quit.php                              30-Sep-2022 11:05                1630
function.ftp-raw.php                               30-Sep-2022 11:05                5625
function.ftp-rawlist.php                           30-Sep-2022 11:05                8204
function.ftp-rename.php                            30-Sep-2022 11:05                7409
function.ftp-rmdir.php                             30-Sep-2022 11:05                6843
function.ftp-set-option.php                        30-Sep-2022 11:05                7169
function.ftp-site.php                              30-Sep-2022 11:05                7042
function.ftp-size.php                              30-Sep-2022 11:05                7189
function.ftp-ssl-connect.php                       30-Sep-2022 11:05                9257
function.ftp-systype.php                           30-Sep-2022 11:05                5684
function.ftruncate.php                             30-Sep-2022 11:04                6473
function.func-get-arg.php                          30-Sep-2022 11:05               11958
function.func-get-args.php                         30-Sep-2022 11:05               12737
function.func-num-args.php                         30-Sep-2022 11:05                6051
function.function-exists.php                       30-Sep-2022 11:05                6248
function.fwrite.php                                30-Sep-2022 11:04               15852
function.gc-collect-cycles.php                     30-Sep-2022 11:04                2665
function.gc-disable.php                            30-Sep-2022 11:04                2591
function.gc-enable.php                             30-Sep-2022 11:04                2556
function.gc-enabled.php                            30-Sep-2022 11:04                3263
function.gc-mem-caches.php                         30-Sep-2022 11:04                2519
function.gc-status.php                             30-Sep-2022 11:04                6121
function.gd-info.php                               30-Sep-2022 11:04                8524
function.geoip-asnum-by-name.php                   30-Sep-2022 11:05                4185
function.geoip-continent-code-by-name.php          30-Sep-2022 11:05                5723
function.geoip-country-code-by-name.php            30-Sep-2022 11:05                5506
function.geoip-country-code3-by-name.php           30-Sep-2022 11:05                5028
function.geoip-country-name-by-name.php            30-Sep-2022 11:05                4991
function.geoip-database-info.php                   30-Sep-2022 11:05                4256
function.geoip-db-avail.php                        30-Sep-2022 11:05                4473
function.geoip-db-filename.php                     30-Sep-2022 11:05                4220
function.geoip-db-get-all-info.php                 30-Sep-2022 11:05                7102
function.geoip-domain-by-name.php                  30-Sep-2022 11:05                4454
function.geoip-id-by-name.php                      30-Sep-2022 11:05                5950
function.geoip-isp-by-name.php                     30-Sep-2022 11:05                4454
function.geoip-netspeedcell-by-name.php            30-Sep-2022 11:05                5319
function.geoip-org-by-name.php                     30-Sep-2022 11:05                4580
function.geoip-record-by-name.php                  30-Sep-2022 11:05                8087
function.geoip-region-by-name.php                  30-Sep-2022 11:05                5109
function.geoip-region-name-by-code.php             30-Sep-2022 11:05                7265
function.geoip-setup-custom-directory.php          30-Sep-2022 11:05                4241
function.geoip-time-zone-by-country-and-region.php 30-Sep-2022 11:05                7461
function.get-browser.php                           30-Sep-2022 11:05                8341
function.get-called-class.php                      30-Sep-2022 11:05                5076
function.get-cfg-var.php                           30-Sep-2022 11:04                3754
function.get-class-methods.php                     30-Sep-2022 11:05                7362
function.get-class-vars.php                        30-Sep-2022 11:05               10463
function.get-class.php                             30-Sep-2022 11:05               12873
function.get-current-user.php                      30-Sep-2022 11:04                4524
function.get-debug-type.php                        30-Sep-2022 11:05                9690
function.get-declared-classes.php                  30-Sep-2022 11:05                5324
function.get-declared-interfaces.php               30-Sep-2022 11:05                4340
function.get-declared-traits.php                   30-Sep-2022 11:05                2918
function.get-defined-constants.php                 30-Sep-2022 11:04                7478
function.get-defined-functions.php                 30-Sep-2022 11:05                6922
function.get-defined-vars.php                      30-Sep-2022 11:05                6613
function.get-extension-funcs.php                   30-Sep-2022 11:04                5433
function.get-headers.php                           30-Sep-2022 11:05                8957
function.get-html-translation-table.php            30-Sep-2022 11:05               13469
function.get-include-path.php                      30-Sep-2022 11:04                4509
function.get-included-files.php                    30-Sep-2022 11:04                6187
function.get-loaded-extensions.php                 30-Sep-2022 11:04                4971
function.get-magic-quotes-gpc.php                  30-Sep-2022 11:04                4185
function.get-magic-quotes-runtime.php              30-Sep-2022 11:04                4969
function.get-mangled-object-vars.php               30-Sep-2022 11:05                8347
function.get-meta-tags.php                         30-Sep-2022 11:05                8320
function.get-object-vars.php                       30-Sep-2022 11:05                6421
function.get-parent-class.php                      30-Sep-2022 11:05                7967
function.get-required-files.php                    30-Sep-2022 11:04                1822
function.get-resource-id.php                       30-Sep-2022 11:05                4657
function.get-resource-type.php                     30-Sep-2022 11:05                5373
function.get-resources.php                         30-Sep-2022 11:04                7795
function.getallheaders.php                         30-Sep-2022 11:05                4788
function.getcwd.php                                30-Sep-2022 11:04                5324
function.getdate.php                               30-Sep-2022 11:04                9428
function.getenv.php                                30-Sep-2022 11:04                8212
function.gethostbyaddr.php                         30-Sep-2022 11:05                4325
function.gethostbyname.php                         30-Sep-2022 11:05                4449
function.gethostbynamel.php                        30-Sep-2022 11:05                4884
function.gethostname.php                           30-Sep-2022 11:05                3923
function.getimagesize.php                          30-Sep-2022 11:04               17259
function.getimagesizefromstring.php                30-Sep-2022 11:04                5693
function.getlastmod.php                            30-Sep-2022 11:04                5412
function.getmxrr.php                               30-Sep-2022 11:05                5722
function.getmygid.php                              30-Sep-2022 11:04                3428
function.getmyinode.php                            30-Sep-2022 11:04                3519
function.getmypid.php                              30-Sep-2022 11:04                3845
function.getmyuid.php                              30-Sep-2022 11:04                3434
function.getopt.php                                30-Sep-2022 11:04               15790
function.getprotobyname.php                        30-Sep-2022 11:05                4702
function.getprotobynumber.php                      30-Sep-2022 11:05                3284
function.getrandmax.php                            30-Sep-2022 11:05                3030
function.getrusage.php                             30-Sep-2022 11:04               12436
function.getservbyname.php                         30-Sep-2022 11:05                6554
function.getservbyport.php                         30-Sep-2022 11:05                3717
function.gettext.php                               30-Sep-2022 11:04                6073
function.gettimeofday.php                          30-Sep-2022 11:04                4742
function.gettype.php                               30-Sep-2022 11:05                9653
function.glob.php                                  30-Sep-2022 11:04                9830
function.gmdate.php                                30-Sep-2022 11:04                7749
function.gmmktime.php                              30-Sep-2022 11:04               10760
function.gmp-abs.php                               30-Sep-2022 11:05                4430
function.gmp-add.php                               30-Sep-2022 11:05                4686
function.gmp-and.php                               30-Sep-2022 11:05                5152
function.gmp-binomial.php                          30-Sep-2022 11:05                3795
function.gmp-clrbit.php                            30-Sep-2022 11:05                5694
function.gmp-cmp.php                               30-Sep-2022 11:05                5563
function.gmp-com.php                               30-Sep-2022 11:05                3909
function.gmp-div-q.php                             30-Sep-2022 11:05                9937
function.gmp-div-qr.php                            30-Sep-2022 11:05                6511
function.gmp-div-r.php                             30-Sep-2022 11:05                5976
function.gmp-div.php                               30-Sep-2022 11:05                1649
function.gmp-divexact.php                          30-Sep-2022 11:05                5770
function.gmp-export.php                            30-Sep-2022 11:05                5354
function.gmp-fact.php                              30-Sep-2022 11:05                4879
function.gmp-gcd.php                               30-Sep-2022 11:05                5158
function.gmp-gcdext.php                            30-Sep-2022 11:05                9693
function.gmp-hamdist.php                           30-Sep-2022 11:05                6433
function.gmp-import.php                            30-Sep-2022 11:05                5792
function.gmp-init.php                              30-Sep-2022 11:05                5443
function.gmp-intval.php                            30-Sep-2022 11:05                5317
function.gmp-invert.php                            30-Sep-2022 11:05                5247
function.gmp-jacobi.php                            30-Sep-2022 11:05                5535
function.gmp-kronecker.php                         30-Sep-2022 11:05                3844
function.gmp-lcm.php                               30-Sep-2022 11:05                3653
function.gmp-legendre.php                          30-Sep-2022 11:05                5548
function.gmp-mod.php                               30-Sep-2022 11:05                4773
function.gmp-mul.php                               30-Sep-2022 11:05                4868
function.gmp-neg.php                               30-Sep-2022 11:05                4458
function.gmp-nextprime.php                         30-Sep-2022 11:05                5193
function.gmp-or.php                                30-Sep-2022 11:05                5413
function.gmp-perfect-power.php                     30-Sep-2022 11:05                3184
function.gmp-perfect-square.php                    30-Sep-2022 11:05                5531
function.gmp-popcount.php                          30-Sep-2022 11:05                4842
function.gmp-pow.php                               30-Sep-2022 11:05                5805
function.gmp-powm.php                              30-Sep-2022 11:05                5664
function.gmp-prob-prime.php                        30-Sep-2022 11:05                5874
function.gmp-random-bits.php                       30-Sep-2022 11:05                4646
function.gmp-random-range.php                      30-Sep-2022 11:05                5579
function.gmp-random-seed.php                       30-Sep-2022 11:05                6945
function.gmp-random.php                            30-Sep-2022 11:05                5493
function.gmp-root.php                              30-Sep-2022 11:05                3124
function.gmp-rootrem.php                           30-Sep-2022 11:05                3223
function.gmp-scan0.php                             30-Sep-2022 11:05                5631
function.gmp-scan1.php                             30-Sep-2022 11:05                5642
function.gmp-setbit.php                            30-Sep-2022 11:05               12171
function.gmp-sign.php                              30-Sep-2022 11:05                5071
function.gmp-sqrt.php                              30-Sep-2022 11:05                4997
function.gmp-sqrtrem.php                           30-Sep-2022 11:05                6499
function.gmp-strval.php                            30-Sep-2022 11:05                4671
function.gmp-sub.php                               30-Sep-2022 11:05                4961
function.gmp-testbit.php                           30-Sep-2022 11:05                5775
function.gmp-xor.php                               30-Sep-2022 11:05                5422
function.gmstrftime.php                            30-Sep-2022 11:04                8568
function.gnupg-adddecryptkey.php                   30-Sep-2022 11:05                5215
function.gnupg-addencryptkey.php                   30-Sep-2022 11:05                4768
function.gnupg-addsignkey.php                      30-Sep-2022 11:05                5227
function.gnupg-cleardecryptkeys.php                30-Sep-2022 11:05                4377
function.gnupg-clearencryptkeys.php                30-Sep-2022 11:05                4380
function.gnupg-clearsignkeys.php                   30-Sep-2022 11:05                4321
function.gnupg-decrypt.php                         30-Sep-2022 11:05                5939
function.gnupg-decryptverify.php                   30-Sep-2022 11:05                7069
function.gnupg-deletekey.php                       30-Sep-2022 11:05                4952
function.gnupg-encrypt.php                         30-Sep-2022 11:05                5868
function.gnupg-encryptsign.php                     30-Sep-2022 11:05                6763
function.gnupg-export.php                          30-Sep-2022 11:05                5048
function.gnupg-getengineinfo.php                   30-Sep-2022 11:05                5515
function.gnupg-geterror.php                        30-Sep-2022 11:05                4238
function.gnupg-geterrorinfo.php                    30-Sep-2022 11:05                5658
function.gnupg-getprotocol.php                     30-Sep-2022 11:05                4343
function.gnupg-gettrustlist.php                    30-Sep-2022 11:05                5032
function.gnupg-import.php                          30-Sep-2022 11:05                5328
function.gnupg-init.php                            30-Sep-2022 11:05                7337
function.gnupg-keyinfo.php                         30-Sep-2022 11:05                5258
function.gnupg-listsignatures.php                  30-Sep-2022 11:05                5261
function.gnupg-setarmor.php                        30-Sep-2022 11:05                5691
function.gnupg-seterrormode.php                    30-Sep-2022 11:05                5564
function.gnupg-setsignmode.php                     30-Sep-2022 11:05                5468
function.gnupg-sign.php                            30-Sep-2022 11:05                6121
function.gnupg-verify.php                          30-Sep-2022 11:05                8314
function.grapheme-extract.php                      30-Sep-2022 11:04                8806
function.grapheme-stripos.php                      30-Sep-2022 11:04                8341
function.grapheme-stristr.php                      30-Sep-2022 11:04                7890
function.grapheme-strlen.php                       30-Sep-2022 11:04                5643
function.grapheme-strpos.php                       30-Sep-2022 11:04                7908
function.grapheme-strripos.php                     30-Sep-2022 11:04                7750
function.grapheme-strrpos.php                      30-Sep-2022 11:04                7365
function.grapheme-strstr.php                       30-Sep-2022 11:04                7466
function.grapheme-substr.php                       30-Sep-2022 11:04                7397
function.gregoriantojd.php                         30-Sep-2022 11:04                8002
function.gzclose.php                               30-Sep-2022 11:04                4320
function.gzcompress.php                            30-Sep-2022 11:04                6004
function.gzdecode.php                              30-Sep-2022 11:04                3687
function.gzdeflate.php                             30-Sep-2022 11:04                5564
function.gzencode.php                              30-Sep-2022 11:04                6860
function.gzeof.php                                 30-Sep-2022 11:04                4161
function.gzfile.php                                30-Sep-2022 11:04                4832
function.gzgetc.php                                30-Sep-2022 11:04                4807
function.gzgets.php                                30-Sep-2022 11:04                6372
function.gzgetss.php                               30-Sep-2022 11:04                6269
function.gzinflate.php                             30-Sep-2022 11:04                5513
function.gzopen.php                                30-Sep-2022 11:04                5712
function.gzpassthru.php                            30-Sep-2022 11:04                4921
function.gzputs.php                                30-Sep-2022 11:04                1615
function.gzread.php                                30-Sep-2022 11:04                6850
function.gzrewind.php                              30-Sep-2022 11:04                3227
function.gzseek.php                                30-Sep-2022 11:04                6328
function.gztell.php                                30-Sep-2022 11:04                3447
function.gzuncompress.php                          30-Sep-2022 11:04                5456
function.gzwrite.php                               30-Sep-2022 11:04                6526
function.halt-compiler.php                         30-Sep-2022 11:05                4977
function.hash-algos.php                            30-Sep-2022 11:04                5750
function.hash-copy.php                             30-Sep-2022 11:04                5572
function.hash-equals.php                           30-Sep-2022 11:04                6644
function.hash-file.php                             30-Sep-2022 11:04                7709
function.hash-final.php                            30-Sep-2022 11:04                6429
function.hash-hkdf.php                             30-Sep-2022 11:04                9506
function.hash-hmac-algos.php                       30-Sep-2022 11:04                5374
function.hash-hmac-file.php                        30-Sep-2022 11:04                7843
function.hash-hmac.php                             30-Sep-2022 11:04                7530
function.hash-init.php                             30-Sep-2022 11:04                8753
function.hash-pbkdf2.php                           30-Sep-2022 11:04               12873
function.hash-update-file.php                      30-Sep-2022 11:04                5885
function.hash-update-stream.php                    30-Sep-2022 11:04                7325
function.hash-update.php                           30-Sep-2022 11:04                4435
function.hash.php                                  30-Sep-2022 11:04                7317
function.header-register-callback.php              30-Sep-2022 11:05                7085
function.header-remove.php                         30-Sep-2022 11:05                6939
function.header.php                                30-Sep-2022 11:05               19454
function.headers-list.php                          30-Sep-2022 11:05                6393
function.headers-sent.php                          30-Sep-2022 11:05                8251
function.hebrev.php                                30-Sep-2022 11:05                3305
function.hebrevc.php                               30-Sep-2022 11:05                3879
function.hex2bin.php                               30-Sep-2022 11:05                5019
function.hexdec.php                                30-Sep-2022 11:05                6658
function.highlight-file.php                        30-Sep-2022 11:05                5514
function.highlight-string.php                      30-Sep-2022 11:05                5880
function.hrtime.php                                30-Sep-2022 11:05                4718
function.html-entity-decode.php                    30-Sep-2022 11:05               14600
function.htmlentities.php                          30-Sep-2022 11:05               17300
function.htmlspecialchars-decode.php               30-Sep-2022 11:05                8926
function.htmlspecialchars.php                      30-Sep-2022 11:05               20745
function.http-build-query.php                      30-Sep-2022 11:05               20632
function.http-response-code.php                    30-Sep-2022 11:05                7097
function.hypot.php                                 30-Sep-2022 11:05                2935
function.ibase-add-user.php                        30-Sep-2022 11:04                4945
function.ibase-affected-rows.php                   30-Sep-2022 11:04                3526
function.ibase-backup.php                          30-Sep-2022 11:04               10603
function.ibase-blob-add.php                        30-Sep-2022 11:04                4110
function.ibase-blob-cancel.php                     30-Sep-2022 11:04                3861
function.ibase-blob-close.php                      30-Sep-2022 11:04                4153
function.ibase-blob-create.php                     30-Sep-2022 11:04                4063
function.ibase-blob-echo.php                       30-Sep-2022 11:04                4111
function.ibase-blob-get.php                        30-Sep-2022 11:04                6792
function.ibase-blob-import.php                     30-Sep-2022 11:04                8707
function.ibase-blob-info.php                       30-Sep-2022 11:04                3369
function.ibase-blob-open.php                       30-Sep-2022 11:04                4227
function.ibase-close.php                           30-Sep-2022 11:04                3735
function.ibase-commit-ret.php                      30-Sep-2022 11:04                3133
function.ibase-commit.php                          30-Sep-2022 11:04                3069
function.ibase-connect.php                         30-Sep-2022 11:04               10576
function.ibase-db-info.php                         30-Sep-2022 11:04                2437
function.ibase-delete-user.php                     30-Sep-2022 11:04                3497
function.ibase-drop-db.php                         30-Sep-2022 11:04                3623
function.ibase-errcode.php                         30-Sep-2022 11:04                2694
function.ibase-errmsg.php                          30-Sep-2022 11:04                2669
function.ibase-execute.php                         30-Sep-2022 11:04                7148
function.ibase-fetch-assoc.php                     30-Sep-2022 11:04                4565
function.ibase-fetch-object.php                    30-Sep-2022 11:04                6669
function.ibase-fetch-row.php                       30-Sep-2022 11:04                4387
function.ibase-field-info.php                      30-Sep-2022 11:04                7208
function.ibase-free-event-handler.php              30-Sep-2022 11:04                3464
function.ibase-free-query.php                      30-Sep-2022 11:04                2688
function.ibase-free-result.php                     30-Sep-2022 11:04                2763
function.ibase-gen-id.php                          30-Sep-2022 11:04                2819
function.ibase-maintain-db.php                     30-Sep-2022 11:04                2789
function.ibase-modify-user.php                     30-Sep-2022 11:04                4925
function.ibase-name-result.php                     30-Sep-2022 11:04                5824
function.ibase-num-fields.php                      30-Sep-2022 11:04                6786
function.ibase-num-params.php                      30-Sep-2022 11:04                3595
function.ibase-param-info.php                      30-Sep-2022 11:04                3680
function.ibase-pconnect.php                        30-Sep-2022 11:04                7702
function.ibase-prepare.php                         30-Sep-2022 11:04                4145
function.ibase-query.php                           30-Sep-2022 11:04                7428
function.ibase-restore.php                         30-Sep-2022 11:04               10637
function.ibase-rollback-ret.php                    30-Sep-2022 11:04                3229
function.ibase-rollback.php                        30-Sep-2022 11:04                3057
function.ibase-server-info.php                     30-Sep-2022 11:04               10921
function.ibase-service-attach.php                  30-Sep-2022 11:04               12977
function.ibase-service-detach.php                  30-Sep-2022 11:04                7108
function.ibase-set-event-handler.php               30-Sep-2022 11:04                8187
function.ibase-trans.php                           30-Sep-2022 11:04                5771
function.ibase-wait-event.php                      30-Sep-2022 11:04                4099
function.iconv-get-encoding.php                    30-Sep-2022 11:04                5720
function.iconv-mime-decode-headers.php             30-Sep-2022 11:04               10692
function.iconv-mime-decode.php                     30-Sep-2022 11:04                8346
function.iconv-mime-encode.php                     30-Sep-2022 11:04               12082
function.iconv-set-encoding.php                    30-Sep-2022 11:04                4848
function.iconv-strlen.php                          30-Sep-2022 11:04                4968
function.iconv-strpos.php                          30-Sep-2022 11:04                7434
function.iconv-strrpos.php                         30-Sep-2022 11:04                6715
function.iconv-substr.php                          30-Sep-2022 11:04                8370
function.iconv.php                                 30-Sep-2022 11:04                9037
function.idate.php                                 30-Sep-2022 11:04               11446
function.idn-to-ascii.php                          30-Sep-2022 11:04                7052
function.idn-to-utf8.php                           30-Sep-2022 11:04                7063
function.igbinary-serialize.php                    30-Sep-2022 11:05               10449
function.igbinary-unserialize.php                  30-Sep-2022 11:05               10319
function.ignore-user-abort.php                     30-Sep-2022 11:05                8337
function.image-type-to-extension.php               30-Sep-2022 11:04                5383
function.image-type-to-mime-type.php               30-Sep-2022 11:04                7749
function.image2wbmp.php                            30-Sep-2022 11:04                6477
function.imageaffine.php                           30-Sep-2022 11:04                4604
function.imageaffinematrixconcat.php               30-Sep-2022 11:04                6640
function.imageaffinematrixget.php                  30-Sep-2022 11:04                6090
function.imagealphablending.php                    30-Sep-2022 11:04                7484
function.imageantialias.php                        30-Sep-2022 11:04               11272
function.imagearc.php                              30-Sep-2022 11:04               13953
function.imageavif.php                             30-Sep-2022 11:04                5940
function.imagebmp.php                              30-Sep-2022 11:04                7858
function.imagechar.php                             30-Sep-2022 11:04               10002
function.imagecharup.php                           30-Sep-2022 11:04                9829
function.imagecolorallocate.php                    30-Sep-2022 11:04                9959
function.imagecolorallocatealpha.php               30-Sep-2022 11:04               18627
function.imagecolorat.php                          30-Sep-2022 11:04               10241
function.imagecolorclosest.php                     30-Sep-2022 11:04               12669
function.imagecolorclosestalpha.php                30-Sep-2022 11:04               13315
function.imagecolorclosesthwb.php                  30-Sep-2022 11:04                6368
function.imagecolordeallocate.php                  30-Sep-2022 11:04                5777
function.imagecolorexact.php                       30-Sep-2022 11:04                8566
function.imagecolorexactalpha.php                  30-Sep-2022 11:04                9436
function.imagecolormatch.php                       30-Sep-2022 11:04                8736
function.imagecolorresolve.php                     30-Sep-2022 11:04                7772
function.imagecolorresolvealpha.php                30-Sep-2022 11:04                8503
function.imagecolorset.php                         30-Sep-2022 11:04                8705
function.imagecolorsforindex.php                   30-Sep-2022 11:04                7628
function.imagecolorstotal.php                      30-Sep-2022 11:04                6056
function.imagecolortransparent.php                 30-Sep-2022 11:04                9319
function.imageconvolution.php                      30-Sep-2022 11:04               12257
function.imagecopy.php                             30-Sep-2022 11:04                9251
function.imagecopymerge.php                        30-Sep-2022 11:04                9645
function.imagecopymergegray.php                    30-Sep-2022 11:04               10266
function.imagecopyresampled.php                    30-Sep-2022 11:04               19672
function.imagecopyresized.php                      30-Sep-2022 11:04               14334
function.imagecreate.php                           30-Sep-2022 11:04                8505
function.imagecreatefromavif.php                   30-Sep-2022 11:04                2800
function.imagecreatefrombmp.php                    30-Sep-2022 11:04                5731
function.imagecreatefromgd.php                     30-Sep-2022 11:04                6475
function.imagecreatefromgd2.php                    30-Sep-2022 11:04                6713
function.imagecreatefromgd2part.php                30-Sep-2022 11:04                9255
function.imagecreatefromgif.php                    30-Sep-2022 11:04               10695
function.imagecreatefromjpeg.php                   30-Sep-2022 11:04               10262
function.imagecreatefrompng.php                    30-Sep-2022 11:04               10205
function.imagecreatefromstring.php                 30-Sep-2022 11:04                8483
function.imagecreatefromtga.php                    30-Sep-2022 11:04                3431
function.imagecreatefromwbmp.php                   30-Sep-2022 11:04               10218
function.imagecreatefromwebp.php                   30-Sep-2022 11:04                5927
function.imagecreatefromxbm.php                    30-Sep-2022 11:04                5753
function.imagecreatefromxpm.php                    30-Sep-2022 11:04                6686
function.imagecreatetruecolor.php                  30-Sep-2022 11:04                7276
function.imagecrop.php                             30-Sep-2022 11:04                7568
function.imagecropauto.php                         30-Sep-2022 11:04               11102
function.imagedashedline.php                       30-Sep-2022 11:04               13737
function.imagedestroy.php                          30-Sep-2022 11:04                5169
function.imageellipse.php                          30-Sep-2022 11:04               10100
function.imagefill.php                             30-Sep-2022 11:04                7615
function.imagefilledarc.php                        30-Sep-2022 11:04               18733
function.imagefilledellipse.php                    30-Sep-2022 11:04                9697
function.imagefilledpolygon.php                    30-Sep-2022 11:04               12718
function.imagefilledrectangle.php                  30-Sep-2022 11:04                8304
function.imagefilltoborder.php                     30-Sep-2022 11:04               11680
function.imagefilter.php                           30-Sep-2022 11:04               33836
function.imageflip.php                             30-Sep-2022 11:04                9622
function.imagefontheight.php                       30-Sep-2022 11:04                6629
function.imagefontwidth.php                        30-Sep-2022 11:04                6608
function.imageftbbox.php                           30-Sep-2022 11:04               14738
function.imagefttext.php                           30-Sep-2022 11:04               16336
function.imagegammacorrect.php                     30-Sep-2022 11:04                5865
function.imagegd.php                               30-Sep-2022 11:04               11092
function.imagegd2.php                              30-Sep-2022 11:04               11670
function.imagegetclip.php                          30-Sep-2022 11:04                6106
function.imagegetinterpolation.php                 30-Sep-2022 11:04                3671
function.imagegif.php                              30-Sep-2022 11:04               17754
function.imagegrabscreen.php                       30-Sep-2022 11:04                4870
function.imagegrabwindow.php                       30-Sep-2022 11:04                9970
function.imageinterlace.php                        30-Sep-2022 11:04                6695
function.imageistruecolor.php                      30-Sep-2022 11:04                7688
function.imagejpeg.php                             30-Sep-2022 11:04               15711
function.imagelayereffect.php                      30-Sep-2022 11:04               11726
function.imageline.php                             30-Sep-2022 11:04               16414
function.imageloadfont.php                         30-Sep-2022 11:04                9696
function.imageopenpolygon.php                      30-Sep-2022 11:04               10499
function.imagepalettecopy.php                      30-Sep-2022 11:04                7871
function.imagepalettetotruecolor.php               30-Sep-2022 11:04               10480
function.imagepng.php                              30-Sep-2022 11:04                8800
function.imagepolygon.php                          30-Sep-2022 11:04               10844
function.imagerectangle.php                        30-Sep-2022 11:04               10612
function.imageresolution.php                       30-Sep-2022 11:04                7523
function.imagerotate.php                           30-Sep-2022 11:04                9660
function.imagesavealpha.php                        30-Sep-2022 11:04                6886
function.imagescale.php                            30-Sep-2022 11:04                6496
function.imagesetbrush.php                         30-Sep-2022 11:04                9425
function.imagesetclip.php                          30-Sep-2022 11:04                4969
function.imagesetinterpolation.php                 30-Sep-2022 11:04               10505
function.imagesetpixel.php                         30-Sep-2022 11:04               11668
function.imagesetstyle.php                         30-Sep-2022 11:04               12683
function.imagesetthickness.php                     30-Sep-2022 11:04                8684
function.imagesettile.php                          30-Sep-2022 11:04                8953
function.imagestring.php                           30-Sep-2022 11:04               10220
function.imagestringup.php                         30-Sep-2022 11:04                9414
function.imagesx.php                               30-Sep-2022 11:04                5224
function.imagesy.php                               30-Sep-2022 11:04                5227
function.imagetruecolortopalette.php               30-Sep-2022 11:04                6773
function.imagettfbbox.php                          30-Sep-2022 11:04               20713
function.imagettftext.php                          30-Sep-2022 11:04               19142
function.imagetypes.php                            30-Sep-2022 11:04                4756
function.imagewbmp.php                             30-Sep-2022 11:04               15718
function.imagewebp.php                             30-Sep-2022 11:04                7340
function.imagexbm.php                              30-Sep-2022 11:04               12254
function.imap-8bit.php                             30-Sep-2022 11:05                3061
function.imap-alerts.php                           30-Sep-2022 11:05                3176
function.imap-append.php                           30-Sep-2022 11:05               10166
function.imap-base64.php                           30-Sep-2022 11:05                3515
function.imap-binary.php                           30-Sep-2022 11:05                3030
function.imap-body.php                             30-Sep-2022 11:05                5347
function.imap-bodystruct.php                       30-Sep-2022 11:05                4550
function.imap-check.php                            30-Sep-2022 11:05                6104
function.imap-clearflag-full.php                   30-Sep-2022 11:05                5700
function.imap-close.php                            30-Sep-2022 11:05                4223
function.imap-create.php                           30-Sep-2022 11:05                1720
function.imap-createmailbox.php                    30-Sep-2022 11:05               16146
function.imap-delete.php                           30-Sep-2022 11:05                9981
function.imap-deletemailbox.php                    30-Sep-2022 11:05                4928
function.imap-errors.php                           30-Sep-2022 11:05                3425
function.imap-expunge.php                          30-Sep-2022 11:05                3507
function.imap-fetch-overview.php                   30-Sep-2022 11:05               11441
function.imap-fetchbody.php                        30-Sep-2022 11:05                6121
function.imap-fetchheader.php                      30-Sep-2022 11:05                5613
function.imap-fetchmime.php                        30-Sep-2022 11:05                6225
function.imap-fetchstructure.php                   30-Sep-2022 11:05                9304
function.imap-fetchtext.php                        30-Sep-2022 11:05                1701
function.imap-gc.php                               30-Sep-2022 11:05                4857
function.imap-get-quota.php                        30-Sep-2022 11:05               13199
function.imap-get-quotaroot.php                    30-Sep-2022 11:05                9638
function.imap-getacl.php                           30-Sep-2022 11:05                5937
function.imap-getmailboxes.php                     30-Sep-2022 11:05               12577
function.imap-getsubscribed.php                    30-Sep-2022 11:05                7751
function.imap-header.php                           30-Sep-2022 11:05                1940
function.imap-headerinfo.php                       30-Sep-2022 11:05               13889
function.imap-headers.php                          30-Sep-2022 11:05                3423
function.imap-last-error.php                       30-Sep-2022 11:05                3132
function.imap-list.php                             30-Sep-2022 11:05                9039
function.imap-listmailbox.php                      30-Sep-2022 11:05                1706
function.imap-listscan.php                         30-Sep-2022 11:05                6916
function.imap-listsubscribed.php                   30-Sep-2022 11:05                1727
function.imap-lsub.php                             30-Sep-2022 11:05                6064
function.imap-mail-compose.php                     30-Sep-2022 11:05               15053
function.imap-mail-copy.php                        30-Sep-2022 11:05                6140
function.imap-mail-move.php                        30-Sep-2022 11:05                6680
function.imap-mail.php                             30-Sep-2022 11:05                6785
function.imap-mailboxmsginfo.php                   30-Sep-2022 11:05               10486
function.imap-mime-header-decode.php               30-Sep-2022 11:05                6439
function.imap-msgno.php                            30-Sep-2022 11:05                4072
function.imap-mutf7-to-utf8.php                    30-Sep-2022 11:05                3365
function.imap-num-msg.php                          30-Sep-2022 11:05                4106
function.imap-num-recent.php                       30-Sep-2022 11:05                3973
function.imap-open.php                             30-Sep-2022 11:05               23197
function.imap-ping.php                             30-Sep-2022 11:05                4943
function.imap-qprint.php                           30-Sep-2022 11:05                3153
function.imap-rename.php                           30-Sep-2022 11:05                1723
function.imap-renamemailbox.php                    30-Sep-2022 11:05                5766
function.imap-reopen.php                           30-Sep-2022 11:05                8504
function.imap-rfc822-parse-adrlist.php             30-Sep-2022 11:05                8515
function.imap-rfc822-parse-headers.php             30-Sep-2022 11:05                3704
function.imap-rfc822-write-address.php             30-Sep-2022 11:05                5157
function.imap-savebody.php                         30-Sep-2022 11:05                6396
function.imap-scan.php                             30-Sep-2022 11:05                1688
function.imap-scanmailbox.php                      30-Sep-2022 11:05                1718
function.imap-search.php                           30-Sep-2022 11:05               13710
function.imap-set-quota.php                        30-Sep-2022 11:05                7033
function.imap-setacl.php                           30-Sep-2022 11:05                5480
function.imap-setflag-full.php                     30-Sep-2022 11:05                7988
function.imap-sort.php                             30-Sep-2022 11:05                7840
function.imap-status.php                           30-Sep-2022 11:05               11149
function.imap-subscribe.php                        30-Sep-2022 11:05                4423
function.imap-thread.php                           30-Sep-2022 11:05                8075
function.imap-timeout.php                          30-Sep-2022 11:05                4327
function.imap-uid.php                              30-Sep-2022 11:05                4589
function.imap-undelete.php                         30-Sep-2022 11:05                5001
function.imap-unsubscribe.php                      30-Sep-2022 11:05                4511
function.imap-utf7-decode.php                      30-Sep-2022 11:05                3751
function.imap-utf7-encode.php                      30-Sep-2022 11:05                3321
function.imap-utf8-to-mutf7.php                    30-Sep-2022 11:05                3375
function.imap-utf8.php                             30-Sep-2022 11:05                4290
function.implode.php                               30-Sep-2022 11:05                7792
function.in-array.php                              30-Sep-2022 11:05               12208
function.include-once.php                          30-Sep-2022 11:04                2241
function.include.php                               30-Sep-2022 11:04               22073
function.inet-ntop.php                             30-Sep-2022 11:05                6443
function.inet-pton.php                             30-Sep-2022 11:05                4818
function.inflate-add.php                           30-Sep-2022 11:04                5393
function.inflate-get-read-len.php                  30-Sep-2022 11:04                3290
function.inflate-get-status.php                    30-Sep-2022 11:04                3172
function.inflate-init.php                          30-Sep-2022 11:04                6444
function.ini-alter.php                             30-Sep-2022 11:04                1680
function.ini-get-all.php                           30-Sep-2022 11:04               10147
function.ini-get.php                               30-Sep-2022 11:04               11465
function.ini-restore.php                           30-Sep-2022 11:04                6633
function.ini-set.php                               30-Sep-2022 11:04                6634
function.inotify-add-watch.php                     30-Sep-2022 11:04                4072
function.inotify-init.php                          30-Sep-2022 11:04                9498
function.inotify-queue-len.php                     30-Sep-2022 11:04                3657
function.inotify-read.php                          30-Sep-2022 11:04                4405
function.inotify-rm-watch.php                      30-Sep-2022 11:04                3457
function.intdiv.php                                30-Sep-2022 11:05                7322
function.interface-exists.php                      30-Sep-2022 11:05                5416
function.intl-error-name.php                       30-Sep-2022 11:04                5135
function.intl-get-error-code.php                   30-Sep-2022 11:04                4757
function.intl-get-error-message.php                30-Sep-2022 11:04                4715
function.intl-is-failure.php                       30-Sep-2022 11:04                5593
function.intval.php                                30-Sep-2022 11:05               14460
function.ip2long.php                               30-Sep-2022 11:05                9829
function.iptcembed.php                             30-Sep-2022 11:04               13062
function.iptcparse.php                             30-Sep-2022 11:04                4651
function.is-a.php                                  30-Sep-2022 11:05                6927
function.is-array.php                              30-Sep-2022 11:05                5956
function.is-bool.php                               30-Sep-2022 11:05                5876
function.is-callable.php                           30-Sep-2022 11:05               11434
function.is-countable.php                          30-Sep-2022 11:05                6370
function.is-dir.php                                30-Sep-2022 11:04                6629
function.is-double.php                             30-Sep-2022 11:05                1666
function.is-executable.php                         30-Sep-2022 11:04                6574
function.is-file.php                               30-Sep-2022 11:04                6028
function.is-finite.php                             30-Sep-2022 11:05                3105
function.is-float.php                              30-Sep-2022 11:05                6697
function.is-infinite.php                           30-Sep-2022 11:05                3196
function.is-int.php                                30-Sep-2022 11:05                6865
function.is-integer.php                            30-Sep-2022 11:05                1659
function.is-iterable.php                           30-Sep-2022 11:05                5859
function.is-link.php                               30-Sep-2022 11:04                5671
function.is-long.php                               30-Sep-2022 11:05                1640
function.is-nan.php                                30-Sep-2022 11:05                4553
function.is-null.php                               30-Sep-2022 11:05                6005
function.is-numeric.php                            30-Sep-2022 11:05               13155
function.is-object.php                             30-Sep-2022 11:05                7386
function.is-readable.php                           30-Sep-2022 11:04                6535
function.is-real.php                               30-Sep-2022 11:05                1877
function.is-resource.php                           30-Sep-2022 11:05                5147
function.is-scalar.php                             30-Sep-2022 11:05                8220
function.is-soap-fault.php                         30-Sep-2022 11:05                8362
function.is-string.php                             30-Sep-2022 11:05                6904
function.is-subclass-of.php                        30-Sep-2022 11:05               13852
function.is-tainted.php                            30-Sep-2022 11:05                2304
function.is-uploaded-file.php                      30-Sep-2022 11:04                6973
function.is-writable.php                           30-Sep-2022 11:04                6232
function.is-writeable.php                          30-Sep-2022 11:04                1725
function.isset.php                                 30-Sep-2022 11:05               16995
function.iterator-apply.php                        30-Sep-2022 11:05                6785
function.iterator-count.php                        30-Sep-2022 11:05                8028
function.iterator-to-array.php                     30-Sep-2022 11:05                6542
function.jddayofweek.php                           30-Sep-2022 11:04                3827
function.jdmonthname.php                           30-Sep-2022 11:04                4413
function.jdtofrench.php                            30-Sep-2022 11:04                3325
function.jdtogregorian.php                         30-Sep-2022 11:04                3342
function.jdtojewish.php                            30-Sep-2022 11:04                7487
function.jdtojulian.php                            30-Sep-2022 11:04                3300
function.jdtounix.php                              30-Sep-2022 11:04                4467
function.jewishtojd.php                            30-Sep-2022 11:04                4693
function.join.php                                  30-Sep-2022 11:05                1646
function.jpeg2wbmp.php                             30-Sep-2022 11:04                6454
function.json-decode.php                           30-Sep-2022 11:05               24134
function.json-encode.php                           30-Sep-2022 11:05               31160
function.json-last-error-msg.php                   30-Sep-2022 11:05                3282
function.json-last-error.php                       30-Sep-2022 11:05               15129
function.juliantojd.php                            30-Sep-2022 11:04                4660
function.key-exists.php                            30-Sep-2022 11:05                1697
function.key.php                                   30-Sep-2022 11:05                7668
function.krsort.php                                30-Sep-2022 11:05                7835
function.ksort.php                                 30-Sep-2022 11:05                9783
function.lcfirst.php                               30-Sep-2022 11:05                5650
function.lcg-value.php                             30-Sep-2022 11:05                3856
function.lchgrp.php                                30-Sep-2022 11:04                5966
function.lchown.php                                30-Sep-2022 11:04                5808
function.ldap-8859-to-t61.php                      30-Sep-2022 11:05                3215
function.ldap-add-ext.php                          30-Sep-2022 11:05                5568
function.ldap-add.php                              30-Sep-2022 11:05               10726
function.ldap-bind-ext.php                         30-Sep-2022 11:05                5556
function.ldap-bind.php                             30-Sep-2022 11:05               10218
function.ldap-close.php                            30-Sep-2022 11:05                1667
function.ldap-compare.php                          30-Sep-2022 11:05               11183
function.ldap-connect.php                          30-Sep-2022 11:05                9924
function.ldap-control-paged-result-response.php    30-Sep-2022 11:05                5756
function.ldap-control-paged-result.php             30-Sep-2022 11:05               16101
function.ldap-count-entries.php                    30-Sep-2022 11:05                5861
function.ldap-count-references.php                 30-Sep-2022 11:05                4677
function.ldap-delete-ext.php                       30-Sep-2022 11:05                5143
function.ldap-delete.php                           30-Sep-2022 11:05                5077
function.ldap-dn2ufn.php                           30-Sep-2022 11:05                2556
function.ldap-err2str.php                          30-Sep-2022 11:05                4911
function.ldap-errno.php                            30-Sep-2022 11:05                8064
function.ldap-error.php                            30-Sep-2022 11:05                4543
function.ldap-escape.php                           30-Sep-2022 11:05                6538
function.ldap-exop-passwd.php                      30-Sep-2022 11:05               10714
function.ldap-exop-refresh.php                     30-Sep-2022 11:05                4918
function.ldap-exop-whoami.php                      30-Sep-2022 11:05                3802
function.ldap-exop.php                             30-Sep-2022 11:05               12514
function.ldap-explode-dn.php                       30-Sep-2022 11:05                3496
function.ldap-first-attribute.php                  30-Sep-2022 11:05                6152
function.ldap-first-entry.php                      30-Sep-2022 11:05                5817
function.ldap-first-reference.php                  30-Sep-2022 11:05                2387
function.ldap-free-result.php                      30-Sep-2022 11:05                4096
function.ldap-get-attributes.php                   30-Sep-2022 11:05                8472
function.ldap-get-dn.php                           30-Sep-2022 11:05                4202
function.ldap-get-entries.php                      30-Sep-2022 11:05                6114
function.ldap-get-option.php                       30-Sep-2022 11:05               12883
function.ldap-get-values-len.php                   30-Sep-2022 11:05                5531
function.ldap-get-values.php                       30-Sep-2022 11:05                9087
function.ldap-list.php                             30-Sep-2022 11:05               15325
function.ldap-mod-add.php                          30-Sep-2022 11:05                6695
function.ldap-mod-del.php                          30-Sep-2022 11:05                6122
function.ldap-mod-replace.php                      30-Sep-2022 11:05                6619
function.ldap-mod_add-ext.php                      30-Sep-2022 11:05                5515
function.ldap-mod_del-ext.php                      30-Sep-2022 11:05                5526
function.ldap-mod_replace-ext.php                  30-Sep-2022 11:05                5595
function.ldap-modify-batch.php                     30-Sep-2022 11:05               21127
function.ldap-modify.php                           30-Sep-2022 11:05                2096
function.ldap-next-attribute.php                   30-Sep-2022 11:05                5514
function.ldap-next-entry.php                       30-Sep-2022 11:05                5871
function.ldap-next-reference.php                   30-Sep-2022 11:05                2355
function.ldap-parse-exop.php                       30-Sep-2022 11:05                5613
function.ldap-parse-reference.php                  30-Sep-2022 11:05                2376
function.ldap-parse-result.php                     30-Sep-2022 11:05                9454
function.ldap-read.php                             30-Sep-2022 11:05               12514
function.ldap-rename-ext.php                       30-Sep-2022 11:05                5741
function.ldap-rename.php                           30-Sep-2022 11:05                6905
function.ldap-sasl-bind.php                        30-Sep-2022 11:05                6041
function.ldap-search.php                           30-Sep-2022 11:05               15718
function.ldap-set-option.php                       30-Sep-2022 11:05               16070
function.ldap-set-rebind-proc.php                  30-Sep-2022 11:05                3173
function.ldap-sort.php                             30-Sep-2022 11:05                7405
function.ldap-start-tls.php                        30-Sep-2022 11:05                1987
function.ldap-t61-to-8859.php                      30-Sep-2022 11:05                2055
function.ldap-unbind.php                           30-Sep-2022 11:05                3734
function.levenshtein.php                           30-Sep-2022 11:05               13514
function.libxml-clear-errors.php                   30-Sep-2022 11:05                2885
function.libxml-disable-entity-loader.php          30-Sep-2022 11:05                4854
function.libxml-get-errors.php                     30-Sep-2022 11:05               12135
function.libxml-get-last-error.php                 30-Sep-2022 11:05                3273
function.libxml-set-external-entity-loader.php     30-Sep-2022 11:05               10175
function.libxml-set-streams-context.php            30-Sep-2022 11:05                5276
function.libxml-use-internal-errors.php            30-Sep-2022 11:05                6802
function.link.php                                  30-Sep-2022 11:04                5869
function.linkinfo.php                              30-Sep-2022 11:04                4539
function.list.php                                  30-Sep-2022 11:05               18237
function.localeconv.php                            30-Sep-2022 11:05               10254
function.localtime.php                             30-Sep-2022 11:04                9015
function.log.php                                   30-Sep-2022 11:05                3706
function.log10.php                                 30-Sep-2022 11:05                2627
function.log1p.php                                 30-Sep-2022 11:05                3332
function.long2ip.php                               30-Sep-2022 11:05                4275
function.lstat.php                                 30-Sep-2022 11:04                6419
function.ltrim.php                                 30-Sep-2022 11:05                9981
function.lzf-compress.php                          30-Sep-2022 11:04                2839
function.lzf-decompress.php                        30-Sep-2022 11:04                2896
function.lzf-optimized-for.php                     30-Sep-2022 11:04                2203
function.mail.php                                  30-Sep-2022 11:05               30433
function.mailparse-determine-best-xfer-encoding..> 30-Sep-2022 11:05                4210
function.mailparse-msg-create.php                  30-Sep-2022 11:05                3431
function.mailparse-msg-extract-part-file.php       30-Sep-2022 11:05                5203
function.mailparse-msg-extract-part.php            30-Sep-2022 11:05                4075
function.mailparse-msg-extract-whole-part-file.php 30-Sep-2022 11:05                4059
function.mailparse-msg-free.php                    30-Sep-2022 11:05                3512
function.mailparse-msg-get-part-data.php           30-Sep-2022 11:05                2495
function.mailparse-msg-get-part.php                30-Sep-2022 11:05                2712
function.mailparse-msg-get-structure.php           30-Sep-2022 11:05                2506
function.mailparse-msg-parse-file.php              30-Sep-2022 11:05                4291
function.mailparse-msg-parse.php                   30-Sep-2022 11:05                3458
function.mailparse-rfc822-parse-addresses.php      30-Sep-2022 11:05                5704
function.mailparse-stream-encode.php               30-Sep-2022 11:05                5815
function.mailparse-uudecode-all.php                30-Sep-2022 11:05                7049
function.max.php                                   30-Sep-2022 11:05               13430
function.mb-check-encoding.php                     30-Sep-2022 11:04                4602
function.mb-chr.php                                30-Sep-2022 11:04                7025
function.mb-convert-case.php                       30-Sep-2022 11:04               11397
function.mb-convert-encoding.php                   30-Sep-2022 11:04                9909
function.mb-convert-kana.php                       30-Sep-2022 11:04                9234
function.mb-convert-variables.php                  30-Sep-2022 11:04                6669
function.mb-decode-mimeheader.php                  30-Sep-2022 11:04                2982
function.mb-decode-numericentity.php               30-Sep-2022 11:04               36401
function.mb-detect-encoding.php                    30-Sep-2022 11:04               16043
function.mb-detect-order.php                       30-Sep-2022 11:04                8954
function.mb-encode-mimeheader.php                  30-Sep-2022 11:04                9626
function.mb-encode-numericentity.php               30-Sep-2022 11:04               13347
function.mb-encoding-aliases.php                   30-Sep-2022 11:04                5785
function.mb-ereg-match.php                         30-Sep-2022 11:04                5441
function.mb-ereg-replace-callback.php              30-Sep-2022 11:04               13456
function.mb-ereg-replace.php                       30-Sep-2022 11:04                7003
function.mb-ereg-search-getpos.php                 30-Sep-2022 11:04                4145
function.mb-ereg-search-getregs.php                30-Sep-2022 11:04                4402
function.mb-ereg-search-init.php                   30-Sep-2022 11:04                5985
function.mb-ereg-search-pos.php                    30-Sep-2022 11:04                5825
function.mb-ereg-search-regs.php                   30-Sep-2022 11:04                5668
function.mb-ereg-search-setpos.php                 30-Sep-2022 11:04                4664
function.mb-ereg-search.php                        30-Sep-2022 11:04                5446
function.mb-ereg.php                               30-Sep-2022 11:04                6580
function.mb-eregi-replace.php                      30-Sep-2022 11:04                6849
function.mb-eregi.php                              30-Sep-2022 11:04                6521
function.mb-get-info.php                           30-Sep-2022 11:04                6120
function.mb-http-input.php                         30-Sep-2022 11:04                4975
function.mb-http-output.php                        30-Sep-2022 11:04                4979
function.mb-internal-encoding.php                  30-Sep-2022 11:04                6908
function.mb-language.php                           30-Sep-2022 11:04                6314
function.mb-list-encodings.php                     30-Sep-2022 11:04                5135
function.mb-ord.php                                30-Sep-2022 11:04                6634
function.mb-output-handler.php                     30-Sep-2022 11:04                5334
function.mb-parse-str.php                          30-Sep-2022 11:04                4597
function.mb-preferred-mime-name.php                30-Sep-2022 11:04                4288
function.mb-regex-encoding.php                     30-Sep-2022 11:04                4525
function.mb-regex-set-options.php                  30-Sep-2022 11:04                7576
function.mb-scrub.php                              30-Sep-2022 11:04                3217
function.mb-send-mail.php                          30-Sep-2022 11:04               10284
function.mb-split.php                              30-Sep-2022 11:04                4628
function.mb-str-split.php                          30-Sep-2022 11:04                5095
function.mb-strcut.php                             30-Sep-2022 11:04                7455
function.mb-strimwidth.php                         30-Sep-2022 11:04                7407
function.mb-stripos.php                            30-Sep-2022 11:04                6385
function.mb-stristr.php                            30-Sep-2022 11:04                6541
function.mb-strlen.php                             30-Sep-2022 11:04                4801
function.mb-strpos.php                             30-Sep-2022 11:04                6318
function.mb-strrchr.php                            30-Sep-2022 11:04                6327
function.mb-strrichr.php                           30-Sep-2022 11:04                6364
function.mb-strripos.php                           30-Sep-2022 11:04                6292
function.mb-strrpos.php                            30-Sep-2022 11:04                6311
function.mb-strstr.php                             30-Sep-2022 11:04                6332
function.mb-strtolower.php                         30-Sep-2022 11:04                7395
function.mb-strtoupper.php                         30-Sep-2022 11:04                7384
function.mb-strwidth.php                           30-Sep-2022 11:04                9006
function.mb-substitute-character.php               30-Sep-2022 11:04                7424
function.mb-substr-count.php                       30-Sep-2022 11:04                5712
function.mb-substr.php                             30-Sep-2022 11:04                6402
function.mcrypt-create-iv.php                      30-Sep-2022 11:04                7009
function.mcrypt-decrypt.php                        30-Sep-2022 11:04                5839
function.mcrypt-enc-get-algorithms-name.php        30-Sep-2022 11:04                5726
function.mcrypt-enc-get-block-size.php             30-Sep-2022 11:04                2976
function.mcrypt-enc-get-iv-size.php                30-Sep-2022 11:04                3385
function.mcrypt-enc-get-key-size.php               30-Sep-2022 11:04                2956
function.mcrypt-enc-get-modes-name.php             30-Sep-2022 11:04                5319
function.mcrypt-enc-get-supported-key-sizes.php    30-Sep-2022 11:04                5266
function.mcrypt-enc-is-block-algorithm-mode.php    30-Sep-2022 11:04                3412
function.mcrypt-enc-is-block-algorithm.php         30-Sep-2022 11:04                3166
function.mcrypt-enc-is-block-mode.php              30-Sep-2022 11:04                3322
function.mcrypt-enc-self-test.php                  30-Sep-2022 11:04                3006
function.mcrypt-encrypt.php                        30-Sep-2022 11:04               16981
function.mcrypt-generic-deinit.php                 30-Sep-2022 11:04                3920
function.mcrypt-generic-init.php                   30-Sep-2022 11:04                5419
function.mcrypt-generic.php                        30-Sep-2022 11:04                6355
function.mcrypt-get-block-size.php                 30-Sep-2022 11:04                6566
function.mcrypt-get-cipher-name.php                30-Sep-2022 11:04                4832
function.mcrypt-get-iv-size.php                    30-Sep-2022 11:04                6609
function.mcrypt-get-key-size.php                   30-Sep-2022 11:04                6664
function.mcrypt-list-algorithms.php                30-Sep-2022 11:04                4756
function.mcrypt-list-modes.php                     30-Sep-2022 11:04                4702
function.mcrypt-module-close.php                   30-Sep-2022 11:04                3396
function.mcrypt-module-get-algo-block-size.php     30-Sep-2022 11:04                3498
function.mcrypt-module-get-algo-key-size.php       30-Sep-2022 11:04                3546
function.mcrypt-module-get-supported-key-sizes.php 30-Sep-2022 11:04                4832
function.mcrypt-module-is-block-algorithm-mode.php 30-Sep-2022 11:04                4059
function.mcrypt-module-is-block-algorithm.php      30-Sep-2022 11:04                3895
function.mcrypt-module-is-block-mode.php           30-Sep-2022 11:04                4423
function.mcrypt-module-open.php                    30-Sep-2022 11:04               14845
function.mcrypt-module-self-test.php               30-Sep-2022 11:04                4861
function.md5-file.php                              30-Sep-2022 11:05                5222
function.md5.php                                   30-Sep-2022 11:05                6206
function.mdecrypt-generic.php                      30-Sep-2022 11:04               11643
function.memcache-debug.php                        30-Sep-2022 11:05                3407
function.memory-get-peak-usage.php                 30-Sep-2022 11:04                3427
function.memory-get-usage.php                      30-Sep-2022 11:04                5611
function.memory-reset-peak-usage.php               30-Sep-2022 11:04                5057
function.metaphone.php                             30-Sep-2022 11:05                8501
function.method-exists.php                         30-Sep-2022 11:05                6470
function.mhash-count.php                           30-Sep-2022 11:04                4875
function.mhash-get-block-size.php                  30-Sep-2022 11:04                4472
function.mhash-get-hash-name.php                   30-Sep-2022 11:04                4406
function.mhash-keygen-s2k.php                      30-Sep-2022 11:04                5857
function.mhash.php                                 30-Sep-2022 11:04                4799
function.microtime.php                             30-Sep-2022 11:04                8073
function.mime-content-type.php                     30-Sep-2022 11:04                4857
function.min.php                                   30-Sep-2022 11:05               14076
function.mkdir.php                                 30-Sep-2022 11:04                9626
function.mktime.php                                30-Sep-2022 11:04               19009
function.money-format.php                          30-Sep-2022 11:05               20027
function.mongodb.bson-fromjson.php                 30-Sep-2022 11:04                5969
function.mongodb.bson-fromphp.php                  30-Sep-2022 11:04                5937
function.mongodb.bson-tocanonicalextendedjson.php  30-Sep-2022 11:04               16315
function.mongodb.bson-tojson.php                   30-Sep-2022 11:04               17854
function.mongodb.bson-tophp.php                    30-Sep-2022 11:04                8968
function.mongodb.bson-torelaxedextendedjson.php    30-Sep-2022 11:04               16014
function.mongodb.driver.monitoring.addsubscribe..> 30-Sep-2022 11:04                5280
function.mongodb.driver.monitoring.removesubscr..> 30-Sep-2022 11:04                5057
function.move-uploaded-file.php                    30-Sep-2022 11:04                8813
function.mqseries-back.php                         30-Sep-2022 11:05                6571
function.mqseries-begin.php                        30-Sep-2022 11:05                7991
function.mqseries-close.php                        30-Sep-2022 11:05                6536
function.mqseries-cmit.php                         30-Sep-2022 11:05                6483
function.mqseries-conn.php                         30-Sep-2022 11:05                5950
function.mqseries-connx.php                        30-Sep-2022 11:05               14650
function.mqseries-disc.php                         30-Sep-2022 11:05                5617
function.mqseries-get.php                          30-Sep-2022 11:05               13215
function.mqseries-inq.php                          30-Sep-2022 11:05                9219
function.mqseries-open.php                         30-Sep-2022 11:05                7653
function.mqseries-put.php                          30-Sep-2022 11:05               14344
function.mqseries-put1.php                         30-Sep-2022 11:05                6264
function.mqseries-set.php                          30-Sep-2022 11:05                5812
function.mqseries-strerror.php                     30-Sep-2022 11:05                4347
function.msg-get-queue.php                         30-Sep-2022 11:05                5778
function.msg-queue-exists.php                      30-Sep-2022 11:05                3326
function.msg-receive.php                           30-Sep-2022 11:05               10897
function.msg-remove-queue.php                      30-Sep-2022 11:05                4517
function.msg-send.php                              30-Sep-2022 11:05                8869
function.msg-set-queue.php                         30-Sep-2022 11:05                5259
function.msg-stat-queue.php                        30-Sep-2022 11:05                6637
function.mt-getrandmax.php                         30-Sep-2022 11:05                5639
function.mt-rand.php                               30-Sep-2022 11:05               10547
function.mt-srand.php                              30-Sep-2022 11:05                8339
function.mysql-affected-rows.php                   30-Sep-2022 11:04               12856
function.mysql-client-encoding.php                 30-Sep-2022 11:04                6310
function.mysql-close.php                           30-Sep-2022 11:04                7476
function.mysql-connect.php                         30-Sep-2022 11:04               17686
function.mysql-create-db.php                       30-Sep-2022 11:04                8697
function.mysql-data-seek.php                       30-Sep-2022 11:04               12682
function.mysql-db-name.php                         30-Sep-2022 11:04                7864
function.mysql-db-query.php                        30-Sep-2022 11:04               10327
function.mysql-drop-db.php                         30-Sep-2022 11:04                8015
function.mysql-errno.php                           30-Sep-2022 11:04                8468
function.mysql-error.php                           30-Sep-2022 11:04                8414
function.mysql-escape-string.php                   30-Sep-2022 11:04                7111
function.mysql-fetch-array.php                     30-Sep-2022 11:04               16088
function.mysql-fetch-assoc.php                     30-Sep-2022 11:04               12556
function.mysql-fetch-field.php                     30-Sep-2022 11:04               14690
function.mysql-fetch-lengths.php                   30-Sep-2022 11:04                7908
function.mysql-fetch-object.php                    30-Sep-2022 11:04               12098
function.mysql-fetch-row.php                       30-Sep-2022 11:04                8173
function.mysql-field-flags.php                     30-Sep-2022 11:04                8678
function.mysql-field-len.php                       30-Sep-2022 11:04                7075
function.mysql-field-name.php                      30-Sep-2022 11:04                9359
function.mysql-field-seek.php                      30-Sep-2022 11:04                5071
function.mysql-field-table.php                     30-Sep-2022 11:04                8082
function.mysql-field-type.php                      30-Sep-2022 11:04               12122
function.mysql-free-result.php                     30-Sep-2022 11:04                8056
function.mysql-get-client-info.php                 30-Sep-2022 11:04                5123
function.mysql-get-host-info.php                   30-Sep-2022 11:04                7089
function.mysql-get-proto-info.php                  30-Sep-2022 11:04                6661
function.mysql-get-server-info.php                 30-Sep-2022 11:04                7040
function.mysql-info.php                            30-Sep-2022 11:04                6379
function.mysql-insert-id.php                       30-Sep-2022 11:04                8657
function.mysql-list-dbs.php                        30-Sep-2022 11:04                9098
function.mysql-list-fields.php                     30-Sep-2022 11:04                8973
function.mysql-list-processes.php                  30-Sep-2022 11:04                7513
function.mysql-list-tables.php                     30-Sep-2022 11:04                9803
function.mysql-num-fields.php                      30-Sep-2022 11:04                6741
function.mysql-num-rows.php                        30-Sep-2022 11:04                8344
function.mysql-pconnect.php                        30-Sep-2022 11:04                8197
function.mysql-ping.php                            30-Sep-2022 11:04                8333
function.mysql-query.php                           30-Sep-2022 11:04               15495
function.mysql-real-escape-string.php              30-Sep-2022 11:04               17368
function.mysql-result.php                          30-Sep-2022 11:04               10031
function.mysql-select-db.php                       30-Sep-2022 11:04                7955
function.mysql-set-charset.php                     30-Sep-2022 11:04                5940
function.mysql-stat.php                            30-Sep-2022 11:04                9284
function.mysql-tablename.php                       30-Sep-2022 11:04                8157
function.mysql-thread-id.php                       30-Sep-2022 11:04                6835
function.mysql-unbuffered-query.php                30-Sep-2022 11:04                7250
function.mysql-xdevapi-expression.php              30-Sep-2022 11:04                4818
function.mysql-xdevapi-getsession.php              30-Sep-2022 11:04               13220
function.mysqli-connect.php                        30-Sep-2022 11:04                2325
function.mysqli-escape-string.php                  30-Sep-2022 11:04                1917
function.mysqli-execute.php                        30-Sep-2022 11:04                2551
function.mysqli-get-client-stats.php               30-Sep-2022 11:04                8335
function.mysqli-get-links-stats.php                30-Sep-2022 11:04                3357
function.mysqli-report.php                         30-Sep-2022 11:04                1719
function.mysqli-set-opt.php                        30-Sep-2022 11:04                1825
function.natcasesort.php                           30-Sep-2022 11:05                7280
function.natsort.php                               30-Sep-2022 11:05               10654
function.net-get-interfaces.php                    30-Sep-2022 11:05                4540
function.next.php                                  30-Sep-2022 11:05                8983
function.ngettext.php                              30-Sep-2022 11:04                5694
function.nl-langinfo.php                           30-Sep-2022 11:05               16053
function.nl2br.php                                 30-Sep-2022 11:05                6862
function.number-format.php                         30-Sep-2022 11:05                8790
function.oauth-get-sbs.php                         30-Sep-2022 11:05                2985
function.oauth-urlencode.php                       30-Sep-2022 11:05                2527
function.ob-clean.php                              30-Sep-2022 11:04                3707
function.ob-end-clean.php                          30-Sep-2022 11:04                5344
function.ob-end-flush.php                          30-Sep-2022 11:04                6212
function.ob-flush.php                              30-Sep-2022 11:04                3892
function.ob-get-clean.php                          30-Sep-2022 11:04                5429
function.ob-get-contents.php                       30-Sep-2022 11:04                4785
function.ob-get-flush.php                          30-Sep-2022 11:04                5899
function.ob-get-length.php                         30-Sep-2022 11:04                4714
function.ob-get-level.php                          30-Sep-2022 11:04                2908
function.ob-get-status.php                         30-Sep-2022 11:04                7343
function.ob-gzhandler.php                          30-Sep-2022 11:04                5956
function.ob-iconv-handler.php                      30-Sep-2022 11:04                5274
function.ob-implicit-flush.php                     30-Sep-2022 11:04                4298
function.ob-list-handlers.php                      30-Sep-2022 11:04                6121
function.ob-start.php                              30-Sep-2022 11:04               16849
function.ob-tidyhandler.php                        30-Sep-2022 11:05                4270
function.oci-bind-array-by-name.php                30-Sep-2022 11:04               14150
function.oci-bind-by-name.php                      30-Sep-2022 11:04               86649
function.oci-cancel.php                            30-Sep-2022 11:04                2531
function.oci-client-version.php                    30-Sep-2022 11:04                4220
function.oci-close.php                             30-Sep-2022 11:04               21200
function.oci-commit.php                            30-Sep-2022 11:04               11925
function.oci-connect.php                           30-Sep-2022 11:04               39637
function.oci-define-by-name.php                    30-Sep-2022 11:04               26371
function.oci-error.php                             30-Sep-2022 11:04               12349
function.oci-execute.php                           30-Sep-2022 11:04               22832
function.oci-fetch-all.php                         30-Sep-2022 11:04               28013
function.oci-fetch-array.php                       30-Sep-2022 11:04               73207
function.oci-fetch-assoc.php                       30-Sep-2022 11:04                9074
function.oci-fetch-object.php                      30-Sep-2022 11:04               20421
function.oci-fetch-row.php                         30-Sep-2022 11:04                9044
function.oci-fetch.php                             30-Sep-2022 11:04               14603
function.oci-field-is-null.php                     30-Sep-2022 11:04                8663
function.oci-field-name.php                        30-Sep-2022 11:04               11373
function.oci-field-precision.php                   30-Sep-2022 11:04               10077
function.oci-field-scale.php                       30-Sep-2022 11:04               10008
function.oci-field-size.php                        30-Sep-2022 11:04               12035
function.oci-field-type-raw.php                    30-Sep-2022 11:04                9052
function.oci-field-type.php                        30-Sep-2022 11:04                7835
function.oci-free-descriptor.php                   30-Sep-2022 11:04                3443
function.oci-free-statement.php                    30-Sep-2022 11:04                2849
function.oci-get-implicit-resultset.php            30-Sep-2022 11:04               32899
function.oci-internal-debug.php                    30-Sep-2022 11:04                3606
function.oci-lob-copy.php                          30-Sep-2022 11:04                4410
function.oci-lob-is-equal.php                      30-Sep-2022 11:04                3123
function.oci-new-collection.php                    30-Sep-2022 11:04                5450
function.oci-new-connect.php                       30-Sep-2022 11:04               17277
function.oci-new-cursor.php                        30-Sep-2022 11:04                8798
function.oci-new-descriptor.php                    30-Sep-2022 11:04               21402
function.oci-num-fields.php                        30-Sep-2022 11:04                7976
function.oci-num-rows.php                          30-Sep-2022 11:04                8730
function.oci-parse.php                             30-Sep-2022 11:04               13520
function.oci-password-change.php                   30-Sep-2022 11:04               14875
function.oci-pconnect.php                          30-Sep-2022 11:04               15227
function.oci-register-taf-callback.php             30-Sep-2022 11:04                5337
function.oci-result.php                            30-Sep-2022 11:04                9681
function.oci-rollback.php                          30-Sep-2022 11:04               15705
function.oci-server-version.php                    30-Sep-2022 11:04                5493
function.oci-set-action.php                        30-Sep-2022 11:04                8850
function.oci-set-call-timout.php                   30-Sep-2022 11:04                5772
function.oci-set-client-identifier.php             30-Sep-2022 11:04                8744
function.oci-set-client-info.php                   30-Sep-2022 11:04                8772
function.oci-set-db-operation.php                  30-Sep-2022 11:04                7870
function.oci-set-edition.php                       30-Sep-2022 11:04               10257
function.oci-set-module-name.php                   30-Sep-2022 11:04                8868
function.oci-set-prefetch-lob.php                  30-Sep-2022 11:04                8936
function.oci-set-prefetch.php                      30-Sep-2022 11:04               24302
function.oci-statement-type.php                    30-Sep-2022 11:04                7218
function.oci-unregister-taf-callback.php           30-Sep-2022 11:04                3452
function.ocibindbyname.php                         30-Sep-2022 11:04                1977
function.ocicancel.php                             30-Sep-2022 11:04                1919
function.ocicloselob.php                           30-Sep-2022 11:04                1918
function.ocicollappend.php                         30-Sep-2022 11:04                1983
function.ocicollassign.php                         30-Sep-2022 11:04                1988
function.ocicollassignelem.php                     30-Sep-2022 11:04                2033
function.ocicollgetelem.php                        30-Sep-2022 11:04                2000
function.ocicollmax.php                            30-Sep-2022 11:04                1952
function.ocicollsize.php                           30-Sep-2022 11:04                1955
function.ocicolltrim.php                           30-Sep-2022 11:04                1965
function.ocicolumnisnull.php                       30-Sep-2022 11:04                1989
function.ocicolumnname.php                         30-Sep-2022 11:04                1981
function.ocicolumnprecision.php                    30-Sep-2022 11:04                2024
function.ocicolumnscale.php                        30-Sep-2022 11:04                1988
function.ocicolumnsize.php                         30-Sep-2022 11:04                1969
function.ocicolumntype.php                         30-Sep-2022 11:04                1973
function.ocicolumntyperaw.php                      30-Sep-2022 11:04                1996
function.ocicommit.php                             30-Sep-2022 11:04                1933
function.ocidefinebyname.php                       30-Sep-2022 11:04                1979
function.ocierror.php                              30-Sep-2022 11:04                1910
function.ociexecute.php                            30-Sep-2022 11:04                1914
function.ocifetch.php                              30-Sep-2022 11:04                1904
function.ocifetchinto.php                          30-Sep-2022 11:04                2669
function.ocifetchstatement.php                     30-Sep-2022 11:04                1997
function.ocifreecollection.php                     30-Sep-2022 11:04                2015
function.ocifreecursor.php                         30-Sep-2022 11:04                1987
function.ocifreedesc.php                           30-Sep-2022 11:04                1931
function.ocifreestatement.php                      30-Sep-2022 11:04                2006
function.ociinternaldebug.php                      30-Sep-2022 11:04                2020
function.ociloadlob.php                            30-Sep-2022 11:04                1916
function.ocilogoff.php                             30-Sep-2022 11:04                1903
function.ocilogon.php                              30-Sep-2022 11:04                1918
function.ocinewcollection.php                      30-Sep-2022 11:04                2004
function.ocinewcursor.php                          30-Sep-2022 11:04                1972
function.ocinewdescriptor.php                      30-Sep-2022 11:04                1994
function.ocinlogon.php                             30-Sep-2022 11:04                1943
function.ocinumcols.php                            30-Sep-2022 11:04                1928
function.ociparse.php                              30-Sep-2022 11:04                1898
function.ociplogon.php                             30-Sep-2022 11:04                1913
function.ociresult.php                             30-Sep-2022 11:04                1911
function.ocirollback.php                           30-Sep-2022 11:04                1933
function.ocirowcount.php                           30-Sep-2022 11:04                1935
function.ocisavelob.php                            30-Sep-2022 11:04                1916
function.ocisavelobfile.php                        30-Sep-2022 11:04                1954
function.ociserverversion.php                      30-Sep-2022 11:04                2008
function.ocisetprefetch.php                        30-Sep-2022 11:04                1994
function.ocistatementtype.php                      30-Sep-2022 11:04                2014
function.ociwritelobtofile.php                     30-Sep-2022 11:04                1995
function.ociwritetemporarylob.php                  30-Sep-2022 11:04                2018
function.octdec.php                                30-Sep-2022 11:05                5981
function.odbc-autocommit.php                       30-Sep-2022 11:04                4481
function.odbc-binmode.php                          30-Sep-2022 11:04                6963
function.odbc-close-all.php                        30-Sep-2022 11:04                2647
function.odbc-close.php                            30-Sep-2022 11:04                3021
function.odbc-columnprivileges.php                 30-Sep-2022 11:04                8694
function.odbc-columns.php                          30-Sep-2022 11:04               11378
function.odbc-commit.php                           30-Sep-2022 11:04                2634
function.odbc-connect.php                          30-Sep-2022 11:04                9036
function.odbc-cursor.php                           30-Sep-2022 11:04                2715
function.odbc-data-source.php                      30-Sep-2022 11:04                5907
function.odbc-do.php                               30-Sep-2022 11:04                1650
function.odbc-error.php                            30-Sep-2022 11:04                4205
function.odbc-errormsg.php                         30-Sep-2022 11:04                4117
function.odbc-exec.php                             30-Sep-2022 11:04                4068
function.odbc-execute.php                          30-Sep-2022 11:04                6965
function.odbc-fetch-array.php                      30-Sep-2022 11:04                4279
function.odbc-fetch-into.php                       30-Sep-2022 11:04                4843
function.odbc-fetch-object.php                     30-Sep-2022 11:04                4313
function.odbc-fetch-row.php                        30-Sep-2022 11:04                4635
function.odbc-field-len.php                        30-Sep-2022 11:04                3259
function.odbc-field-name.php                       30-Sep-2022 11:04                2961
function.odbc-field-num.php                        30-Sep-2022 11:04                2921
function.odbc-field-precision.php                  30-Sep-2022 11:04                2225
function.odbc-field-scale.php                      30-Sep-2022 11:04                3066
function.odbc-field-type.php                       30-Sep-2022 11:04                2949
function.odbc-foreignkeys.php                      30-Sep-2022 11:04                8844
function.odbc-free-result.php                      30-Sep-2022 11:04                3311
function.odbc-gettypeinfo.php                      30-Sep-2022 11:04                4385
function.odbc-longreadlen.php                      30-Sep-2022 11:04                3837
function.odbc-next-result.php                      30-Sep-2022 11:04                9428
function.odbc-num-fields.php                       30-Sep-2022 11:04                2553
function.odbc-num-rows.php                         30-Sep-2022 11:04                3305
function.odbc-pconnect.php                         30-Sep-2022 11:04                4626
function.odbc-prepare.php                          30-Sep-2022 11:04                6454
function.odbc-primarykeys.php                      30-Sep-2022 11:04                7844
function.odbc-procedurecolumns.php                 30-Sep-2022 11:04               11578
function.odbc-procedures.php                       30-Sep-2022 11:04                9402
function.odbc-result-all.php                       30-Sep-2022 11:04                4004
function.odbc-result.php                           30-Sep-2022 11:04                5522
function.odbc-rollback.php                         30-Sep-2022 11:04                2639
function.odbc-setoption.php                        30-Sep-2022 11:04                7673
function.odbc-specialcolumns.php                   30-Sep-2022 11:04                7370
function.odbc-statistics.php                       30-Sep-2022 11:04                9626
function.odbc-tableprivileges.php                  30-Sep-2022 11:04                8198
function.odbc-tables.php                           30-Sep-2022 11:04               12330
function.opcache-compile-file.php                  30-Sep-2022 11:04                3683
function.opcache-get-configuration.php             30-Sep-2022 11:04                3316
function.opcache-get-status.php                    30-Sep-2022 11:04                3735
function.opcache-invalidate.php                    30-Sep-2022 11:04                4098
function.opcache-is-script-cached.php              30-Sep-2022 11:04                3328
function.opcache-reset.php                         30-Sep-2022 11:04                3005
function.openal-buffer-create.php                  30-Sep-2022 11:04                2878
function.openal-buffer-data.php                    30-Sep-2022 11:04                4495
function.openal-buffer-destroy.php                 30-Sep-2022 11:04                3020
function.openal-buffer-get.php                     30-Sep-2022 11:04                3593
function.openal-buffer-loadwav.php                 30-Sep-2022 11:04                3583
function.openal-context-create.php                 30-Sep-2022 11:04                3254
function.openal-context-current.php                30-Sep-2022 11:04                3075
function.openal-context-destroy.php                30-Sep-2022 11:04                3057
function.openal-context-process.php                30-Sep-2022 11:04                3499
function.openal-context-suspend.php                30-Sep-2022 11:04                3493
function.openal-device-close.php                   30-Sep-2022 11:04                3015
function.openal-device-open.php                    30-Sep-2022 11:04                3399
function.openal-listener-get.php                   30-Sep-2022 11:04                3584
function.openal-listener-set.php                   30-Sep-2022 11:04                3935
function.openal-source-create.php                  30-Sep-2022 11:04                3058
function.openal-source-destroy.php                 30-Sep-2022 11:04                3038
function.openal-source-get.php                     30-Sep-2022 11:04                5713
function.openal-source-pause.php                   30-Sep-2022 11:04                3410
function.openal-source-play.php                    30-Sep-2022 11:04                3402
function.openal-source-rewind.php                  30-Sep-2022 11:04                3412
function.openal-source-set.php                     30-Sep-2022 11:04                6406
function.openal-source-stop.php                    30-Sep-2022 11:04                3385
function.openal-stream.php                         30-Sep-2022 11:04                3974
function.opendir.php                               30-Sep-2022 11:04                8158
function.openlog.php                               30-Sep-2022 11:05                8840
function.openssl-cipher-iv-length.php              30-Sep-2022 11:04                4397
function.openssl-cipher-key-length.php             30-Sep-2022 11:04                4181
function.openssl-cms-decrypt.php                   30-Sep-2022 11:04                4596
function.openssl-cms-encrypt.php                   30-Sep-2022 11:04                5591
function.openssl-cms-read.php                      30-Sep-2022 11:04                3010
function.openssl-cms-sign.php                      30-Sep-2022 11:04                7266
function.openssl-cms-verify.php                    30-Sep-2022 11:04                6126
function.openssl-csr-export-to-file.php            30-Sep-2022 11:04                8449
function.openssl-csr-export.php                    30-Sep-2022 11:04                8224
function.openssl-csr-get-public-key.php            30-Sep-2022 11:04                9024
function.openssl-csr-get-subject.php               30-Sep-2022 11:04                9732
function.openssl-csr-new.php                       30-Sep-2022 11:04               22322
function.openssl-csr-sign.php                      30-Sep-2022 11:04               13704
function.openssl-decrypt.php                       30-Sep-2022 11:04                7338
function.openssl-dh-compute-key.php                30-Sep-2022 11:04               16936
function.openssl-digest.php                        30-Sep-2022 11:04                4314
function.openssl-encrypt.php                       30-Sep-2022 11:04               18459
function.openssl-error-string.php                  30-Sep-2022 11:04                4059
function.openssl-free-key.php                      30-Sep-2022 11:04                3518
function.openssl-get-cert-locations.php            30-Sep-2022 11:04                4025
function.openssl-get-cipher-methods.php            30-Sep-2022 11:04               14462
function.openssl-get-curve-names.php               30-Sep-2022 11:04                7190
function.openssl-get-md-methods.php                30-Sep-2022 11:04                6950
function.openssl-get-privatekey.php                30-Sep-2022 11:04                1874
function.openssl-get-publickey.php                 30-Sep-2022 11:04                1847
function.openssl-open.php                          30-Sep-2022 11:04               10219
function.openssl-pbkdf2.php                        30-Sep-2022 11:04                7403
function.openssl-pkcs12-export-to-file.php         30-Sep-2022 11:04                6989
function.openssl-pkcs12-export.php                 30-Sep-2022 11:04                6861
function.openssl-pkcs12-read.php                   30-Sep-2022 11:04                5467
function.openssl-pkcs7-decrypt.php                 30-Sep-2022 11:04                7434
function.openssl-pkcs7-encrypt.php                 30-Sep-2022 11:04               10927
function.openssl-pkcs7-read.php                    30-Sep-2022 11:04                7004
function.openssl-pkcs7-sign.php                    30-Sep-2022 11:04               12034
function.openssl-pkcs7-verify.php                  30-Sep-2022 11:04                7699
function.openssl-pkey-derive.php                   30-Sep-2022 11:04                7879
function.openssl-pkey-export-to-file.php           30-Sep-2022 11:04                6112
function.openssl-pkey-export.php                   30-Sep-2022 11:04                6071
function.openssl-pkey-free.php                     30-Sep-2022 11:04                3796
function.openssl-pkey-get-details.php              30-Sep-2022 11:04                9454
function.openssl-pkey-get-private.php              30-Sep-2022 11:04                5946
function.openssl-pkey-get-public.php               30-Sep-2022 11:04                5523
function.openssl-pkey-new.php                      30-Sep-2022 11:04                7102
function.openssl-private-decrypt.php               30-Sep-2022 11:04                6311
function.openssl-private-encrypt.php               30-Sep-2022 11:04                6208
function.openssl-public-decrypt.php                30-Sep-2022 11:04                6195
function.openssl-public-encrypt.php                30-Sep-2022 11:04                6472
function.openssl-random-pseudo-bytes.php           30-Sep-2022 11:04                9410
function.openssl-seal.php                          30-Sep-2022 11:04               11574
function.openssl-sign.php                          30-Sep-2022 11:04               12755
function.openssl-spki-export-challenge.php         30-Sep-2022 11:04                7872
function.openssl-spki-export.php                   30-Sep-2022 11:04                8442
function.openssl-spki-new.php                      30-Sep-2022 11:04                9263
function.openssl-spki-verify.php                   30-Sep-2022 11:04                8068
function.openssl-verify.php                        30-Sep-2022 11:04               13675
function.openssl-x509-check-private-key.php        30-Sep-2022 11:04                5611
function.openssl-x509-checkpurpose.php             30-Sep-2022 11:04                7649
function.openssl-x509-export-to-file.php           30-Sep-2022 11:04                4749
function.openssl-x509-export.php                   30-Sep-2022 11:04                4676
function.openssl-x509-fingerprint.php              30-Sep-2022 11:04                5276
function.openssl-x509-free.php                     30-Sep-2022 11:04                3802
function.openssl-x509-parse.php                    30-Sep-2022 11:04                4877
function.openssl-x509-read.php                     30-Sep-2022 11:04                4483
function.openssl-x509-verify.php                   30-Sep-2022 11:04               13042
function.ord.php                                   30-Sep-2022 11:05                7896
function.output-add-rewrite-var.php                30-Sep-2022 11:04                8479
function.output-reset-rewrite-vars.php             30-Sep-2022 11:04                6701
function.pack.php                                  30-Sep-2022 11:05               13461
function.parse-ini-file.php                        30-Sep-2022 11:04               20409
function.parse-ini-string.php                      30-Sep-2022 11:04                6810
function.parse-str.php                             30-Sep-2022 11:05               10637
function.parse-url.php                             30-Sep-2022 11:05               16102
function.passthru.php                              30-Sep-2022 11:05                6109
function.password-algos.php                        30-Sep-2022 11:04                3467
function.password-get-info.php                     30-Sep-2022 11:04                3570
function.password-hash.php                         30-Sep-2022 11:04               23444
function.password-needs-rehash.php                 30-Sep-2022 11:04                8278
function.password-verify.php                       30-Sep-2022 11:04                6600
function.pathinfo.php                              30-Sep-2022 11:04               11936
function.pclose.php                                30-Sep-2022 11:04                4876
function.pcntl-alarm.php                           30-Sep-2022 11:05                2881
function.pcntl-async-signals.php                   30-Sep-2022 11:05                3903
function.pcntl-errno.php                           30-Sep-2022 11:05                1738
function.pcntl-exec.php                            30-Sep-2022 11:05                3755
function.pcntl-fork.php                            30-Sep-2022 11:05                5304
function.pcntl-get-last-error.php                  30-Sep-2022 11:05                2796
function.pcntl-getpriority.php                     30-Sep-2022 11:05                5168
function.pcntl-rfork.php                           30-Sep-2022 11:05                7586
function.pcntl-setpriority.php                     30-Sep-2022 11:05                5137
function.pcntl-signal-dispatch.php                 30-Sep-2022 11:05                5866
function.pcntl-signal-get-handler.php              30-Sep-2022 11:05                6817
function.pcntl-signal.php                          30-Sep-2022 11:05               12557
function.pcntl-sigprocmask.php                     30-Sep-2022 11:05                5768
function.pcntl-sigtimedwait.php                    30-Sep-2022 11:05                4909
function.pcntl-sigwaitinfo.php                     30-Sep-2022 11:05                7560
function.pcntl-strerror.php                        30-Sep-2022 11:05                2981
function.pcntl-unshare.php                         30-Sep-2022 11:05                4316
function.pcntl-wait.php                            30-Sep-2022 11:05                8295
function.pcntl-waitpid.php                         30-Sep-2022 11:05                9850
function.pcntl-wexitstatus.php                     30-Sep-2022 11:05                3655
function.pcntl-wifexited.php                       30-Sep-2022 11:05                3406
function.pcntl-wifsignaled.php                     30-Sep-2022 11:05                3413
function.pcntl-wifstopped.php                      30-Sep-2022 11:05                3364
function.pcntl-wstopsig.php                        30-Sep-2022 11:05                3650
function.pcntl-wtermsig.php                        30-Sep-2022 11:05                3742
function.pfsockopen.php                            30-Sep-2022 11:05                5219
function.pg-affected-rows.php                      30-Sep-2022 11:04                7025
function.pg-cancel-query.php                       30-Sep-2022 11:04                7878
function.pg-client-encoding.php                    30-Sep-2022 11:04                6990
function.pg-close.php                              30-Sep-2022 11:04                6581
function.pg-connect-poll.php                       30-Sep-2022 11:04                3778
function.pg-connect.php                            30-Sep-2022 11:04               11796
function.pg-connection-busy.php                    30-Sep-2022 11:04                5906
function.pg-connection-reset.php                   30-Sep-2022 11:04                6087
function.pg-connection-status.php                  30-Sep-2022 11:04                5684
function.pg-consume-input.php                      30-Sep-2022 11:04                3550
function.pg-convert.php                            30-Sep-2022 11:04                8875
function.pg-copy-from.php                          30-Sep-2022 11:04                8109
function.pg-copy-to.php                            30-Sep-2022 11:04                7565
function.pg-dbname.php                             30-Sep-2022 11:04                5356
function.pg-delete.php                             30-Sep-2022 11:04                9531
function.pg-end-copy.php                           30-Sep-2022 11:04                7445
function.pg-escape-bytea.php                       30-Sep-2022 11:04                8424
function.pg-escape-identifier.php                  30-Sep-2022 11:04                8377
function.pg-escape-literal.php                     30-Sep-2022 11:04                8924
function.pg-escape-string.php                      30-Sep-2022 11:04                7871
function.pg-execute.php                            30-Sep-2022 11:04               11186
function.pg-fetch-all-columns.php                  30-Sep-2022 11:04                7250
function.pg-fetch-all.php                          30-Sep-2022 11:04                9018
function.pg-fetch-array.php                        30-Sep-2022 11:04               12794
function.pg-fetch-assoc.php                        30-Sep-2022 11:04                9563
function.pg-fetch-object.php                       30-Sep-2022 11:04               11213
function.pg-fetch-result.php                       30-Sep-2022 11:04                9073
function.pg-fetch-row.php                          30-Sep-2022 11:04                9678
function.pg-field-is-null.php                      30-Sep-2022 11:04                8777
function.pg-field-name.php                         30-Sep-2022 11:04                9424
function.pg-field-num.php                          30-Sep-2022 11:04                6747
function.pg-field-prtlen.php                       30-Sep-2022 11:04               11363
function.pg-field-size.php                         30-Sep-2022 11:04                9873
function.pg-field-table.php                        30-Sep-2022 11:04                8591
function.pg-field-type-oid.php                     30-Sep-2022 11:04                7530
function.pg-field-type.php                         30-Sep-2022 11:04                7389
function.pg-flush.php                              30-Sep-2022 11:04                3600
function.pg-free-result.php                        30-Sep-2022 11:04                7593
function.pg-get-notify.php                         30-Sep-2022 11:04                7344
function.pg-get-pid.php                            30-Sep-2022 11:04                5378
function.pg-get-result.php                         30-Sep-2022 11:04                9189
function.pg-host.php                               30-Sep-2022 11:04                6345
function.pg-insert.php                             30-Sep-2022 11:04               10070
function.pg-last-error.php                         30-Sep-2022 11:04                7642
function.pg-last-notice.php                        30-Sep-2022 11:04                7967
function.pg-last-oid.php                           30-Sep-2022 11:04                7849
function.pg-lo-close.php                           30-Sep-2022 11:04                7491
function.pg-lo-create.php                          30-Sep-2022 11:04                9102
function.pg-lo-export.php                          30-Sep-2022 11:04                8475
function.pg-lo-import.php                          30-Sep-2022 11:04                7814
function.pg-lo-open.php                            30-Sep-2022 11:04                9440
function.pg-lo-read-all.php                        30-Sep-2022 11:04                6605
function.pg-lo-read.php                            30-Sep-2022 11:04                7178
function.pg-lo-seek.php                            30-Sep-2022 11:04                8039
function.pg-lo-tell.php                            30-Sep-2022 11:04                7452
function.pg-lo-truncate.php                        30-Sep-2022 11:04                6756
function.pg-lo-unlink.php                          30-Sep-2022 11:04                7486
function.pg-lo-write.php                           30-Sep-2022 11:04                8504
function.pg-meta-data.php                          30-Sep-2022 11:04                7566
function.pg-num-fields.php                         30-Sep-2022 11:04                6104
function.pg-num-rows.php                           30-Sep-2022 11:04                6071
function.pg-options.php                            30-Sep-2022 11:04                5581
function.pg-parameter-status.php                   30-Sep-2022 11:04                8623
function.pg-pconnect.php                           30-Sep-2022 11:04               10544
function.pg-ping.php                               30-Sep-2022 11:04                6158
function.pg-port.php                               30-Sep-2022 11:04                5892
function.pg-prepare.php                            30-Sep-2022 11:04               11107
function.pg-put-line.php                           30-Sep-2022 11:04                9023
function.pg-query-params.php                       30-Sep-2022 11:04               11557
function.pg-query.php                              30-Sep-2022 11:04               13346
function.pg-result-error-field.php                 30-Sep-2022 11:04                8962
function.pg-result-error.php                       30-Sep-2022 11:04                8405
function.pg-result-seek.php                        30-Sep-2022 11:04                7585
function.pg-result-status.php                      30-Sep-2022 11:04                8004
function.pg-select.php                             30-Sep-2022 11:04               10224
function.pg-send-execute.php                       30-Sep-2022 11:04               11136
function.pg-send-prepare.php                       30-Sep-2022 11:04               11498
function.pg-send-query-params.php                  30-Sep-2022 11:04                8402
function.pg-send-query.php                         30-Sep-2022 11:04               10449
function.pg-set-client-encoding.php                30-Sep-2022 11:04                9320
function.pg-set-error-verbosity.php                30-Sep-2022 11:04                8819
function.pg-socket.php                             30-Sep-2022 11:04                3710
function.pg-trace.php                              30-Sep-2022 11:04                8357
function.pg-transaction-status.php                 30-Sep-2022 11:04                6697
function.pg-tty.php                                30-Sep-2022 11:04                6100
function.pg-unescape-bytea.php                     30-Sep-2022 11:04                7070
function.pg-untrace.php                            30-Sep-2022 11:04                6719
function.pg-update.php                             30-Sep-2022 11:04               10634
function.pg-version.php                            30-Sep-2022 11:04                6612
function.php-ini-loaded-file.php                   30-Sep-2022 11:04                4795
function.php-ini-scanned-files.php                 30-Sep-2022 11:04                7096
function.php-sapi-name.php                         30-Sep-2022 11:04                6084
function.php-strip-whitespace.php                  30-Sep-2022 11:05                4873
function.php-uname.php                             30-Sep-2022 11:04                9926
function.phpcredits.php                            30-Sep-2022 11:04                8151
function.phpdbg-break-file.php                     30-Sep-2022 11:04                3809
function.phpdbg-break-function.php                 30-Sep-2022 11:04                3593
function.phpdbg-break-method.php                   30-Sep-2022 11:04                3865
function.phpdbg-break-next.php                     30-Sep-2022 11:04                3292
function.phpdbg-clear.php                          30-Sep-2022 11:04                3596
function.phpdbg-color.php                          30-Sep-2022 11:04                3605
function.phpdbg-end-oplog.php                      30-Sep-2022 11:04                2468
function.phpdbg-exec.php                           30-Sep-2022 11:04                2899
function.phpdbg-get-executable.php                 30-Sep-2022 11:04                2467
function.phpdbg-prompt.php                         30-Sep-2022 11:04                2816
function.phpdbg-start-oplog.php                    30-Sep-2022 11:04                2278
function.phpinfo.php                               30-Sep-2022 11:04                9861
function.phpversion.php                            30-Sep-2022 11:04               10930
function.pi.php                                    30-Sep-2022 11:05                3087
function.png2wbmp.php                              30-Sep-2022 11:04                6428
function.popen.php                                 30-Sep-2022 11:04                8748
function.pos.php                                   30-Sep-2022 11:05                1593
function.posix-access.php                          30-Sep-2022 11:05                6420
function.posix-ctermid.php                         30-Sep-2022 11:05                4512
function.posix-errno.php                           30-Sep-2022 11:05                1754
function.posix-get-last-error.php                  30-Sep-2022 11:05                4227
function.posix-getcwd.php                          30-Sep-2022 11:05                4363
function.posix-getegid.php                         30-Sep-2022 11:05                5438
function.posix-geteuid.php                         30-Sep-2022 11:05                5416
function.posix-getgid.php                          30-Sep-2022 11:05                4798
function.posix-getgrgid.php                        30-Sep-2022 11:05                6334
function.posix-getgrnam.php                        30-Sep-2022 11:05                6174
function.posix-getgroups.php                       30-Sep-2022 11:05                4058
function.posix-getlogin.php                        30-Sep-2022 11:05                3575
function.posix-getpgid.php                         30-Sep-2022 11:05                4620
function.posix-getpgrp.php                         30-Sep-2022 11:05                2597
function.posix-getpid.php                          30-Sep-2022 11:05                3343
function.posix-getppid.php                         30-Sep-2022 11:05                2952
function.posix-getpwnam.php                        30-Sep-2022 11:05                6790
function.posix-getpwuid.php                        30-Sep-2022 11:05                6785
function.posix-getrlimit.php                       30-Sep-2022 11:05                7334
function.posix-getsid.php                          30-Sep-2022 11:05                4668
function.posix-getuid.php                          30-Sep-2022 11:05                3388
function.posix-initgroups.php                      30-Sep-2022 11:05                3128
function.posix-isatty.php                          30-Sep-2022 11:05                3559
function.posix-kill.php                            30-Sep-2022 11:05                3245
function.posix-mkfifo.php                          30-Sep-2022 11:05                3352
function.posix-mknod.php                           30-Sep-2022 11:05                7217
function.posix-setegid.php                         30-Sep-2022 11:05                5185
function.posix-seteuid.php                         30-Sep-2022 11:05                3518
function.posix-setgid.php                          30-Sep-2022 11:05                5382
function.posix-setpgid.php                         30-Sep-2022 11:05                3212
function.posix-setrlimit.php                       30-Sep-2022 11:05                4341
function.posix-setsid.php                          30-Sep-2022 11:05                2517
function.posix-setuid.php                          30-Sep-2022 11:05                5508
function.posix-strerror.php                        30-Sep-2022 11:05                5075
function.posix-times.php                           30-Sep-2022 11:05                4622
function.posix-ttyname.php                         30-Sep-2022 11:05                3207
function.posix-uname.php                           30-Sep-2022 11:05                4976
function.pow.php                                   30-Sep-2022 11:05                6878
function.preg-filter.php                           30-Sep-2022 11:05                9718
function.preg-grep.php                             30-Sep-2022 11:05                6186
function.preg-last-error-msg.php                   30-Sep-2022 11:05                4084
function.preg-last-error.php                       30-Sep-2022 11:05                4804
function.preg-match-all.php                        30-Sep-2022 11:05               26629
function.preg-match.php                            30-Sep-2022 11:05               24577
function.preg-quote.php                            30-Sep-2022 11:05                9070
function.preg-replace-callback-array.php           30-Sep-2022 11:05               10960
function.preg-replace-callback.php                 30-Sep-2022 11:05               18503
function.preg-replace.php                          30-Sep-2022 11:05               24781
function.preg-split.php                            30-Sep-2022 11:05               12919
function.prev.php                                  30-Sep-2022 11:05                8584
function.print-r.php                               30-Sep-2022 11:05                9245
function.print.php                                 30-Sep-2022 11:05               14482
function.printf.php                                30-Sep-2022 11:05               25778
function.proc-close.php                            30-Sep-2022 11:05                3568
function.proc-get-status.php                       30-Sep-2022 11:05                6223
function.proc-nice.php                             30-Sep-2022 11:05                7943
function.proc-open.php                             30-Sep-2022 11:05               23373
function.proc-terminate.php                        30-Sep-2022 11:05                4884
function.property-exists.php                       30-Sep-2022 11:05                8589
function.ps-add-bookmark.php                       30-Sep-2022 11:05                5035
function.ps-add-launchlink.php                     30-Sep-2022 11:05                5657
function.ps-add-locallink.php                      30-Sep-2022 11:05                6253
function.ps-add-note.php                           30-Sep-2022 11:05                7011
function.ps-add-pdflink.php                        30-Sep-2022 11:05                6392
function.ps-add-weblink.php                        30-Sep-2022 11:05                5553
function.ps-arc.php                                30-Sep-2022 11:05                5052
function.ps-arcn.php                               30-Sep-2022 11:05                5055
function.ps-begin-page.php                         30-Sep-2022 11:05                7108
function.ps-begin-pattern.php                      30-Sep-2022 11:05               13409
function.ps-begin-template.php                     30-Sep-2022 11:05               11616
function.ps-circle.php                             30-Sep-2022 11:05                4634
function.ps-clip.php                               30-Sep-2022 11:05                2972
function.ps-close-image.php                        30-Sep-2022 11:05                3821
function.ps-close.php                              30-Sep-2022 11:05                3655
function.ps-closepath-stroke.php                   30-Sep-2022 11:05                3016
function.ps-closepath.php                          30-Sep-2022 11:05                3197
function.ps-continue-text.php                      30-Sep-2022 11:05                4064
function.ps-curveto.php                            30-Sep-2022 11:05                4803
function.ps-delete.php                             30-Sep-2022 11:05                3552
function.ps-end-page.php                           30-Sep-2022 11:05                3238
function.ps-end-pattern.php                        30-Sep-2022 11:05                3154
function.ps-end-template.php                       30-Sep-2022 11:05                3142
function.ps-fill-stroke.php                        30-Sep-2022 11:05                3239
function.ps-fill.php                               30-Sep-2022 11:05                3171
function.ps-findfont.php                           30-Sep-2022 11:05                7408
function.ps-get-buffer.php                         30-Sep-2022 11:05                3262
function.ps-get-parameter.php                      30-Sep-2022 11:05                8081
function.ps-get-value.php                          30-Sep-2022 11:05                9900
function.ps-hyphenate.php                          30-Sep-2022 11:05                7281
function.ps-include-file.php                       30-Sep-2022 11:05                2997
function.ps-lineto.php                             30-Sep-2022 11:05                8244
function.ps-makespotcolor.php                      30-Sep-2022 11:05               10565
function.ps-moveto.php                             30-Sep-2022 11:05                3703
function.ps-new.php                                30-Sep-2022 11:05                2991
function.ps-open-file.php                          30-Sep-2022 11:05                3572
function.ps-open-image-file.php                    30-Sep-2022 11:05                4817
function.ps-open-image.php                         30-Sep-2022 11:05                6697
function.ps-open-memory-image.php                  30-Sep-2022 11:05                2754
function.ps-place-image.php                        30-Sep-2022 11:05                5028
function.ps-rect.php                               30-Sep-2022 11:05                4832
function.ps-restore.php                            30-Sep-2022 11:05                3365
function.ps-rotate.php                             30-Sep-2022 11:05               12567
function.ps-save.php                               30-Sep-2022 11:05                3114
function.ps-scale.php                              30-Sep-2022 11:05                3633
function.ps-set-border-color.php                   30-Sep-2022 11:05                4708
function.ps-set-border-dash.php                    30-Sep-2022 11:05                4356
function.ps-set-border-style.php                   30-Sep-2022 11:05                4395
function.ps-set-info.php                           30-Sep-2022 11:05                6140
function.ps-set-parameter.php                      30-Sep-2022 11:05                3843
function.ps-set-text-pos.php                       30-Sep-2022 11:05                9495
function.ps-set-value.php                          30-Sep-2022 11:05                4820
function.ps-setcolor.php                           30-Sep-2022 11:05                5715
function.ps-setdash.php                            30-Sep-2022 11:05                3481
function.ps-setflat.php                            30-Sep-2022 11:05                2965
function.ps-setfont.php                            30-Sep-2022 11:05                3932
function.ps-setgray.php                            30-Sep-2022 11:05                3173
function.ps-setlinecap.php                         30-Sep-2022 11:05                3771
function.ps-setlinejoin.php                        30-Sep-2022 11:05                3789
function.ps-setlinewidth.php                       30-Sep-2022 11:05                3658
function.ps-setmiterlimit.php                      30-Sep-2022 11:05                4205
function.ps-setoverprintmode.php                   30-Sep-2022 11:05                3038
function.ps-setpolydash.php                        30-Sep-2022 11:05                7901
function.ps-shading-pattern.php                    30-Sep-2022 11:05                4078
function.ps-shading.php                            30-Sep-2022 11:05                6580
function.ps-shfill.php                             30-Sep-2022 11:05                3858
function.ps-show-boxed.php                         30-Sep-2022 11:05               13094
function.ps-show-xy.php                            30-Sep-2022 11:05                4033
function.ps-show-xy2.php                           30-Sep-2022 11:05                2774
function.ps-show.php                               30-Sep-2022 11:05                5934
function.ps-show2.php                              30-Sep-2022 11:05                3136
function.ps-string-geometry.php                    30-Sep-2022 11:05                5101
function.ps-stringwidth.php                        30-Sep-2022 11:05                4465
function.ps-stroke.php                             30-Sep-2022 11:05                3384
function.ps-symbol-name.php                        30-Sep-2022 11:05                3865
function.ps-symbol-width.php                       30-Sep-2022 11:05                4391
function.ps-symbol.php                             30-Sep-2022 11:05                3676
function.ps-translate.php                          30-Sep-2022 11:05               14623
function.pspell-add-to-personal.php                30-Sep-2022 11:04                6361
function.pspell-add-to-session.php                 30-Sep-2022 11:04                3953
function.pspell-check.php                          30-Sep-2022 11:04                4976
function.pspell-clear-session.php                  30-Sep-2022 11:04                5848
function.pspell-config-create.php                  30-Sep-2022 11:04                8453
function.pspell-config-data-dir.php                30-Sep-2022 11:04                3256
function.pspell-config-dict-dir.php                30-Sep-2022 11:04                3245
function.pspell-config-ignore.php                  30-Sep-2022 11:04                5689
function.pspell-config-mode.php                    30-Sep-2022 11:04                6305
function.pspell-config-personal.php                30-Sep-2022 11:04                6508
function.pspell-config-repl.php                    30-Sep-2022 11:04                6854
function.pspell-config-runtogether.php             30-Sep-2022 11:04                6216
function.pspell-config-save-repl.php               30-Sep-2022 11:04                5135
function.pspell-new-config.php                     30-Sep-2022 11:04                6470
function.pspell-new-personal.php                   30-Sep-2022 11:04               10774
function.pspell-new.php                            30-Sep-2022 11:04                9191
function.pspell-save-wordlist.php                  30-Sep-2022 11:04                6002
function.pspell-store-replacement.php              30-Sep-2022 11:04                7613
function.pspell-suggest.php                        30-Sep-2022 11:04                5728
function.putenv.php                                30-Sep-2022 11:04                3972
function.quoted-printable-decode.php               30-Sep-2022 11:05                5348
function.quoted-printable-encode.php               30-Sep-2022 11:05                5138
function.quotemeta.php                             30-Sep-2022 11:05                6010
function.rad2deg.php                               30-Sep-2022 11:05                3464
function.radius-acct-open.php                      30-Sep-2022 11:04                3280
function.radius-add-server.php                     30-Sep-2022 11:04                7629
function.radius-auth-open.php                      30-Sep-2022 11:04                3295
function.radius-close.php                          30-Sep-2022 11:04                2501
function.radius-config.php                         30-Sep-2022 11:04                3926
function.radius-create-request.php                 30-Sep-2022 11:04                5139
function.radius-cvt-addr.php                       30-Sep-2022 11:04                6896
function.radius-cvt-int.php                        30-Sep-2022 11:04                6136
function.radius-cvt-string.php                     30-Sep-2022 11:04                6196
function.radius-demangle-mppe-key.php              30-Sep-2022 11:04                3063
function.radius-demangle.php                       30-Sep-2022 11:04                2839
function.radius-get-attr.php                       30-Sep-2022 11:04                6996
function.radius-get-tagged-attr-data.php           30-Sep-2022 11:04                6863
function.radius-get-tagged-attr-tag.php            30-Sep-2022 11:04                6901
function.radius-get-vendor-attr.php                30-Sep-2022 11:04                8970
function.radius-put-addr.php                       30-Sep-2022 11:04                5037
function.radius-put-attr.php                       30-Sep-2022 11:04                8518
function.radius-put-int.php                        30-Sep-2022 11:04                7250
function.radius-put-string.php                     30-Sep-2022 11:04                7722
function.radius-put-vendor-addr.php                30-Sep-2022 11:04                5056
function.radius-put-vendor-attr.php                30-Sep-2022 11:04                7479
function.radius-put-vendor-int.php                 30-Sep-2022 11:04                5485
function.radius-put-vendor-string.php              30-Sep-2022 11:04                5984
function.radius-request-authenticator.php          30-Sep-2022 11:04                3100
function.radius-salt-encrypt-attr.php              30-Sep-2022 11:04                4102
function.radius-send-request.php                   30-Sep-2022 11:04                3716
function.radius-server-secret.php                  30-Sep-2022 11:04                2582
function.radius-strerror.php                       30-Sep-2022 11:04                2536
function.rand.php                                  30-Sep-2022 11:05               10430
function.random-bytes.php                          30-Sep-2022 11:04                8292
function.random-int.php                            30-Sep-2022 11:04                8205
function.range.php                                 30-Sep-2022 11:05                8399
function.rar-wrapper-cache-stats.php               30-Sep-2022 11:04                2321
function.rawurldecode.php                          30-Sep-2022 11:05                4911
function.rawurlencode.php                          30-Sep-2022 11:05                6366
function.read-exif-data.php                        30-Sep-2022 11:04                2476
function.readdir.php                               30-Sep-2022 11:04               11003
function.readfile.php                              30-Sep-2022 11:04               10156
function.readgzfile.php                            30-Sep-2022 11:04                4520
function.readline-add-history.php                  30-Sep-2022 11:04                2581
function.readline-callback-handler-install.php     30-Sep-2022 11:04               10079
function.readline-callback-handler-remove.php      30-Sep-2022 11:04                3787
function.readline-callback-read-char.php           30-Sep-2022 11:04                3859
function.readline-clear-history.php                30-Sep-2022 11:04                2347
function.readline-completion-function.php          30-Sep-2022 11:04                2939
function.readline-info.php                         30-Sep-2022 11:04                4740
function.readline-list-history.php                 30-Sep-2022 11:04                2339
function.readline-on-new-line.php                  30-Sep-2022 11:04                2711
function.readline-read-history.php                 30-Sep-2022 11:04                3268
function.readline-redisplay.php                    30-Sep-2022 11:04                2262
function.readline-write-history.php                30-Sep-2022 11:04                3220
function.readline.php                              30-Sep-2022 11:04                5353
function.readlink.php                              30-Sep-2022 11:04                4487
function.realpath-cache-get.php                    30-Sep-2022 11:04                4256
function.realpath-cache-size.php                   30-Sep-2022 11:04                3753
function.realpath.php                              30-Sep-2022 11:04                8690
function.recode-file.php                           30-Sep-2022 11:04                5433
function.recode-string.php                         30-Sep-2022 11:04                4958
function.recode.php                                30-Sep-2022 11:04                1705
function.register-shutdown-function.php            30-Sep-2022 11:05                8792
function.register-tick-function.php                30-Sep-2022 11:05                5616
function.rename.php                                30-Sep-2022 11:04                5737
function.require-once.php                          30-Sep-2022 11:04                1849
function.require.php                               30-Sep-2022 11:04                1958
function.reset.php                                 30-Sep-2022 11:05                9150
function.restore-error-handler.php                 30-Sep-2022 11:04                5972
function.restore-exception-handler.php             30-Sep-2022 11:04                7162
function.restore-include-path.php                  30-Sep-2022 11:04                5518
function.return.php                                30-Sep-2022 11:04                4307
function.rewind.php                                30-Sep-2022 11:04                6289
function.rewinddir.php                             30-Sep-2022 11:04                3462
function.rmdir.php                                 30-Sep-2022 11:04                4997
function.round.php                                 30-Sep-2022 11:05               21337
function.rpmaddtag.php                             30-Sep-2022 11:05                3147
function.rpmdbinfo.php                             30-Sep-2022 11:05                4708
function.rpmdbsearch.php                           30-Sep-2022 11:05                5493
function.rpminfo.php                               30-Sep-2022 11:05                4892
function.rpmvercmp.php                             30-Sep-2022 11:05                2552
function.rrd-create.php                            30-Sep-2022 11:05                2766
function.rrd-error.php                             30-Sep-2022 11:05                2078
function.rrd-fetch.php                             30-Sep-2022 11:05                2948
function.rrd-first.php                             30-Sep-2022 11:05                2719
function.rrd-graph.php                             30-Sep-2022 11:05                3040
function.rrd-info.php                              30-Sep-2022 11:05                2373
function.rrd-last.php                              30-Sep-2022 11:05                2372
function.rrd-lastupdate.php                        30-Sep-2022 11:05                2540
function.rrd-restore.php                           30-Sep-2022 11:05                3116
function.rrd-tune.php                              30-Sep-2022 11:05                2914
function.rrd-update.php                            30-Sep-2022 11:05                2968
function.rrd-version.php                           30-Sep-2022 11:05                2253
function.rrd-xport.php                             30-Sep-2022 11:05                2662
function.rrdc-disconnect.php                       30-Sep-2022 11:05                2591
function.rsort.php                                 30-Sep-2022 11:05                8177
function.rtrim.php                                 30-Sep-2022 11:05                9944
function.runkit7-constant-add.php                  30-Sep-2022 11:04                4237
function.runkit7-constant-redefine.php             30-Sep-2022 11:04                4109
function.runkit7-constant-remove.php               30-Sep-2022 11:04                3453
function.runkit7-function-add.php                  30-Sep-2022 11:04                8829
function.runkit7-function-copy.php                 30-Sep-2022 11:04                5289
function.runkit7-function-redefine.php             30-Sep-2022 11:04                9327
function.runkit7-function-remove.php               30-Sep-2022 11:04                4013
function.runkit7-function-rename.php               30-Sep-2022 11:04                4234
function.runkit7-import.php                        30-Sep-2022 11:04                3571
function.runkit7-method-add.php                    30-Sep-2022 11:04               10736
function.runkit7-method-copy.php                   30-Sep-2022 11:04                7053
function.runkit7-method-redefine.php               30-Sep-2022 11:04               11202
function.runkit7-method-remove.php                 30-Sep-2022 11:04                6502
function.runkit7-method-rename.php                 30-Sep-2022 11:04                6553
function.runkit7-object-id.php                     30-Sep-2022 11:04                3635
function.runkit7-superglobals.php                  30-Sep-2022 11:04                2564
function.runkit7-zval-inspect.php                  30-Sep-2022 11:04                5054
function.sapi-windows-cp-conv.php                  30-Sep-2022 11:05                4308
function.sapi-windows-cp-get.php                   30-Sep-2022 11:05                3326
function.sapi-windows-cp-is-utf8.php               30-Sep-2022 11:05                2670
function.sapi-windows-cp-set.php                   30-Sep-2022 11:05                2860
function.sapi-windows-generate-ctrl-event.php      30-Sep-2022 11:05                7721
function.sapi-windows-set-ctrl-handler.php         30-Sep-2022 11:05                7438
function.sapi-windows-vt100-support.php            30-Sep-2022 11:05                9949
function.scandir.php                               30-Sep-2022 11:04                8514
function.scoutapm-get-calls.php                    30-Sep-2022 11:05                4368
function.scoutapm-list-instrumented-functions.php  30-Sep-2022 11:05                3705
function.seaslog-get-author.php                    30-Sep-2022 11:05                3023
function.seaslog-get-version.php                   30-Sep-2022 11:05                3021
function.sem-acquire.php                           30-Sep-2022 11:05                4999
function.sem-get.php                               30-Sep-2022 11:05                6931
function.sem-release.php                           30-Sep-2022 11:05                4231
function.sem-remove.php                            30-Sep-2022 11:05                4176
function.serialize.php                             30-Sep-2022 11:05               11680
function.session-abort.php                         30-Sep-2022 11:05                4155
function.session-cache-expire.php                  30-Sep-2022 11:05                7676
function.session-cache-limiter.php                 30-Sep-2022 11:05                8957
function.session-commit.php                        30-Sep-2022 11:05                1789
function.session-create-id.php                     30-Sep-2022 11:05               11693
function.session-decode.php                        30-Sep-2022 11:05                3615
function.session-destroy.php                       30-Sep-2022 11:05               10310
function.session-encode.php                        30-Sep-2022 11:05                3906
function.session-gc.php                            30-Sep-2022 11:05                8914
function.session-get-cookie-params.php             30-Sep-2022 11:05                5743
function.session-id.php                            30-Sep-2022 11:05                6150
function.session-module-name.php                   30-Sep-2022 11:05                4151
function.session-name.php                          30-Sep-2022 11:05                7781
function.session-regenerate-id.php                 30-Sep-2022 11:05               19279
function.session-register-shutdown.php             30-Sep-2022 11:05                2731
function.session-reset.php                         30-Sep-2022 11:05                4265
function.session-save-path.php                     30-Sep-2022 11:05                4506
function.session-set-cookie-params.php             30-Sep-2022 11:05               10235
function.session-set-save-handler.php              30-Sep-2022 11:05               23771
function.session-start.php                         30-Sep-2022 11:05               15355
function.session-status.php                        30-Sep-2022 11:05                3123
function.session-unset.php                         30-Sep-2022 11:05                4408
function.session-write-close.php                   30-Sep-2022 11:05                4123
function.set-error-handler.php                     30-Sep-2022 11:04               28863
function.set-exception-handler.php                 30-Sep-2022 11:04                7152
function.set-file-buffer.php                       30-Sep-2022 11:04                1778
function.set-include-path.php                      30-Sep-2022 11:04                6284
function.set-time-limit.php                        30-Sep-2022 11:04                4718
function.setcookie.php                             30-Sep-2022 11:05               26785
function.setlocale.php                             30-Sep-2022 11:05               15740
function.setrawcookie.php                          30-Sep-2022 11:05                5510
function.settype.php                               30-Sep-2022 11:05                6577
function.sha1-file.php                             30-Sep-2022 11:05                5681
function.sha1.php                                  30-Sep-2022 11:05                6147
function.shell-exec.php                            30-Sep-2022 11:05                5689
function.shm-attach.php                            30-Sep-2022 11:05                5700
function.shm-detach.php                            30-Sep-2022 11:05                4485
function.shm-get-var.php                           30-Sep-2022 11:05                4487
function.shm-has-var.php                           30-Sep-2022 11:05                4187
function.shm-put-var.php                           30-Sep-2022 11:05                5389
function.shm-remove-var.php                        30-Sep-2022 11:05                4105
function.shm-remove.php                            30-Sep-2022 11:05                3871
function.shmop-close.php                           30-Sep-2022 11:05                4964
function.shmop-delete.php                          30-Sep-2022 11:05                4116
function.shmop-open.php                            30-Sep-2022 11:05                8816
function.shmop-read.php                            30-Sep-2022 11:05                5362
function.shmop-size.php                            30-Sep-2022 11:05                4295
function.shmop-write.php                           30-Sep-2022 11:05                5586
function.show-source.php                           30-Sep-2022 11:05                1714
function.shuffle.php                               30-Sep-2022 11:05                5897
function.similar-text.php                          30-Sep-2022 11:05                7540
function.simplexml-import-dom.php                  30-Sep-2022 11:05                6849
function.simplexml-load-file.php                   30-Sep-2022 11:05               10104
function.simplexml-load-string.php                 30-Sep-2022 11:05                9651
function.sin.php                                   30-Sep-2022 11:05                4596
function.sinh.php                                  30-Sep-2022 11:05                3112
function.sizeof.php                                30-Sep-2022 11:05                1613
function.sleep.php                                 30-Sep-2022 11:05                7381
function.snmp-get-quick-print.php                  30-Sep-2022 11:05                3713
function.snmp-get-valueretrieval.php               30-Sep-2022 11:05                4483
function.snmp-read-mib.php                         30-Sep-2022 11:05                4772
function.snmp-set-enum-print.php                   30-Sep-2022 11:05                4716
function.snmp-set-oid-numeric-print.php            30-Sep-2022 11:05                2312
function.snmp-set-oid-output-format.php            30-Sep-2022 11:05                6713
function.snmp-set-quick-print.php                  30-Sep-2022 11:05                6696
function.snmp-set-valueretrieval.php               30-Sep-2022 11:05                9393
function.snmp2-get.php                             30-Sep-2022 11:05                5627
function.snmp2-getnext.php                         30-Sep-2022 11:05                6119
function.snmp2-real-walk.php                       30-Sep-2022 11:05                6411
function.snmp2-set.php                             30-Sep-2022 11:05               11007
function.snmp2-walk.php                            30-Sep-2022 11:05                6835
function.snmp3-get.php                             30-Sep-2022 11:05                8581
function.snmp3-getnext.php                         30-Sep-2022 11:05                9017
function.snmp3-real-walk.php                       30-Sep-2022 11:05                9417
function.snmp3-set.php                             30-Sep-2022 11:05               13626
function.snmp3-walk.php                            30-Sep-2022 11:05                9946
function.snmpget.php                               30-Sep-2022 11:05                5537
function.snmpgetnext.php                           30-Sep-2022 11:05                5965
function.snmprealwalk.php                          30-Sep-2022 11:05                6237
function.snmpset.php                               30-Sep-2022 11:05               10969
function.snmpwalk.php                              30-Sep-2022 11:05                6785
function.snmpwalkoid.php                           30-Sep-2022 11:05                7537
function.socket-accept.php                         30-Sep-2022 11:05                6975
function.socket-addrinfo-bind.php                  30-Sep-2022 11:05                5281
function.socket-addrinfo-connect.php               30-Sep-2022 11:05                5076
function.socket-addrinfo-explain.php               30-Sep-2022 11:05                4400
function.socket-addrinfo-lookup.php                30-Sep-2022 11:05                5560
function.socket-bind.php                           30-Sep-2022 11:05               11159
function.socket-clear-error.php                    30-Sep-2022 11:05                4681
function.socket-close.php                          30-Sep-2022 11:05                4577
function.socket-cmsg-space.php                     30-Sep-2022 11:05                3514
function.socket-connect.php                        30-Sep-2022 11:05                7293
function.socket-create-listen.php                  30-Sep-2022 11:05                7292
function.socket-create-pair.php                    30-Sep-2022 11:05               21168
function.socket-create.php                         30-Sep-2022 11:05               13219
function.socket-export-stream.php                  30-Sep-2022 11:05                3349
function.socket-get-option.php                     30-Sep-2022 11:05               25588
function.socket-get-status.php                     30-Sep-2022 11:05                1794
function.socket-getopt.php                         30-Sep-2022 11:05                1777
function.socket-getpeername.php                    30-Sep-2022 11:05                7764
function.socket-getsockname.php                    30-Sep-2022 11:05                6910
function.socket-import-stream.php                  30-Sep-2022 11:05                5047
function.socket-last-error.php                     30-Sep-2022 11:05                7339
function.socket-listen.php                         30-Sep-2022 11:05                7194
function.socket-read.php                           30-Sep-2022 11:05                7877
function.socket-recv.php                           30-Sep-2022 11:05               16942
function.socket-recvfrom.php                       30-Sep-2022 11:05               13252
function.socket-recvmsg.php                        30-Sep-2022 11:05                4227
function.socket-select.php                         30-Sep-2022 11:05               16109
function.socket-send.php                           30-Sep-2022 11:05                6437
function.socket-sendmsg.php                        30-Sep-2022 11:05                4318
function.socket-sendto.php                         30-Sep-2022 11:05                9588
function.socket-set-block.php                      30-Sep-2022 11:05                6088
function.socket-set-blocking.php                   30-Sep-2022 11:05                1814
function.socket-set-nonblock.php                   30-Sep-2022 11:05                6398
function.socket-set-option.php                     30-Sep-2022 11:05               11648
function.socket-set-timeout.php                    30-Sep-2022 11:05                1782
function.socket-setopt.php                         30-Sep-2022 11:05                1771
function.socket-shutdown.php                       30-Sep-2022 11:05                4833
function.socket-strerror.php                       30-Sep-2022 11:05                7418
function.socket-write.php                          30-Sep-2022 11:05                7405
function.socket-wsaprotocol-info-export.php        30-Sep-2022 11:05                4849
function.socket-wsaprotocol-info-import.php        30-Sep-2022 11:05                4256
function.socket-wsaprotocol-info-release.php       30-Sep-2022 11:05                3440
function.sodium-add.php                            30-Sep-2022 11:04                3033
function.sodium-base642bin.php                     30-Sep-2022 11:04                4213
function.sodium-bin2base64.php                     30-Sep-2022 11:04                3859
function.sodium-bin2hex.php                        30-Sep-2022 11:04                2550
function.sodium-compare.php                        30-Sep-2022 11:04                3023
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-Sep-2022 11:04                4257
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-Sep-2022 11:04                4038
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-Sep-2022 11:04                2654
function.sodium-crypto-aead-aes256gcm-keygen.php   30-Sep-2022 11:04                2746
function.sodium-crypto-aead-chacha20poly1305-de..> 30-Sep-2022 11:04                4173
function.sodium-crypto-aead-chacha20poly1305-en..> 30-Sep-2022 11:04                3918
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:04                4403
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:04                4084
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:04                2940
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-Sep-2022 11:04                2875
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:04                4581
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:04                4302
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:04                2916
function.sodium-crypto-auth-keygen.php             30-Sep-2022 11:04                2567
function.sodium-crypto-auth-verify.php             30-Sep-2022 11:04                3547
function.sodium-crypto-auth.php                    30-Sep-2022 11:04                3150
function.sodium-crypto-box-keypair-from-secretk..> 30-Sep-2022 11:04                3229
function.sodium-crypto-box-keypair.php             30-Sep-2022 11:04                2848
function.sodium-crypto-box-open.php                30-Sep-2022 11:04                3664
function.sodium-crypto-box-publickey-from-secre..> 30-Sep-2022 11:04                3116
function.sodium-crypto-box-publickey.php           30-Sep-2022 11:04                2829
function.sodium-crypto-box-seal-open.php           30-Sep-2022 11:04                5918
function.sodium-crypto-box-seal.php                30-Sep-2022 11:04                7092
function.sodium-crypto-box-secretkey.php           30-Sep-2022 11:04                2796
function.sodium-crypto-box-seed-keypair.php        30-Sep-2022 11:04                2855
function.sodium-crypto-box.php                     30-Sep-2022 11:04                3963
function.sodium-crypto-core-ristretto255-add.php   30-Sep-2022 11:04                6002
function.sodium-crypto-core-ristretto255-from-h..> 30-Sep-2022 11:04                5433
function.sodium-crypto-core-ristretto255-is-val..> 30-Sep-2022 11:04                5464
function.sodium-crypto-core-ristretto255-random..> 30-Sep-2022 11:04                5630
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:04                6270
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:04                3513
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:04                5383
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:04                3716
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:04                5367
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:04                5790
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:04                3457
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:04                6261
function.sodium-crypto-core-ristretto255-sub.php   30-Sep-2022 11:04                6039
function.sodium-crypto-generichash-final.php       30-Sep-2022 11:04                6735
function.sodium-crypto-generichash-init.php        30-Sep-2022 11:04                6684
function.sodium-crypto-generichash-keygen.php      30-Sep-2022 11:04                2377
function.sodium-crypto-generichash-update.php      30-Sep-2022 11:04                6521
function.sodium-crypto-generichash.php             30-Sep-2022 11:04                3425
function.sodium-crypto-kdf-derive-from-key.php     30-Sep-2022 11:04                3658
function.sodium-crypto-kdf-keygen.php              30-Sep-2022 11:04                2479
function.sodium-crypto-kx-client-session-keys.php  30-Sep-2022 11:04                3184
function.sodium-crypto-kx-keypair.php              30-Sep-2022 11:04                4984
function.sodium-crypto-kx-publickey.php            30-Sep-2022 11:04                2648
function.sodium-crypto-kx-secretkey.php            30-Sep-2022 11:04                2659
function.sodium-crypto-kx-seed-keypair.php         30-Sep-2022 11:04                2617
function.sodium-crypto-kx-server-session-keys.php  30-Sep-2022 11:04                3250
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:04                3167
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:04                3317
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:04                5566
function.sodium-crypto-pwhash-str-needs-rehash.php 30-Sep-2022 11:04                3668
function.sodium-crypto-pwhash-str-verify.php       30-Sep-2022 11:04                4595
function.sodium-crypto-pwhash-str.php              30-Sep-2022 11:04                7988
function.sodium-crypto-pwhash.php                  30-Sep-2022 11:04                9430
function.sodium-crypto-scalarmult-base.php         30-Sep-2022 11:04                2015
function.sodium-crypto-scalarmult-ristretto255-..> 30-Sep-2022 11:04                3426
function.sodium-crypto-scalarmult-ristretto255.php 30-Sep-2022 11:04                3719
function.sodium-crypto-scalarmult.php              30-Sep-2022 11:04                2871
function.sodium-crypto-secretbox-keygen.php        30-Sep-2022 11:04                6356
function.sodium-crypto-secretbox-open.php          30-Sep-2022 11:04                8644
function.sodium-crypto-secretbox.php               30-Sep-2022 11:04                8570
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:04               11649
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:04               10801
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:04                2643
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:04                5506
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:04                5605
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:04                2884
function.sodium-crypto-shorthash-keygen.php        30-Sep-2022 11:04                2647
function.sodium-crypto-shorthash.php               30-Sep-2022 11:04                2983
function.sodium-crypto-sign-detached.php           30-Sep-2022 11:04                2976
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-Sep-2022 11:04                2816
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-Sep-2022 11:04                2872
function.sodium-crypto-sign-keypair-from-secret..> 30-Sep-2022 11:04                3055
function.sodium-crypto-sign-keypair.php            30-Sep-2022 11:04                2365
function.sodium-crypto-sign-open.php               30-Sep-2022 11:04                3086
function.sodium-crypto-sign-publickey-from-secr..> 30-Sep-2022 11:04                2674
function.sodium-crypto-sign-publickey.php          30-Sep-2022 11:04                2684
function.sodium-crypto-sign-secretkey.php          30-Sep-2022 11:04                2660
function.sodium-crypto-sign-seed-keypair.php       30-Sep-2022 11:04                2893
function.sodium-crypto-sign-verify-detached.php    30-Sep-2022 11:04                3324
function.sodium-crypto-sign.php                    30-Sep-2022 11:04                3054
function.sodium-crypto-stream-keygen.php           30-Sep-2022 11:04                2548
function.sodium-crypto-stream-xchacha20-keygen.php 30-Sep-2022 11:04                2706
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-Sep-2022 11:04                9468
function.sodium-crypto-stream-xchacha20-xor.php    30-Sep-2022 11:04                4459
function.sodium-crypto-stream-xchacha20.php        30-Sep-2022 11:04                3456
function.sodium-crypto-stream-xor.php              30-Sep-2022 11:04                3240
function.sodium-crypto-stream.php                  30-Sep-2022 11:04                3175
function.sodium-hex2bin.php                        30-Sep-2022 11:04                3102
function.sodium-increment.php                      30-Sep-2022 11:04                2424
function.sodium-memcmp.php                         30-Sep-2022 11:04                3210
function.sodium-memzero.php                        30-Sep-2022 11:04                2419
function.sodium-pad.php                            30-Sep-2022 11:04                2553
function.sodium-unpad.php                          30-Sep-2022 11:04                2508
function.solr-get-version.php                      30-Sep-2022 11:05                4071
function.sort.php                                  30-Sep-2022 11:05               11603
function.soundex.php                               30-Sep-2022 11:05                7661
function.spl-autoload-call.php                     30-Sep-2022 11:05                2610
function.spl-autoload-extensions.php               30-Sep-2022 11:05                4914
function.spl-autoload-functions.php                30-Sep-2022 11:05                2579
function.spl-autoload-register.php                 30-Sep-2022 11:05               11127
function.spl-autoload-unregister.php               30-Sep-2022 11:05                2944
function.spl-autoload.php                          30-Sep-2022 11:05                4453
function.spl-classes.php                           30-Sep-2022 11:05                3782
function.spl-object-hash.php                       30-Sep-2022 11:05                4744
function.spl-object-id.php                         30-Sep-2022 11:05                4150
function.sprintf.php                               30-Sep-2022 11:05               26982
function.sqlsrv-begin-transaction.php              30-Sep-2022 11:04               12336
function.sqlsrv-cancel.php                         30-Sep-2022 11:04               11013
function.sqlsrv-client-info.php                    30-Sep-2022 11:04                7065
function.sqlsrv-close.php                          30-Sep-2022 11:04                5634
function.sqlsrv-commit.php                         30-Sep-2022 11:04               12092
function.sqlsrv-configure.php                      30-Sep-2022 11:04                4828
function.sqlsrv-connect.php                        30-Sep-2022 11:04               13261
function.sqlsrv-errors.php                         30-Sep-2022 11:04               11014
function.sqlsrv-execute.php                        30-Sep-2022 11:04               11237
function.sqlsrv-fetch-array.php                    30-Sep-2022 11:04               15800
function.sqlsrv-fetch-object.php                   30-Sep-2022 11:04               13266
function.sqlsrv-fetch.php                          30-Sep-2022 11:04               11774
function.sqlsrv-field-metadata.php                 30-Sep-2022 11:04                9413
function.sqlsrv-free-stmt.php                      30-Sep-2022 11:04                8044
function.sqlsrv-get-config.php                     30-Sep-2022 11:04                3318
function.sqlsrv-get-field.php                      30-Sep-2022 11:04               11317
function.sqlsrv-has-rows.php                       30-Sep-2022 11:04                6601
function.sqlsrv-next-result.php                    30-Sep-2022 11:04                9958
function.sqlsrv-num-fields.php                     30-Sep-2022 11:04                8816
function.sqlsrv-num-rows.php                       30-Sep-2022 11:04                8417
function.sqlsrv-prepare.php                        30-Sep-2022 11:04               15774
function.sqlsrv-query.php                          30-Sep-2022 11:04               12206
function.sqlsrv-rollback.php                       30-Sep-2022 11:04               11550
function.sqlsrv-rows-affected.php                  30-Sep-2022 11:04                8363
function.sqlsrv-send-stream-data.php               30-Sep-2022 11:04                9209
function.sqlsrv-server-info.php                    30-Sep-2022 11:04                6403
function.sqrt.php                                  30-Sep-2022 11:05                4349
function.srand.php                                 30-Sep-2022 11:05                6784
function.sscanf.php                                30-Sep-2022 11:05               12314
function.ssdeep-fuzzy-compare.php                  30-Sep-2022 11:05                3168
function.ssdeep-fuzzy-hash-filename.php            30-Sep-2022 11:05                2977
function.ssdeep-fuzzy-hash.php                     30-Sep-2022 11:05                2951
function.ssh2-auth-agent.php                       30-Sep-2022 11:05                4663
function.ssh2-auth-hostbased-file.php              30-Sep-2022 11:05                7942
function.ssh2-auth-none.php                        30-Sep-2022 11:05                4967
function.ssh2-auth-password.php                    30-Sep-2022 11:05                4900
function.ssh2-auth-pubkey-file.php                 30-Sep-2022 11:05                7438
function.ssh2-connect.php                          30-Sep-2022 11:05               16974
function.ssh2-disconnect.php                       30-Sep-2022 11:05                2927
function.ssh2-exec.php                             30-Sep-2022 11:05                7125
function.ssh2-fetch-stream.php                     30-Sep-2022 11:05                5461
function.ssh2-fingerprint.php                      30-Sep-2022 11:05                5435
function.ssh2-forward-accept.php                   30-Sep-2022 11:05                2884
function.ssh2-forward-listen.php                   30-Sep-2022 11:05                4178
function.ssh2-methods-negotiated.php               30-Sep-2022 11:05                8252
function.ssh2-poll.php                             30-Sep-2022 11:05                3399
function.ssh2-publickey-add.php                    30-Sep-2022 11:05                8379
function.ssh2-publickey-init.php                   30-Sep-2022 11:05                4679
function.ssh2-publickey-list.php                   30-Sep-2022 11:05                9268
function.ssh2-publickey-remove.php                 30-Sep-2022 11:05                4641
function.ssh2-scp-recv.php                         30-Sep-2022 11:05                5261
function.ssh2-scp-send.php                         30-Sep-2022 11:05                5818
function.ssh2-send-eof.php                         30-Sep-2022 11:05                3276
function.ssh2-sftp-chmod.php                       30-Sep-2022 11:05                5892
function.ssh2-sftp-lstat.php                       30-Sep-2022 11:05                7418
function.ssh2-sftp-mkdir.php                       30-Sep-2022 11:05                6483
function.ssh2-sftp-readlink.php                    30-Sep-2022 11:05                5345
function.ssh2-sftp-realpath.php                    30-Sep-2022 11:05                5683
function.ssh2-sftp-rename.php                      30-Sep-2022 11:05                5282
function.ssh2-sftp-rmdir.php                       30-Sep-2022 11:05                5473
function.ssh2-sftp-stat.php                        30-Sep-2022 11:05                7344
function.ssh2-sftp-symlink.php                     30-Sep-2022 11:05                5488
function.ssh2-sftp-unlink.php                      30-Sep-2022 11:05                4889
function.ssh2-sftp.php                             30-Sep-2022 11:05                5469
function.ssh2-shell.php                            30-Sep-2022 11:05                7595
function.ssh2-tunnel.php                           30-Sep-2022 11:05                5187
function.stat.php                                  30-Sep-2022 11:04               18016
function.stats-absolute-deviation.php              30-Sep-2022 11:05                2654
function.stats-cdf-beta.php                        30-Sep-2022 11:05                4908
function.stats-cdf-binomial.php                    30-Sep-2022 11:05                4893
function.stats-cdf-cauchy.php                      30-Sep-2022 11:05                4928
function.stats-cdf-chisquare.php                   30-Sep-2022 11:05                4301
function.stats-cdf-exponential.php                 30-Sep-2022 11:05                4332
function.stats-cdf-f.php                           30-Sep-2022 11:05                4833
function.stats-cdf-gamma.php                       30-Sep-2022 11:05                4892
function.stats-cdf-laplace.php                     30-Sep-2022 11:05                4913
function.stats-cdf-logistic.php                    30-Sep-2022 11:05                4948
function.stats-cdf-negative-binomial.php           30-Sep-2022 11:05                5036
function.stats-cdf-noncentral-chisquare.php        30-Sep-2022 11:05                5138
function.stats-cdf-noncentral-f.php                30-Sep-2022 11:05                5658
function.stats-cdf-noncentral-t.php                30-Sep-2022 11:05                4998
function.stats-cdf-normal.php                      30-Sep-2022 11:05                4930
function.stats-cdf-poisson.php                     30-Sep-2022 11:05                4266
function.stats-cdf-t.php                           30-Sep-2022 11:05                4194
function.stats-cdf-uniform.php                     30-Sep-2022 11:05                4893
function.stats-cdf-weibull.php                     30-Sep-2022 11:05                4930
function.stats-covariance.php                      30-Sep-2022 11:05                2797
function.stats-dens-beta.php                       30-Sep-2022 11:05                3229
function.stats-dens-cauchy.php                     30-Sep-2022 11:05                3287
function.stats-dens-chisquare.php                  30-Sep-2022 11:05                3011
function.stats-dens-exponential.php                30-Sep-2022 11:05                3001
function.stats-dens-f.php                          30-Sep-2022 11:05                3227
function.stats-dens-gamma.php                      30-Sep-2022 11:05                3280
function.stats-dens-laplace.php                    30-Sep-2022 11:05                3314
function.stats-dens-logistic.php                   30-Sep-2022 11:05                3326
function.stats-dens-normal.php                     30-Sep-2022 11:05                3297
function.stats-dens-pmf-binomial.php               30-Sep-2022 11:05                3351
function.stats-dens-pmf-hypergeometric.php         30-Sep-2022 11:05                3949
function.stats-dens-pmf-negative-binomial.php      30-Sep-2022 11:05                3480
function.stats-dens-pmf-poisson.php                30-Sep-2022 11:05                3002
function.stats-dens-t.php                          30-Sep-2022 11:05                2915
function.stats-dens-uniform.php                    30-Sep-2022 11:05                3262
function.stats-dens-weibull.php                    30-Sep-2022 11:05                3294
function.stats-harmonic-mean.php                   30-Sep-2022 11:05                2641
function.stats-kurtosis.php                        30-Sep-2022 11:05                2558
function.stats-rand-gen-beta.php                   30-Sep-2022 11:05                2862
function.stats-rand-gen-chisquare.php              30-Sep-2022 11:05                2589
function.stats-rand-gen-exponential.php            30-Sep-2022 11:05                2587
function.stats-rand-gen-f.php                      30-Sep-2022 11:05                2916
function.stats-rand-gen-funiform.php               30-Sep-2022 11:05                2843
function.stats-rand-gen-gamma.php                  30-Sep-2022 11:05                2929
function.stats-rand-gen-ibinomial-negative.php     30-Sep-2022 11:05                3009
function.stats-rand-gen-ibinomial.php              30-Sep-2022 11:05                2933
function.stats-rand-gen-int.php                    30-Sep-2022 11:05                2220
function.stats-rand-gen-ipoisson.php               30-Sep-2022 11:05                2562
function.stats-rand-gen-iuniform.php               30-Sep-2022 11:05                2910
function.stats-rand-gen-noncentral-chisquare.php   30-Sep-2022 11:05                3051
function.stats-rand-gen-noncentral-f.php           30-Sep-2022 11:05                3350
function.stats-rand-gen-noncentral-t.php           30-Sep-2022 11:05                2964
function.stats-rand-gen-normal.php                 30-Sep-2022 11:05                2877
function.stats-rand-gen-t.php                      30-Sep-2022 11:05                2481
function.stats-rand-get-seeds.php                  30-Sep-2022 11:05                2263
function.stats-rand-phrase-to-seeds.php            30-Sep-2022 11:05                2568
function.stats-rand-ranf.php                       30-Sep-2022 11:05                2264
function.stats-rand-setall.php                     30-Sep-2022 11:05                2818
function.stats-skew.php                            30-Sep-2022 11:05                2524
function.stats-standard-deviation.php              30-Sep-2022 11:05                3423
function.stats-stat-binomial-coef.php              30-Sep-2022 11:05                2822
function.stats-stat-correlation.php                30-Sep-2022 11:05                2977
function.stats-stat-factorial.php                  30-Sep-2022 11:05                2449
function.stats-stat-independent-t.php              30-Sep-2022 11:05                3115
function.stats-stat-innerproduct.php               30-Sep-2022 11:05                2919
function.stats-stat-paired-t.php                   30-Sep-2022 11:05                2856
function.stats-stat-percentile.php                 30-Sep-2022 11:05                2774
function.stats-stat-powersum.php                   30-Sep-2022 11:05                2766
function.stats-variance.php                        30-Sep-2022 11:05                2978
function.stomp-connect-error.php                   30-Sep-2022 11:05                3675
function.stomp-version.php                         30-Sep-2022 11:05                3057
function.str-contains.php                          30-Sep-2022 11:05                8720
function.str-ends-with.php                         30-Sep-2022 11:05                8595
function.str-getcsv.php                            30-Sep-2022 11:05                8023
function.str-ireplace.php                          30-Sep-2022 11:05                9264
function.str-pad.php                               30-Sep-2022 11:05                7926
function.str-repeat.php                            30-Sep-2022 11:05                4694
function.str-replace.php                           30-Sep-2022 11:05               18387
function.str-rot13.php                             30-Sep-2022 11:05                3632
function.str-shuffle.php                           30-Sep-2022 11:05                5786
function.str-split.php                             30-Sep-2022 11:05                8493
function.str-starts-with.php                       30-Sep-2022 11:05                8625
function.str-word-count.php                        30-Sep-2022 11:05                9319
function.strcasecmp.php                            30-Sep-2022 11:05                5848
function.strchr.php                                30-Sep-2022 11:05                1661
function.strcmp.php                                30-Sep-2022 11:05                5820
function.strcoll.php                               30-Sep-2022 11:05                5284
function.strcspn.php                               30-Sep-2022 11:05               11542
function.stream-bucket-append.php                  30-Sep-2022 11:05                2150
function.stream-bucket-make-writeable.php          30-Sep-2022 11:05                4174
function.stream-bucket-new.php                     30-Sep-2022 11:05                2154
function.stream-bucket-prepend.php                 30-Sep-2022 11:05                6706
function.stream-context-create.php                 30-Sep-2022 11:05                7692
function.stream-context-get-default.php            30-Sep-2022 11:05                9469
function.stream-context-get-options.php            30-Sep-2022 11:05                4699
function.stream-context-get-params.php             30-Sep-2022 11:05                5484
function.stream-context-set-default.php            30-Sep-2022 11:05                6630
function.stream-context-set-option.php             30-Sep-2022 11:05                5344
function.stream-context-set-params.php             30-Sep-2022 11:05                4647
function.stream-copy-to-stream.php                 30-Sep-2022 11:05                7506
function.stream-filter-append.php                  30-Sep-2022 11:05               11166
function.stream-filter-prepend.php                 30-Sep-2022 11:05                8020
function.stream-filter-register.php                30-Sep-2022 11:05               20109
function.stream-filter-remove.php                  30-Sep-2022 11:05                6773
function.stream-get-contents.php                   30-Sep-2022 11:05                8687
function.stream-get-filters.php                    30-Sep-2022 11:05                4074
function.stream-get-line.php                       30-Sep-2022 11:05                5296
function.stream-get-meta-data.php                  30-Sep-2022 11:05               15937
function.stream-get-transports.php                 30-Sep-2022 11:05                4122
function.stream-get-wrappers.php                   30-Sep-2022 11:05                5065
function.stream-is-local.php                       30-Sep-2022 11:05                4089
function.stream-isatty.php                         30-Sep-2022 11:05                3871
function.stream-notification-callback.php          30-Sep-2022 11:05               25813
function.stream-register-wrapper.php               30-Sep-2022 11:05                1896
function.stream-resolve-include-path.php           30-Sep-2022 11:05                4262
function.stream-select.php                         30-Sep-2022 11:05               16670
function.stream-set-blocking.php                   30-Sep-2022 11:05                4576
function.stream-set-chunk-size.php                 30-Sep-2022 11:05                3263
function.stream-set-read-buffer.php                30-Sep-2022 11:05                3652
function.stream-set-timeout.php                    30-Sep-2022 11:05                8313
function.stream-set-write-buffer.php               30-Sep-2022 11:05                6054
function.stream-socket-accept.php                  30-Sep-2022 11:05                7445
function.stream-socket-client.php                  30-Sep-2022 11:05               17738
function.stream-socket-enable-crypto.php           30-Sep-2022 11:05               11442
function.stream-socket-get-name.php                30-Sep-2022 11:05                3722
function.stream-socket-pair.php                    30-Sep-2022 11:05                9129
function.stream-socket-recvfrom.php                30-Sep-2022 11:05               10946
function.stream-socket-sendto.php                  30-Sep-2022 11:05                7580
function.stream-socket-server.php                  30-Sep-2022 11:05               15375
function.stream-socket-shutdown.php                30-Sep-2022 11:05                6291
function.stream-supports-lock.php                  30-Sep-2022 11:05                3033
function.stream-wrapper-register.php               30-Sep-2022 11:05                9397
function.stream-wrapper-restore.php                30-Sep-2022 11:05                2761
function.stream-wrapper-unregister.php             30-Sep-2022 11:05                2985
function.strftime.php                              30-Sep-2022 11:04               62761
function.strip-tags.php                            30-Sep-2022 11:05                9690
function.stripcslashes.php                         30-Sep-2022 11:05                4186
function.stripos.php                               30-Sep-2022 11:05               12442
function.stripslashes.php                          30-Sep-2022 11:05                8006
function.stristr.php                               30-Sep-2022 11:05               10520
function.strlen.php                                30-Sep-2022 11:05                5566
function.strnatcasecmp.php                         30-Sep-2022 11:05                7240
function.strnatcmp.php                             30-Sep-2022 11:05                8354
function.strncasecmp.php                           30-Sep-2022 11:05                6627
function.strncmp.php                               30-Sep-2022 11:05                6590
function.strpbrk.php                               30-Sep-2022 11:05                5499
function.strpos.php                                30-Sep-2022 11:05               14932
function.strptime.php                              30-Sep-2022 11:04               11278
function.strrchr.php                               30-Sep-2022 11:05                7501
function.strrev.php                                30-Sep-2022 11:05                3187
function.strripos.php                              30-Sep-2022 11:05               10868
function.strrpos.php                               30-Sep-2022 11:05               14068
function.strspn.php                                30-Sep-2022 11:05               10994
function.strstr.php                                30-Sep-2022 11:05                8790
function.strtok.php                                30-Sep-2022 11:05               13194
function.strtolower.php                            30-Sep-2022 11:05                5186
function.strtotime.php                             30-Sep-2022 11:04               13271
function.strtoupper.php                            30-Sep-2022 11:05                5322
function.strtr.php                                 30-Sep-2022 11:05               11292
function.strval.php                                30-Sep-2022 11:05                6762
function.substr-compare.php                        30-Sep-2022 11:05               10506
function.substr-count.php                          30-Sep-2022 11:05               10044
function.substr-replace.php                        30-Sep-2022 11:05               16461
function.substr.php                                30-Sep-2022 11:05               23894
function.svn-add.php                               30-Sep-2022 11:05                6321
function.svn-auth-get-parameter.php                30-Sep-2022 11:05                4031
function.svn-auth-set-parameter.php                30-Sep-2022 11:05                5595
function.svn-blame.php                             30-Sep-2022 11:05                4962
function.svn-cat.php                               30-Sep-2022 11:05                4860
function.svn-checkout.php                          30-Sep-2022 11:05                7562
function.svn-cleanup.php                           30-Sep-2022 11:05                5326
function.svn-client-version.php                    30-Sep-2022 11:05                3532
function.svn-commit.php                            30-Sep-2022 11:05                8370
function.svn-delete.php                            30-Sep-2022 11:05                4602
function.svn-diff.php                              30-Sep-2022 11:05               13855
function.svn-export.php                            30-Sep-2022 11:05                5046
function.svn-fs-abort-txn.php                      30-Sep-2022 11:05                3196
function.svn-fs-apply-text.php                     30-Sep-2022 11:05                2681
function.svn-fs-begin-txn2.php                     30-Sep-2022 11:05                2628
function.svn-fs-change-node-prop.php               30-Sep-2022 11:05                3133
function.svn-fs-check-path.php                     30-Sep-2022 11:05                2720
function.svn-fs-contents-changed.php               30-Sep-2022 11:05                3153
function.svn-fs-copy.php                           30-Sep-2022 11:05                3888
function.svn-fs-delete.php                         30-Sep-2022 11:05                3307
function.svn-fs-dir-entries.php                    30-Sep-2022 11:05                2649
function.svn-fs-file-contents.php                  30-Sep-2022 11:05                2778
function.svn-fs-file-length.php                    30-Sep-2022 11:05                2689
function.svn-fs-is-dir.php                         30-Sep-2022 11:05                3337
function.svn-fs-is-file.php                        30-Sep-2022 11:05                3340
function.svn-fs-make-dir.php                       30-Sep-2022 11:05                3318
function.svn-fs-make-file.php                      30-Sep-2022 11:05                3350
function.svn-fs-node-created-rev.php               30-Sep-2022 11:05                2754
function.svn-fs-node-prop.php                      30-Sep-2022 11:05                2790
function.svn-fs-props-changed.php                  30-Sep-2022 11:05                3161
function.svn-fs-revision-prop.php                  30-Sep-2022 11:05                2803
function.svn-fs-revision-root.php                  30-Sep-2022 11:05                2758
function.svn-fs-txn-root.php                       30-Sep-2022 11:05                2512
function.svn-fs-youngest-rev.php                   30-Sep-2022 11:05                2600
function.svn-import.php                            30-Sep-2022 11:05                6137
function.svn-log.php                               30-Sep-2022 11:05                9305
function.svn-ls.php                                30-Sep-2022 11:05                7293
function.svn-mkdir.php                             30-Sep-2022 11:05                3105
function.svn-repos-create.php                      30-Sep-2022 11:05                2850
function.svn-repos-fs-begin-txn-for-commit.php     30-Sep-2022 11:05                3096
function.svn-repos-fs-commit-txn.php               30-Sep-2022 11:05                2635
function.svn-repos-fs.php                          30-Sep-2022 11:05                2523
function.svn-repos-hotcopy.php                     30-Sep-2022 11:05                2777
function.svn-repos-open.php                        30-Sep-2022 11:05                2516
function.svn-repos-recover.php                     30-Sep-2022 11:05                2547
function.svn-revert.php                            30-Sep-2022 11:05                3453
function.svn-status.php                            30-Sep-2022 11:05               15567
function.svn-update.php                            30-Sep-2022 11:05                6292
function.swoole-async-dns-lookup.php               30-Sep-2022 11:05                3590
function.swoole-async-read.php                     30-Sep-2022 11:05                4171
function.swoole-async-readfile.php                 30-Sep-2022 11:05                3612
function.swoole-async-set.php                      30-Sep-2022 11:05                2343
function.swoole-async-write.php                    30-Sep-2022 11:05                3452
function.swoole-async-writefile.php                30-Sep-2022 11:05                3480
function.swoole-clear-error.php                    30-Sep-2022 11:05                2266
function.swoole-client-select.php                  30-Sep-2022 11:05                3218
function.swoole-cpu-num.php                        30-Sep-2022 11:05                2072
function.swoole-errno.php                          30-Sep-2022 11:05                2049
function.swoole-error-log.php                      30-Sep-2022 11:05                3010
function.swoole-event-add.php                      30-Sep-2022 11:05                3341
function.swoole-event-defer.php                    30-Sep-2022 11:05                2501
function.swoole-event-del.php                      30-Sep-2022 11:05                2409
function.swoole-event-exit.php                     30-Sep-2022 11:05                2148
function.swoole-event-set.php                      30-Sep-2022 11:05                3328
function.swoole-event-wait.php                     30-Sep-2022 11:05                2119
function.swoole-event-write.php                    30-Sep-2022 11:05                2625
function.swoole-get-local-ip.php                   30-Sep-2022 11:05                2143
function.swoole-last-error.php                     30-Sep-2022 11:05                2098
function.swoole-load-module.php                    30-Sep-2022 11:05                2295
function.swoole-select.php                         30-Sep-2022 11:05                3185
function.swoole-set-process-name.php               30-Sep-2022 11:05                2493
function.swoole-strerror.php                       30-Sep-2022 11:05                2414
function.swoole-timer-after.php                    30-Sep-2022 11:05                2947
function.swoole-timer-exists.php                   30-Sep-2022 11:05                2310
function.swoole-timer-tick.php                     30-Sep-2022 11:05                2820
function.swoole-version.php                        30-Sep-2022 11:05                2075
function.symlink.php                               30-Sep-2022 11:04                5338
function.sys-get-temp-dir.php                      30-Sep-2022 11:04                4312
function.sys-getloadavg.php                        30-Sep-2022 11:05                4231
function.syslog.php                                30-Sep-2022 11:05                9402
function.system.php                                30-Sep-2022 11:05                8073
function.taint.php                                 30-Sep-2022 11:05                2577
function.tan.php                                   30-Sep-2022 11:05                4167
function.tanh.php                                  30-Sep-2022 11:05                3126
function.tcpwrap-check.php                         30-Sep-2022 11:05                5561
function.tempnam.php                               30-Sep-2022 11:04                7219
function.textdomain.php                            30-Sep-2022 11:04                3126
function.tidy-access-count.php                     30-Sep-2022 11:05                6632
function.tidy-config-count.php                     30-Sep-2022 11:05                4472
function.tidy-error-count.php                      30-Sep-2022 11:05                5457
function.tidy-get-output.php                       30-Sep-2022 11:05                4318
function.tidy-warning-count.php                    30-Sep-2022 11:05                4966
function.time-nanosleep.php                        30-Sep-2022 11:05                9190
function.time-sleep-until.php                      30-Sep-2022 11:05                5942
function.time.php                                  30-Sep-2022 11:04                4774
function.timezone-abbreviations-list.php           30-Sep-2022 11:04                1890
function.timezone-identifiers-list.php             30-Sep-2022 11:04                1906
function.timezone-location-get.php                 30-Sep-2022 11:04                1862
function.timezone-name-from-abbr.php               30-Sep-2022 11:04                6277
function.timezone-name-get.php                     30-Sep-2022 11:04                1806
function.timezone-offset-get.php                   30-Sep-2022 11:04                1804
function.timezone-open.php                         30-Sep-2022 11:04                1792
function.timezone-transitions-get.php              30-Sep-2022 11:04                1865
function.timezone-version-get.php                  30-Sep-2022 11:04                3512
function.tmpfile.php                               30-Sep-2022 11:04                5689
function.token-get-all.php                         30-Sep-2022 11:05               12397
function.token-name.php                            30-Sep-2022 11:05                4301
function.touch.php                                 30-Sep-2022 11:04                8142
function.trader-acos.php                           30-Sep-2022 11:05                2428
function.trader-ad.php                             30-Sep-2022 11:05                3206
function.trader-add.php                            30-Sep-2022 11:05                2716
function.trader-adosc.php                          30-Sep-2022 11:05                3962
function.trader-adx.php                            30-Sep-2022 11:05                3286
function.trader-adxr.php                           30-Sep-2022 11:05                3297
function.trader-apo.php                            30-Sep-2022 11:05                3486
function.trader-aroon.php                          30-Sep-2022 11:05                2903
function.trader-aroonosc.php                       30-Sep-2022 11:05                2940
function.trader-asin.php                           30-Sep-2022 11:05                2443
function.trader-atan.php                           30-Sep-2022 11:05                2438
function.trader-atr.php                            30-Sep-2022 11:05                3276
function.trader-avgprice.php                       30-Sep-2022 11:05                3257
function.trader-bbands.php                         30-Sep-2022 11:05                4235
function.trader-beta.php                           30-Sep-2022 11:05                2870
function.trader-bop.php                            30-Sep-2022 11:05                3206
function.trader-cci.php                            30-Sep-2022 11:05                3281
function.trader-cdl2crows.php                      30-Sep-2022 11:05                3279
function.trader-cdl3blackcrows.php                 30-Sep-2022 11:05                3341
function.trader-cdl3inside.php                     30-Sep-2022 11:05                3333
function.trader-cdl3linestrike.php                 30-Sep-2022 11:05                3345
function.trader-cdl3outside.php                    30-Sep-2022 11:05                3337
function.trader-cdl3starsinsouth.php               30-Sep-2022 11:05                3386
function.trader-cdl3whitesoldiers.php              30-Sep-2022 11:05                3410
function.trader-cdlabandonedbaby.php               30-Sep-2022 11:05                3753
function.trader-cdladvanceblock.php                30-Sep-2022 11:05                3363
function.trader-cdlbelthold.php                    30-Sep-2022 11:05                3319
function.trader-cdlbreakaway.php                   30-Sep-2022 11:05                3333
function.trader-cdlclosingmarubozu.php             30-Sep-2022 11:05                3404
function.trader-cdlconcealbabyswall.php            30-Sep-2022 11:05                3427
function.trader-cdlcounterattack.php               30-Sep-2022 11:05                3391
function.trader-cdldarkcloudcover.php              30-Sep-2022 11:05                3747
function.trader-cdldoji.php                        30-Sep-2022 11:05                3276
function.trader-cdldojistar.php                    30-Sep-2022 11:05                3311
function.trader-cdldragonflydoji.php               30-Sep-2022 11:05                3366
function.trader-cdlengulfing.php                   30-Sep-2022 11:05                3351
function.trader-cdleveningdojistar.php             30-Sep-2022 11:05                3764
function.trader-cdleveningstar.php                 30-Sep-2022 11:05                3741
function.trader-cdlgapsidesidewhite.php            30-Sep-2022 11:05                3393
function.trader-cdlgravestonedoji.php              30-Sep-2022 11:05                3387
function.trader-cdlhammer.php                      30-Sep-2022 11:05                3302
function.trader-cdlhangingman.php                  30-Sep-2022 11:05                3323
function.trader-cdlharami.php                      30-Sep-2022 11:05                3304
function.trader-cdlharamicross.php                 30-Sep-2022 11:05                3346
function.trader-cdlhighwave.php                    30-Sep-2022 11:05                3320
function.trader-cdlhikkake.php                     30-Sep-2022 11:05                3309
function.trader-cdlhikkakemod.php                  30-Sep-2022 11:05                3350
function.trader-cdlhomingpigeon.php                30-Sep-2022 11:05                3371
function.trader-cdlidentical3crows.php             30-Sep-2022 11:05                3395
function.trader-cdlinneck.php                      30-Sep-2022 11:05                3320
function.trader-cdlinvertedhammer.php              30-Sep-2022 11:05                3370
function.trader-cdlkicking.php                     30-Sep-2022 11:05                3323
function.trader-cdlkickingbylength.php             30-Sep-2022 11:05                3428
function.trader-cdlladderbottom.php                30-Sep-2022 11:05                3388
function.trader-cdllongleggeddoji.php              30-Sep-2022 11:05                3394
function.trader-cdllongline.php                    30-Sep-2022 11:05                3328
function.trader-cdlmarubozu.php                    30-Sep-2022 11:05                3314
function.trader-cdlmatchinglow.php                 30-Sep-2022 11:05                3340
function.trader-cdlmathold.php                     30-Sep-2022 11:05                3687
function.trader-cdlmorningdojistar.php             30-Sep-2022 11:05                3763
function.trader-cdlmorningstar.php                 30-Sep-2022 11:05                3724
function.trader-cdlonneck.php                      30-Sep-2022 11:05                3300
function.trader-cdlpiercing.php                    30-Sep-2022 11:05                3317
function.trader-cdlrickshawman.php                 30-Sep-2022 11:05                3358
function.trader-cdlrisefall3methods.php            30-Sep-2022 11:05                3429
function.trader-cdlseparatinglines.php             30-Sep-2022 11:05                3411
function.trader-cdlshootingstar.php                30-Sep-2022 11:05                3370
function.trader-cdlshortline.php                   30-Sep-2022 11:05                3346
function.trader-cdlspinningtop.php                 30-Sep-2022 11:05                3350
function.trader-cdlstalledpattern.php              30-Sep-2022 11:05                3398
function.trader-cdlsticksandwich.php               30-Sep-2022 11:05                3376
function.trader-cdltakuri.php                      30-Sep-2022 11:05                3355
function.trader-cdltasukigap.php                   30-Sep-2022 11:05                3320
function.trader-cdlthrusting.php                   30-Sep-2022 11:05                3328
function.trader-cdltristar.php                     30-Sep-2022 11:05                3314
function.trader-cdlunique3river.php                30-Sep-2022 11:05                3366
function.trader-cdlupsidegap2crows.php             30-Sep-2022 11:05                3426
function.trader-cdlxsidegap3methods.php            30-Sep-2022 11:05                3431
function.trader-ceil.php                           30-Sep-2022 11:05                2485
function.trader-cmo.php                            30-Sep-2022 11:05                2640
function.trader-correl.php                         30-Sep-2022 11:05                2930
function.trader-cos.php                            30-Sep-2022 11:05                2439
function.trader-cosh.php                           30-Sep-2022 11:05                2457
function.trader-dema.php                           30-Sep-2022 11:05                2651
function.trader-div.php                            30-Sep-2022 11:05                2761
function.trader-dx.php                             30-Sep-2022 11:05                3482
function.trader-ema.php                            30-Sep-2022 11:05                2626
function.trader-errno.php                          30-Sep-2022 11:05                2178
function.trader-exp.php                            30-Sep-2022 11:05                2519
function.trader-floor.php                          30-Sep-2022 11:05                2480
function.trader-get-compat.php                     30-Sep-2022 11:05                2295
function.trader-get-unstable-period.php            30-Sep-2022 11:05                2685
function.trader-ht-dcperiod.php                    30-Sep-2022 11:05                2455
function.trader-ht-dcphase.php                     30-Sep-2022 11:05                2424
function.trader-ht-phasor.php                      30-Sep-2022 11:05                2407
function.trader-ht-sine.php                        30-Sep-2022 11:05                2390
function.trader-ht-trendline.php                   30-Sep-2022 11:05                2440
function.trader-ht-trendmode.php                   30-Sep-2022 11:05                2440
function.trader-kama.php                           30-Sep-2022 11:05                2689
function.trader-linearreg-angle.php                30-Sep-2022 11:05                2788
function.trader-linearreg-intercept.php            30-Sep-2022 11:05                2849
function.trader-linearreg-slope.php                30-Sep-2022 11:05                2798
function.trader-linearreg.php                      30-Sep-2022 11:05                2702
function.trader-ln.php                             30-Sep-2022 11:05                2437
function.trader-log10.php                          30-Sep-2022 11:05                2438
function.trader-ma.php                             30-Sep-2022 11:05                3012
function.trader-macd.php                           30-Sep-2022 11:05                3484
function.trader-macdext.php                        30-Sep-2022 11:05                4855
function.trader-macdfix.php                        30-Sep-2022 11:05                2749
function.trader-mama.php                           30-Sep-2022 11:05                3039
function.trader-mavp.php                           30-Sep-2022 11:05                3867
function.trader-max.php                            30-Sep-2022 11:05                2669
function.trader-maxindex.php                       30-Sep-2022 11:05                2730
function.trader-medprice.php                       30-Sep-2022 11:05                2627
function.trader-mfi.php                            30-Sep-2022 11:05                3609
function.trader-midpoint.php                       30-Sep-2022 11:05                2686
function.trader-midprice.php                       30-Sep-2022 11:05                2962
function.trader-min.php                            30-Sep-2022 11:05                2673
function.trader-minindex.php                       30-Sep-2022 11:05                2723
function.trader-minmax.php                         30-Sep-2022 11:05                2715
function.trader-minmaxindex.php                    30-Sep-2022 11:05                2767
function.trader-minus-di.php                       30-Sep-2022 11:05                3361
function.trader-minus-dm.php                       30-Sep-2022 11:05                2966
function.trader-mom.php                            30-Sep-2022 11:05                2620
function.trader-mult.php                           30-Sep-2022 11:05                2731
function.trader-natr.php                           30-Sep-2022 11:05                3299
function.trader-obv.php                            30-Sep-2022 11:05                2589
function.trader-plus-di.php                        30-Sep-2022 11:05                3330
function.trader-plus-dm.php                        30-Sep-2022 11:05                2951
function.trader-ppo.php                            30-Sep-2022 11:05                3502
function.trader-roc.php                            30-Sep-2022 11:05                2648
function.trader-rocp.php                           30-Sep-2022 11:05                2681
function.trader-rocr.php                           30-Sep-2022 11:05                2668
function.trader-rocr100.php                        30-Sep-2022 11:05                2720
function.trader-rsi.php                            30-Sep-2022 11:05                2630
function.trader-sar.php                            30-Sep-2022 11:05                3588
function.trader-sarext.php                         30-Sep-2022 11:05                6861
function.trader-set-compat.php                     30-Sep-2022 11:05                2603
function.trader-set-unstable-period.php            30-Sep-2022 11:05                3195
function.trader-sin.php                            30-Sep-2022 11:05                2450
function.trader-sinh.php                           30-Sep-2022 11:05                2442
function.trader-sma.php                            30-Sep-2022 11:05                2629
function.trader-sqrt.php                           30-Sep-2022 11:05                2438
function.trader-stddev.php                         30-Sep-2022 11:05                2920
function.trader-stoch.php                          30-Sep-2022 11:05                5004
function.trader-stochf.php                         30-Sep-2022 11:05                4205
function.trader-stochrsi.php                       30-Sep-2022 11:05                3983
function.trader-sub.php                            30-Sep-2022 11:05                2742
function.trader-sum.php                            30-Sep-2022 11:05                2605
function.trader-t3.php                             30-Sep-2022 11:05                2940
function.trader-tan.php                            30-Sep-2022 11:05                2425
function.trader-tanh.php                           30-Sep-2022 11:05                2451
function.trader-tema.php                           30-Sep-2022 11:05                2652
function.trader-trange.php                         30-Sep-2022 11:05                2867
function.trader-trima.php                          30-Sep-2022 11:05                2654
function.trader-trix.php                           30-Sep-2022 11:05                2681
function.trader-tsf.php                            30-Sep-2022 11:05                2649
function.trader-typprice.php                       30-Sep-2022 11:05                2889
function.trader-ultosc.php                         30-Sep-2022 11:05                4113
function.trader-var.php                            30-Sep-2022 11:05                2884
function.trader-wclprice.php                       30-Sep-2022 11:05                2894
function.trader-willr.php                          30-Sep-2022 11:05                3296
function.trader-wma.php                            30-Sep-2022 11:05                2663
function.trait-exists.php                          30-Sep-2022 11:05                2740
function.trigger-error.php                         30-Sep-2022 11:04                6593
function.trim.php                                  30-Sep-2022 11:05               14330
function.uasort.php                                30-Sep-2022 11:05                9745
function.ucfirst.php                               30-Sep-2022 11:05                5842
function.ucwords.php                               30-Sep-2022 11:05               10039
function.ui-draw-text-font-fontfamilies.php        30-Sep-2022 11:05                2349
function.ui-quit.php                               30-Sep-2022 11:05                2025
function.ui-run.php                                30-Sep-2022 11:05                2402
function.uksort.php                                30-Sep-2022 11:05                9038
function.umask.php                                 30-Sep-2022 11:04                5735
function.uniqid.php                                30-Sep-2022 11:05                7933
function.unixtojd.php                              30-Sep-2022 11:04                3766
function.unlink.php                                30-Sep-2022 11:04                5958
function.unpack.php                                30-Sep-2022 11:05               10788
function.unregister-tick-function.php              30-Sep-2022 11:05                3155
function.unserialize.php                           30-Sep-2022 11:05               16878
function.unset.php                                 30-Sep-2022 11:05               15623
function.untaint.php                               30-Sep-2022 11:05                2382
function.uopz-add-function.php                     30-Sep-2022 11:04                6600
function.uopz-allow-exit.php                       30-Sep-2022 11:04                4568
function.uopz-backup.php                           30-Sep-2022 11:04                4397
function.uopz-compose.php                          30-Sep-2022 11:04                7018
function.uopz-copy.php                             30-Sep-2022 11:04                5170
function.uopz-del-function.php                     30-Sep-2022 11:04                6145
function.uopz-delete.php                           30-Sep-2022 11:04                5920
function.uopz-extend.php                           30-Sep-2022 11:04                4846
function.uopz-flags.php                            30-Sep-2022 11:04               11092
function.uopz-function.php                         30-Sep-2022 11:04                7172
function.uopz-get-exit-status.php                  30-Sep-2022 11:04                4193
function.uopz-get-hook.php                         30-Sep-2022 11:04                5184
function.uopz-get-mock.php                         30-Sep-2022 11:04                5128
function.uopz-get-property.php                     30-Sep-2022 11:04                6117
function.uopz-get-return.php                       30-Sep-2022 11:04                4333
function.uopz-get-static.php                       30-Sep-2022 11:04                4805
function.uopz-implement.php                        30-Sep-2022 11:04                4876
function.uopz-overload.php                         30-Sep-2022 11:04                3944
function.uopz-redefine.php                         30-Sep-2022 11:04                4891
function.uopz-rename.php                           30-Sep-2022 11:04                6625
function.uopz-restore.php                          30-Sep-2022 11:04                4756
function.uopz-set-hook.php                         30-Sep-2022 11:04                5365
function.uopz-set-mock.php                         30-Sep-2022 11:04               12583
function.uopz-set-property.php                     30-Sep-2022 11:04                7581
function.uopz-set-return.php                       30-Sep-2022 11:04                9377
function.uopz-set-static.php                       30-Sep-2022 11:04                5456
function.uopz-undefine.php                         30-Sep-2022 11:04                4341
function.uopz-unset-hook.php                       30-Sep-2022 11:04                5259
function.uopz-unset-mock.php                       30-Sep-2022 11:04                5482
function.uopz-unset-return.php                     30-Sep-2022 11:04                4629
function.urldecode.php                             30-Sep-2022 11:05                6669
function.urlencode.php                             30-Sep-2022 11:05                8609
function.use-soap-error-handler.php                30-Sep-2022 11:05                3906
function.user-error.php                            30-Sep-2022 11:04                1695
function.usleep.php                                30-Sep-2022 11:05                6094
function.usort.php                                 30-Sep-2022 11:05               27855
function.utf8-decode.php                           30-Sep-2022 11:05                9536
function.utf8-encode.php                           30-Sep-2022 11:05                7819
function.var-dump.php                              30-Sep-2022 11:05                7275
function.var-export.php                            30-Sep-2022 11:05               17469
function.var-representation.php                    30-Sep-2022 11:05               14371
function.variant-abs.php                           30-Sep-2022 11:05                4390
function.variant-add.php                           30-Sep-2022 11:05                5846
function.variant-and.php                           30-Sep-2022 11:05                6507
function.variant-cast.php                          30-Sep-2022 11:05                3556
function.variant-cat.php                           30-Sep-2022 11:05                5008
function.variant-cmp.php                           30-Sep-2022 11:05                7573
function.variant-date-from-timestamp.php           30-Sep-2022 11:05                3578
function.variant-date-to-timestamp.php             30-Sep-2022 11:05                3665
function.variant-div.php                           30-Sep-2022 11:05                6632
function.variant-eqv.php                           30-Sep-2022 11:05                4615
function.variant-fix.php                           30-Sep-2022 11:05                5873
function.variant-get-type.php                      30-Sep-2022 11:05                3476
function.variant-idiv.php                          30-Sep-2022 11:05                6060
function.variant-imp.php                           30-Sep-2022 11:05                6056
function.variant-int.php                           30-Sep-2022 11:05                5374
function.variant-mod.php                           30-Sep-2022 11:05                5068
function.variant-mul.php                           30-Sep-2022 11:05                6163
function.variant-neg.php                           30-Sep-2022 11:05                4052
function.variant-not.php                           30-Sep-2022 11:05                4227
function.variant-or.php                            30-Sep-2022 11:05                6740
function.variant-pow.php                           30-Sep-2022 11:05                4902
function.variant-round.php                         30-Sep-2022 11:05                4570
function.variant-set-type.php                      30-Sep-2022 11:05                3670
function.variant-set.php                           30-Sep-2022 11:05                2957
function.variant-sub.php                           30-Sep-2022 11:05                5795
function.variant-xor.php                           30-Sep-2022 11:05                6061
function.version-compare.php                       30-Sep-2022 11:04               11811
function.vfprintf.php                              30-Sep-2022 11:05               17250
function.virtual.php                               30-Sep-2022 11:05                5393
function.vprintf.php                               30-Sep-2022 11:05               16703
function.vsprintf.php                              30-Sep-2022 11:05               17035
function.wddx-add-vars.php                         30-Sep-2022 11:05                3865
function.wddx-deserialize.php                      30-Sep-2022 11:05                3918
function.wddx-packet-end.php                       30-Sep-2022 11:05                2809
function.wddx-packet-start.php                     30-Sep-2022 11:05                3153
function.wddx-serialize-value.php                  30-Sep-2022 11:05                3287
function.wddx-serialize-vars.php                   30-Sep-2022 11:05                6191
function.win32-continue-service.php                30-Sep-2022 11:05                6564
function.win32-create-service.php                  30-Sep-2022 11:05               34586
function.win32-delete-service.php                  30-Sep-2022 11:05                7045
function.win32-get-last-control-message.php        30-Sep-2022 11:05                7403
function.win32-pause-service.php                   30-Sep-2022 11:05                6564
function.win32-query-service-status.php            30-Sep-2022 11:05                8692
function.win32-send-custom-control.php             30-Sep-2022 11:05                7114
function.win32-set-service-exit-code.php           30-Sep-2022 11:05                5970
function.win32-set-service-exit-mode.php           30-Sep-2022 11:05                5965
function.win32-set-service-status.php              30-Sep-2022 11:05                8455
function.win32-start-service-ctrl-dispatcher.php   30-Sep-2022 11:05               11405
function.win32-start-service.php                   30-Sep-2022 11:05                6563
function.win32-stop-service.php                    30-Sep-2022 11:05                6487
function.wincache-fcache-fileinfo.php              30-Sep-2022 11:04                9616
function.wincache-fcache-meminfo.php               30-Sep-2022 11:04                7554
function.wincache-lock.php                         30-Sep-2022 11:04                9126
function.wincache-ocache-fileinfo.php              30-Sep-2022 11:04               10298
function.wincache-ocache-meminfo.php               30-Sep-2022 11:04                7748
function.wincache-refresh-if-changed.php           30-Sep-2022 11:04                8325
function.wincache-rplist-fileinfo.php              30-Sep-2022 11:04                7910
function.wincache-rplist-meminfo.php               30-Sep-2022 11:04                7688
function.wincache-scache-info.php                  30-Sep-2022 11:04               10018
function.wincache-scache-meminfo.php               30-Sep-2022 11:04                6917
function.wincache-ucache-add.php                   30-Sep-2022 11:04               14298
function.wincache-ucache-cas.php                   30-Sep-2022 11:04                6291
function.wincache-ucache-clear.php                 30-Sep-2022 11:04                7764
function.wincache-ucache-dec.php                   30-Sep-2022 11:04                6234
function.wincache-ucache-delete.php                30-Sep-2022 11:04               12060
function.wincache-ucache-exists.php                30-Sep-2022 11:04                6286
function.wincache-ucache-get.php                   30-Sep-2022 11:04               11212
function.wincache-ucache-inc.php                   30-Sep-2022 11:04                6260
function.wincache-ucache-info.php                  30-Sep-2022 11:04               11753
function.wincache-ucache-meminfo.php               30-Sep-2022 11:04                7302
function.wincache-ucache-set.php                   30-Sep-2022 11:04               14503
function.wincache-unlock.php                       30-Sep-2022 11:04                8349
function.wordwrap.php                              30-Sep-2022 11:05                9116
function.xattr-get.php                             30-Sep-2022 11:04                6350
function.xattr-list.php                            30-Sep-2022 11:04                6963
function.xattr-remove.php                          30-Sep-2022 11:04                6598
function.xattr-set.php                             30-Sep-2022 11:04                8285
function.xattr-supported.php                       30-Sep-2022 11:04                5383
function.xdiff-file-bdiff-size.php                 30-Sep-2022 11:04                4983
function.xdiff-file-bdiff.php                      30-Sep-2022 11:04                5861
function.xdiff-file-bpatch.php                     30-Sep-2022 11:04                6529
function.xdiff-file-diff-binary.php                30-Sep-2022 11:04                6393
function.xdiff-file-diff.php                       30-Sep-2022 11:04                7246
function.xdiff-file-merge3.php                     30-Sep-2022 11:04                6940
function.xdiff-file-patch-binary.php               30-Sep-2022 11:04                6585
function.xdiff-file-patch.php                      30-Sep-2022 11:04                9103
function.xdiff-file-rabdiff.php                    30-Sep-2022 11:04                6535
function.xdiff-string-bdiff-size.php               30-Sep-2022 11:04                5295
function.xdiff-string-bdiff.php                    30-Sep-2022 11:04                3798
function.xdiff-string-bpatch.php                   30-Sep-2022 11:04                3944
function.xdiff-string-diff-binary.php              30-Sep-2022 11:04                4304
function.xdiff-string-diff.php                     30-Sep-2022 11:04                7674
function.xdiff-string-merge3.php                   30-Sep-2022 11:04                4707
function.xdiff-string-patch-binary.php             30-Sep-2022 11:04                4403
function.xdiff-string-patch.php                    30-Sep-2022 11:04                8302
function.xdiff-string-rabdiff.php                  30-Sep-2022 11:04                4455
function.xhprof-disable.php                        30-Sep-2022 11:04                3906
function.xhprof-enable.php                         30-Sep-2022 11:04                8088
function.xhprof-sample-disable.php                 30-Sep-2022 11:04                4760
function.xhprof-sample-enable.php                  30-Sep-2022 11:04                3697
function.xml-error-string.php                      30-Sep-2022 11:05                3267
function.xml-get-current-byte-index.php            30-Sep-2022 11:05                4639
function.xml-get-current-column-number.php         30-Sep-2022 11:05                4505
function.xml-get-current-line-number.php           30-Sep-2022 11:05                4198
function.xml-get-error-code.php                    30-Sep-2022 11:05                3875
function.xml-parse-into-struct.php                 30-Sep-2022 11:05               21038
function.xml-parse.php                             30-Sep-2022 11:05                8344
function.xml-parser-create-ns.php                  30-Sep-2022 11:05                5330
function.xml-parser-create.php                     30-Sep-2022 11:05                4885
function.xml-parser-free.php                       30-Sep-2022 11:05                3983
function.xml-parser-get-option.php                 30-Sep-2022 11:05                4543
function.xml-parser-set-option.php                 30-Sep-2022 11:05                6192
function.xml-set-character-data-handler.php        30-Sep-2022 11:05                5939
function.xml-set-default-handler.php               30-Sep-2022 11:05                5845
function.xml-set-element-handler.php               30-Sep-2022 11:05                8784
function.xml-set-end-namespace-decl-handler.php    30-Sep-2022 11:05                7181
function.xml-set-external-entity-ref-handler.php   30-Sep-2022 11:05                8437
function.xml-set-notation-decl-handler.php         30-Sep-2022 11:05                7676
function.xml-set-object.php                        30-Sep-2022 11:05               10550
function.xml-set-processing-instruction-handler..> 30-Sep-2022 11:05                7113
function.xml-set-start-namespace-decl-handler.php  30-Sep-2022 11:05                7448
function.xml-set-unparsed-entity-decl-handler.php  30-Sep-2022 11:05                8331
function.xmlrpc-decode-request.php                 30-Sep-2022 11:05                2735
function.xmlrpc-decode.php                         30-Sep-2022 11:05                4223
function.xmlrpc-encode-request.php                 30-Sep-2022 11:05                8911
function.xmlrpc-encode.php                         30-Sep-2022 11:05                2435
function.xmlrpc-get-type.php                       30-Sep-2022 11:05                6496
function.xmlrpc-is-fault.php                       30-Sep-2022 11:05                3959
function.xmlrpc-parse-method-descriptions.php      30-Sep-2022 11:05                2537
function.xmlrpc-server-add-introspection-data.php  30-Sep-2022 11:05                2666
function.xmlrpc-server-call-method.php             30-Sep-2022 11:05                3069
function.xmlrpc-server-create.php                  30-Sep-2022 11:05                2295
function.xmlrpc-server-destroy.php                 30-Sep-2022 11:05                2446
function.xmlrpc-server-register-introspection-c..> 30-Sep-2022 11:05                2749
function.xmlrpc-server-register-method.php         30-Sep-2022 11:05                2738
function.xmlrpc-set-type.php                       30-Sep-2022 11:05                5577
function.yaml-emit-file.php                        30-Sep-2022 11:05                5907
function.yaml-emit.php                             30-Sep-2022 11:05               12868
function.yaml-parse-file.php                       30-Sep-2022 11:05                5850
function.yaml-parse-url.php                        30-Sep-2022 11:05                6097
function.yaml-parse.php                            30-Sep-2022 11:05               10124
function.yaz-addinfo.php                           30-Sep-2022 11:05                3458
function.yaz-ccl-conf.php                          30-Sep-2022 11:05                5880
function.yaz-ccl-parse.php                         30-Sep-2022 11:05                6947
function.yaz-close.php                             30-Sep-2022 11:05                3347
function.yaz-connect.php                           30-Sep-2022 11:05                9561
function.yaz-database.php                          30-Sep-2022 11:05                3325
function.yaz-element.php                           30-Sep-2022 11:05                3697
function.yaz-errno.php                             30-Sep-2022 11:05                3770
function.yaz-error.php                             30-Sep-2022 11:05                3416
function.yaz-es-result.php                         30-Sep-2022 11:05                3292
function.yaz-es.php                                30-Sep-2022 11:05                7489
function.yaz-get-option.php                        30-Sep-2022 11:05                3305
function.yaz-hits.php                              30-Sep-2022 11:05                5354
function.yaz-itemorder.php                         30-Sep-2022 11:05                7068
function.yaz-present.php                           30-Sep-2022 11:05                2808
function.yaz-range.php                             30-Sep-2022 11:05                3506
function.yaz-record.php                            30-Sep-2022 11:05               15407
function.yaz-scan-result.php                       30-Sep-2022 11:05                3825
function.yaz-scan.php                              30-Sep-2022 11:05               10091
function.yaz-schema.php                            30-Sep-2022 11:05                3345
function.yaz-search.php                            30-Sep-2022 11:05                8870
function.yaz-set-option.php                        30-Sep-2022 11:05                6956
function.yaz-sort.php                              30-Sep-2022 11:05                5645
function.yaz-syntax.php                            30-Sep-2022 11:05                3302
function.yaz-wait.php                              30-Sep-2022 11:05                4120
function.zend-thread-id.php                        30-Sep-2022 11:04                3880
function.zend-version.php                          30-Sep-2022 11:04                4132
function.zip-close.php                             30-Sep-2022 11:04                3973
function.zip-entry-close.php                       30-Sep-2022 11:04                4132
function.zip-entry-compressedsize.php              30-Sep-2022 11:04                4439
function.zip-entry-compressionmethod.php           30-Sep-2022 11:04                4555
function.zip-entry-filesize.php                    30-Sep-2022 11:04                4390
function.zip-entry-name.php                        30-Sep-2022 11:04                4257
function.zip-entry-open.php                        30-Sep-2022 11:04                5809
function.zip-entry-read.php                        30-Sep-2022 11:04                5040
function.zip-open.php                              30-Sep-2022 11:04                4415
function.zip-read.php                              30-Sep-2022 11:04                4677
function.zlib-decode.php                           30-Sep-2022 11:04                3273
function.zlib-encode.php                           30-Sep-2022 11:04                5058
function.zlib-get-coding-type.php                  30-Sep-2022 11:04                2861
function.zookeeper-dispatch.php                    30-Sep-2022 11:05                8673
functional.parallel.php                            30-Sep-2022 11:05                2542
functions.anonymous.php                            30-Sep-2022 11:04               27434
functions.arguments.php                            30-Sep-2022 11:04               49505
functions.arrow.php                                30-Sep-2022 11:04               11511
functions.first_class_callable_syntax.php          30-Sep-2022 11:04               12352
functions.internal.php                             30-Sep-2022 11:04                8061
functions.returning-values.php                     30-Sep-2022 11:04                6551
functions.user-defined.php                         30-Sep-2022 11:04               10552
functions.variable-functions.php                   30-Sep-2022 11:04               12762
gearman.configuration.php                          30-Sep-2022 11:05                1231
gearman.constants.php                              30-Sep-2022 11:05               18953
gearman.examples-reverse-bg.php                    30-Sep-2022 11:05               11886
gearman.examples-reverse-task.php                  30-Sep-2022 11:05               19084
gearman.examples-reverse.php                       30-Sep-2022 11:05               14716
gearman.examples.php                               30-Sep-2022 11:05                1485
gearman.installation.php                           30-Sep-2022 11:05                1730
gearman.requirements.php                           30-Sep-2022 11:05                1491
gearman.resources.php                              30-Sep-2022 11:05                1247
gearman.setup.php                                  30-Sep-2022 11:05                1598
gearmanclient.addoptions.php                       30-Sep-2022 11:05                2924
gearmanclient.addserver.php                        30-Sep-2022 11:05                5115
gearmanclient.addservers.php                       30-Sep-2022 11:05                4616
gearmanclient.addtask.php                          30-Sep-2022 11:05               15729
gearmanclient.addtaskbackground.php                30-Sep-2022 11:05               22189
gearmanclient.addtaskhigh.php                      30-Sep-2022 11:05               11807
gearmanclient.addtaskhighbackground.php            30-Sep-2022 11:05                6214
gearmanclient.addtasklow.php                       30-Sep-2022 11:05               11793
gearmanclient.addtasklowbackground.php             30-Sep-2022 11:05                6216
gearmanclient.addtaskstatus.php                    30-Sep-2022 11:05               10194
gearmanclient.clearcallbacks.php                   30-Sep-2022 11:05                4842
gearmanclient.clone.php                            30-Sep-2022 11:05                2632
gearmanclient.construct.php                        30-Sep-2022 11:05                2857
gearmanclient.context.php                          30-Sep-2022 11:05                2954
gearmanclient.data.php                             30-Sep-2022 11:05                3262
gearmanclient.do.php                               30-Sep-2022 11:05               24706
gearmanclient.dobackground.php                     30-Sep-2022 11:05               10133
gearmanclient.dohigh.php                           30-Sep-2022 11:05                5186
gearmanclient.dohighbackground.php                 30-Sep-2022 11:05                4837
gearmanclient.dojobhandle.php                      30-Sep-2022 11:05                3049
gearmanclient.dolow.php                            30-Sep-2022 11:05                5202
gearmanclient.dolowbackground.php                  30-Sep-2022 11:05                4861
gearmanclient.donormal.php                         30-Sep-2022 11:05               25106
gearmanclient.dostatus.php                         30-Sep-2022 11:05                9049
gearmanclient.echo.php                             30-Sep-2022 11:05                2844
gearmanclient.error.php                            30-Sep-2022 11:05                2873
gearmanclient.geterrno.php                         30-Sep-2022 11:05                2714
gearmanclient.jobstatus.php                        30-Sep-2022 11:05                8936
gearmanclient.ping.php                             30-Sep-2022 11:05                2919
gearmanclient.removeoptions.php                    30-Sep-2022 11:05                2511
gearmanclient.returncode.php                       30-Sep-2022 11:05                2260
gearmanclient.runtasks.php                         30-Sep-2022 11:05                3672
gearmanclient.setclientcallback.php                30-Sep-2022 11:05                5913
gearmanclient.setcompletecallback.php              30-Sep-2022 11:05                5729
gearmanclient.setcontext.php                       30-Sep-2022 11:05                3166
gearmanclient.setcreatedcallback.php               30-Sep-2022 11:05                5180
gearmanclient.setdata.php                          30-Sep-2022 11:05                3384
gearmanclient.setdatacallback.php                  30-Sep-2022 11:05                5212
gearmanclient.setexceptioncallback.php             30-Sep-2022 11:05                5106
gearmanclient.setfailcallback.php                  30-Sep-2022 11:05                5175
gearmanclient.setoptions.php                       30-Sep-2022 11:05                2526
gearmanclient.setstatuscallback.php                30-Sep-2022 11:05                5225
gearmanclient.settimeout.php                       30-Sep-2022 11:05                2612
gearmanclient.setwarningcallback.php               30-Sep-2022 11:05                5219
gearmanclient.setworkloadcallback.php              30-Sep-2022 11:05                5458
gearmanclient.timeout.php                          30-Sep-2022 11:05                2827
gearmanclient.wait.php                             30-Sep-2022 11:05                2667
gearmanjob.complete.php                            30-Sep-2022 11:05                3507
gearmanjob.construct.php                           30-Sep-2022 11:05                2355
gearmanjob.data.php                                30-Sep-2022 11:05                3552
gearmanjob.exception.php                           30-Sep-2022 11:05                3703
gearmanjob.fail.php                                30-Sep-2022 11:05                3726
gearmanjob.functionname.php                        30-Sep-2022 11:05                2703
gearmanjob.handle.php                              30-Sep-2022 11:05                2587
gearmanjob.returncode.php                          30-Sep-2022 11:05                2622
gearmanjob.sendcomplete.php                        30-Sep-2022 11:05                3213
gearmanjob.senddata.php                            30-Sep-2022 11:05                3249
gearmanjob.sendexception.php                       30-Sep-2022 11:05                3389
gearmanjob.sendfail.php                            30-Sep-2022 11:05                3394
gearmanjob.sendstatus.php                          30-Sep-2022 11:05                3970
gearmanjob.sendwarning.php                         30-Sep-2022 11:05                3386
gearmanjob.setreturn.php                           30-Sep-2022 11:05                2470
gearmanjob.status.php                              30-Sep-2022 11:05                4275
gearmanjob.unique.php                              30-Sep-2022 11:05                2861
gearmanjob.warning.php                             30-Sep-2022 11:05                3692
gearmanjob.workload.php                            30-Sep-2022 11:05                2883
gearmanjob.workloadsize.php                        30-Sep-2022 11:05                2653
gearmantask.construct.php                          30-Sep-2022 11:05                2368
gearmantask.create.php                             30-Sep-2022 11:05                2742
gearmantask.data.php                               30-Sep-2022 11:05                2668
gearmantask.datasize.php                           30-Sep-2022 11:05                2696
gearmantask.function.php                           30-Sep-2022 11:05                2628
gearmantask.functionname.php                       30-Sep-2022 11:05                2294
gearmantask.isknown.php                            30-Sep-2022 11:05                2302
gearmantask.isrunning.php                          30-Sep-2022 11:05                2315
gearmantask.jobhandle.php                          30-Sep-2022 11:05                2748
gearmantask.recvdata.php                           30-Sep-2022 11:05                3372
gearmantask.returncode.php                         30-Sep-2022 11:05                2650
gearmantask.senddata.php                           30-Sep-2022 11:05                3300
gearmantask.sendworkload.php                       30-Sep-2022 11:05                3335
gearmantask.taskdenominator.php                    30-Sep-2022 11:05                2819
gearmantask.tasknumerator.php                      30-Sep-2022 11:05                2791
gearmantask.unique.php                             30-Sep-2022 11:05                3159
gearmantask.uuid.php                               30-Sep-2022 11:05                3476
gearmanworker.addfunction.php                      30-Sep-2022 11:05                8069
gearmanworker.addoptions.php                       30-Sep-2022 11:05                3312
gearmanworker.addserver.php                        30-Sep-2022 11:05                4699
gearmanworker.addservers.php                       30-Sep-2022 11:05                4272
gearmanworker.clone.php                            30-Sep-2022 11:05                2296
gearmanworker.construct.php                        30-Sep-2022 11:05                2843
gearmanworker.echo.php                             30-Sep-2022 11:05                3073
gearmanworker.error.php                            30-Sep-2022 11:05                2752
gearmanworker.geterrno.php                         30-Sep-2022 11:05                2630
gearmanworker.options.php                          30-Sep-2022 11:05                2654
gearmanworker.register.php                         30-Sep-2022 11:05                3742
gearmanworker.removeoptions.php                    30-Sep-2022 11:05                3354
gearmanworker.returncode.php                       30-Sep-2022 11:05                2862
gearmanworker.setid.php                            30-Sep-2022 11:05                3918
gearmanworker.setoptions.php                       30-Sep-2022 11:05                3523
gearmanworker.settimeout.php                       30-Sep-2022 11:05                8438
gearmanworker.timeout.php                          30-Sep-2022 11:05                2812
gearmanworker.unregister.php                       30-Sep-2022 11:05                3284
gearmanworker.unregisterall.php                    30-Sep-2022 11:05                3033
gearmanworker.wait.php                             30-Sep-2022 11:05                8664
gearmanworker.work.php                             30-Sep-2022 11:05                5524
gender-gender.connect.php                          30-Sep-2022 11:04                2447
gender-gender.construct.php                        30-Sep-2022 11:04                2383
gender-gender.country.php                          30-Sep-2022 11:04                3682
gender-gender.get.php                              30-Sep-2022 11:04                2690
gender-gender.isnick.php                           30-Sep-2022 11:04                3103
gender-gender.similarnames.php                     30-Sep-2022 11:04                2819
gender.example.admin.php                           30-Sep-2022 11:04                9701
gender.examples.php                                30-Sep-2022 11:04                1338
gender.installation.php                            30-Sep-2022 11:04                2144
gender.setup.php                                   30-Sep-2022 11:04                1345
generator.current.php                              30-Sep-2022 11:04                2147
generator.getreturn.php                            30-Sep-2022 11:04                4029
generator.key.php                                  30-Sep-2022 11:04                3993
generator.next.php                                 30-Sep-2022 11:04                2386
generator.rewind.php                               30-Sep-2022 11:04                2199
generator.send.php                                 30-Sep-2022 11:04                5826
generator.throw.php                                30-Sep-2022 11:04                5408
generator.valid.php                                30-Sep-2022 11:04                2155
generator.wakeup.php                               30-Sep-2022 11:04                2203
geoip.configuration.php                            30-Sep-2022 11:05                2462
geoip.constants.php                                30-Sep-2022 11:05                4512
geoip.installation.php                             30-Sep-2022 11:05                1874
geoip.requirements.php                             30-Sep-2022 11:05                1795
geoip.resources.php                                30-Sep-2022 11:05                1203
geoip.setup.php                                    30-Sep-2022 11:05                1559
gettext.configuration.php                          30-Sep-2022 11:04                1231
gettext.constants.php                              30-Sep-2022 11:04                1157
gettext.installation.php                           30-Sep-2022 11:04                1423
gettext.requirements.php                           30-Sep-2022 11:04                1385
gettext.resources.php                              30-Sep-2022 11:04                1217
gettext.setup.php                                  30-Sep-2022 11:04                1604
getting-started.php                                30-Sep-2022 11:04                1948
globiterator.construct.php                         30-Sep-2022 11:05                7933
globiterator.count.php                             30-Sep-2022 11:05                4474
gmagick.addimage.php                               30-Sep-2022 11:04                2965
gmagick.addnoiseimage.php                          30-Sep-2022 11:04                2937
gmagick.annotateimage.php                          30-Sep-2022 11:04                4284
gmagick.blurimage.php                              30-Sep-2022 11:04                3188
gmagick.borderimage.php                            30-Sep-2022 11:04                3859
gmagick.charcoalimage.php                          30-Sep-2022 11:04                3161
gmagick.chopimage.php                              30-Sep-2022 11:04                3779
gmagick.clear.php                                  30-Sep-2022 11:04                2645
gmagick.commentimage.php                           30-Sep-2022 11:04                2839
gmagick.compositeimage.php                         30-Sep-2022 11:04                3956
gmagick.configuration.php                          30-Sep-2022 11:04                1249
gmagick.constants.php                              30-Sep-2022 11:04               69192
gmagick.construct.php                              30-Sep-2022 11:04                2575
gmagick.cropimage.php                              30-Sep-2022 11:04                3903
gmagick.cropthumbnailimage.php                     30-Sep-2022 11:04                3257
gmagick.current.php                                30-Sep-2022 11:04                2554
gmagick.cyclecolormapimage.php                     30-Sep-2022 11:04                3042
gmagick.deconstructimages.php                      30-Sep-2022 11:04                2746
gmagick.despeckleimage.php                         30-Sep-2022 11:04                3491
gmagick.destroy.php                                30-Sep-2022 11:04                2620
gmagick.drawimage.php                              30-Sep-2022 11:04                3044
gmagick.edgeimage.php                              30-Sep-2022 11:04                2990
gmagick.embossimage.php                            30-Sep-2022 11:04                3430
gmagick.enhanceimage.php                           30-Sep-2022 11:04                2674
gmagick.equalizeimage.php                          30-Sep-2022 11:04                2615
gmagick.examples.php                               30-Sep-2022 11:04                3733
gmagick.flipimage.php                              30-Sep-2022 11:04                2957
gmagick.flopimage.php                              30-Sep-2022 11:04                2955
gmagick.frameimage.php                             30-Sep-2022 11:04                4559
gmagick.gammaimage.php                             30-Sep-2022 11:04                3163
gmagick.getcopyright.php                           30-Sep-2022 11:04                2637
gmagick.getfilename.php                            30-Sep-2022 11:04                2608
gmagick.getimagebackgroundcolor.php                30-Sep-2022 11:04                2765
gmagick.getimageblueprimary.php                    30-Sep-2022 11:04                2959
gmagick.getimagebordercolor.php                    30-Sep-2022 11:04                2781
gmagick.getimagechanneldepth.php                   30-Sep-2022 11:04                2753
gmagick.getimagecolors.php                         30-Sep-2022 11:04                2591
gmagick.getimagecolorspace.php                     30-Sep-2022 11:04                2582
gmagick.getimagecompose.php                        30-Sep-2022 11:04                2608
gmagick.getimagedelay.php                          30-Sep-2022 11:04                2514
gmagick.getimagedepth.php                          30-Sep-2022 11:04                2493
gmagick.getimagedispose.php                        30-Sep-2022 11:04                2560
gmagick.getimageextrema.php                        30-Sep-2022 11:04                2750
gmagick.getimagefilename.php                       30-Sep-2022 11:04                2708
gmagick.getimageformat.php                         30-Sep-2022 11:04                2694
gmagick.getimagegamma.php                          30-Sep-2022 11:04                2514
gmagick.getimagegreenprimary.php                   30-Sep-2022 11:04                2637
gmagick.getimageheight.php                         30-Sep-2022 11:04                2527
gmagick.getimagehistogram.php                      30-Sep-2022 11:04                2826
gmagick.getimageindex.php                          30-Sep-2022 11:04                2661
gmagick.getimageinterlacescheme.php                30-Sep-2022 11:04                2769
gmagick.getimageiterations.php                     30-Sep-2022 11:04                2655
gmagick.getimagematte.php                          30-Sep-2022 11:04                2665
gmagick.getimagemattecolor.php                     30-Sep-2022 11:04                2682
gmagick.getimageprofile.php                        30-Sep-2022 11:04                2734
gmagick.getimageredprimary.php                     30-Sep-2022 11:04                2871
gmagick.getimagerenderingintent.php                30-Sep-2022 11:04                2657
gmagick.getimageresolution.php                     30-Sep-2022 11:04                2640
gmagick.getimagescene.php                          30-Sep-2022 11:04                2493
gmagick.getimagesignature.php                      30-Sep-2022 11:04                2661
gmagick.getimagetype.php                           30-Sep-2022 11:04                2506
gmagick.getimageunits.php                          30-Sep-2022 11:04                2299
gmagick.getimagewhitepoint.php                     30-Sep-2022 11:04                2642
gmagick.getimagewidth.php                          30-Sep-2022 11:04                2490
gmagick.getpackagename.php                         30-Sep-2022 11:04                2613
gmagick.getquantumdepth.php                        30-Sep-2022 11:04                2788
gmagick.getreleasedate.php                         30-Sep-2022 11:04                2709
gmagick.getsamplingfactors.php                     30-Sep-2022 11:04                2658
gmagick.getsize.php                                30-Sep-2022 11:04                2743
gmagick.getversion.php                             30-Sep-2022 11:04                2598
gmagick.hasnextimage.php                           30-Sep-2022 11:04                2709
gmagick.haspreviousimage.php                       30-Sep-2022 11:04                2746
gmagick.implodeimage.php                           30-Sep-2022 11:04                3036
gmagick.installation.php                           30-Sep-2022 11:04                2114
gmagick.labelimage.php                             30-Sep-2022 11:04                2745
gmagick.levelimage.php                             30-Sep-2022 11:04                4740
gmagick.magnifyimage.php                           30-Sep-2022 11:04                2661
gmagick.mapimage.php                               30-Sep-2022 11:04                3281
gmagick.medianfilterimage.php                      30-Sep-2022 11:04                3014
gmagick.minifyimage.php                            30-Sep-2022 11:04                2623
gmagick.modulateimage.php                          30-Sep-2022 11:04                3909
gmagick.motionblurimage.php                        30-Sep-2022 11:04                3871
gmagick.newimage.php                               30-Sep-2022 11:04                3841
gmagick.nextimage.php                              30-Sep-2022 11:04                2653
gmagick.normalizeimage.php                         30-Sep-2022 11:04                3008
gmagick.oilpaintimage.php                          30-Sep-2022 11:04                2986
gmagick.previousimage.php                          30-Sep-2022 11:04                2652
gmagick.profileimage.php                           30-Sep-2022 11:04                3437
gmagick.quantizeimage.php                          30-Sep-2022 11:04                5520
gmagick.quantizeimages.php                         30-Sep-2022 11:04                5434
gmagick.queryfontmetrics.php                       30-Sep-2022 11:04                2889
gmagick.queryfonts.php                             30-Sep-2022 11:04                2647
gmagick.queryformats.php                           30-Sep-2022 11:04                2953
gmagick.radialblurimage.php                        30-Sep-2022 11:04                3165
gmagick.raiseimage.php                             30-Sep-2022 11:04                4175
gmagick.read.php                                   30-Sep-2022 11:04                2715
gmagick.readimage.php                              30-Sep-2022 11:04                2766
gmagick.readimageblob.php                          30-Sep-2022 11:04                3148
gmagick.readimagefile.php                          30-Sep-2022 11:04                3011
gmagick.reducenoiseimage.php                       30-Sep-2022 11:04                3224
gmagick.removeimage.php                            30-Sep-2022 11:04                2617
gmagick.removeimageprofile.php                     30-Sep-2022 11:04                2797
gmagick.requirements.php                           30-Sep-2022 11:04                1717
gmagick.resampleimage.php                          30-Sep-2022 11:04                3884
gmagick.resizeimage.php                            30-Sep-2022 11:04                4092
gmagick.rollimage.php                              30-Sep-2022 11:04                3015
gmagick.rotateimage.php                            30-Sep-2022 11:04                3244
gmagick.scaleimage.php                             30-Sep-2022 11:04                3407
gmagick.separateimagechannel.php                   30-Sep-2022 11:04                3185
gmagick.setcompressionquality.php                  30-Sep-2022 11:04                4222
gmagick.setfilename.php                            30-Sep-2022 11:04                2951
gmagick.setimagebackgroundcolor.php                30-Sep-2022 11:04                3069
gmagick.setimageblueprimary.php                    30-Sep-2022 11:04                3254
gmagick.setimagebordercolor.php                    30-Sep-2022 11:04                3024
gmagick.setimagechanneldepth.php                   30-Sep-2022 11:04                3401
gmagick.setimagecolorspace.php                     30-Sep-2022 11:04                3115
gmagick.setimagecompose.php                        30-Sep-2022 11:04                2872
gmagick.setimagedelay.php                          30-Sep-2022 11:04                2860
gmagick.setimagedepth.php                          30-Sep-2022 11:04                2869
gmagick.setimagedispose.php                        30-Sep-2022 11:04                2914
gmagick.setimagefilename.php                       30-Sep-2022 11:04                2966
gmagick.setimageformat.php                         30-Sep-2022 11:04                2894
gmagick.setimagegamma.php                          30-Sep-2022 11:04                2841
gmagick.setimagegreenprimary.php                   30-Sep-2022 11:04                3266
gmagick.setimageindex.php                          30-Sep-2022 11:04                3003
gmagick.setimageinterlacescheme.php                30-Sep-2022 11:04                3176
gmagick.setimageiterations.php                     30-Sep-2022 11:04                2951
gmagick.setimageprofile.php                        30-Sep-2022 11:04                3342
gmagick.setimageredprimary.php                     30-Sep-2022 11:04                3209
gmagick.setimagerenderingintent.php                30-Sep-2022 11:04                3134
gmagick.setimageresolution.php                     30-Sep-2022 11:04                3153
gmagick.setimagescene.php                          30-Sep-2022 11:04                2845
gmagick.setimagetype.php                           30-Sep-2022 11:04                2964
gmagick.setimageunits.php                          30-Sep-2022 11:04                3059
gmagick.setimagewhitepoint.php                     30-Sep-2022 11:04                3258
gmagick.setsamplingfactors.php                     30-Sep-2022 11:04                3055
gmagick.setsize.php                                30-Sep-2022 11:04                3265
gmagick.setup.php                                  30-Sep-2022 11:04                1519
gmagick.shearimage.php                             30-Sep-2022 11:04                4006
gmagick.solarizeimage.php                          30-Sep-2022 11:04                3119
gmagick.spreadimage.php                            30-Sep-2022 11:04                2972
gmagick.stripimage.php                             30-Sep-2022 11:04                2626
gmagick.swirlimage.php                             30-Sep-2022 11:04                3024
gmagick.thumbnailimage.php                         30-Sep-2022 11:04                3734
gmagick.trimimage.php                              30-Sep-2022 11:04                3079
gmagick.write.php                                  30-Sep-2022 11:04                1692
gmagick.writeimage.php                             30-Sep-2022 11:04                3364
gmagickdraw.annotate.php                           30-Sep-2022 11:04                3060
gmagickdraw.arc.php                                30-Sep-2022 11:04                4040
gmagickdraw.bezier.php                             30-Sep-2022 11:04                2577
gmagickdraw.ellipse.php                            30-Sep-2022 11:04                3986
gmagickdraw.getfillcolor.php                       30-Sep-2022 11:04                2484
gmagickdraw.getfillopacity.php                     30-Sep-2022 11:04                2453
gmagickdraw.getfont.php                            30-Sep-2022 11:04                2519
gmagickdraw.getfontsize.php                        30-Sep-2022 11:04                2463
gmagickdraw.getfontstyle.php                       30-Sep-2022 11:04                2521
gmagickdraw.getfontweight.php                      30-Sep-2022 11:04                2417
gmagickdraw.getstrokecolor.php                     30-Sep-2022 11:04                2521
gmagickdraw.getstrokeopacity.php                   30-Sep-2022 11:04                2362
gmagickdraw.getstrokewidth.php                     30-Sep-2022 11:04                2355
gmagickdraw.gettextdecoration.php                  30-Sep-2022 11:04                2407
gmagickdraw.gettextencoding.php                    30-Sep-2022 11:04                2617
gmagickdraw.line.php                               30-Sep-2022 11:04                3524
gmagickdraw.point.php                              30-Sep-2022 11:04                2821
gmagickdraw.polygon.php                            30-Sep-2022 11:04                2677
gmagickdraw.polyline.php                           30-Sep-2022 11:04                2713
gmagickdraw.rectangle.php                          30-Sep-2022 11:04                3535
gmagickdraw.rotate.php                             30-Sep-2022 11:04                2571
gmagickdraw.roundrectangle.php                     30-Sep-2022 11:04                4118
gmagickdraw.scale.php                              30-Sep-2022 11:04                2890
gmagickdraw.setfillcolor.php                       30-Sep-2022 11:04                2964
gmagickdraw.setfillopacity.php                     30-Sep-2022 11:04                2816
gmagickdraw.setfont.php                            30-Sep-2022 11:04                2652
gmagickdraw.setfontsize.php                        30-Sep-2022 11:04                2733
gmagickdraw.setfontstyle.php                       30-Sep-2022 11:04                2832
gmagickdraw.setfontweight.php                      30-Sep-2022 11:04                2745
gmagickdraw.setstrokecolor.php                     30-Sep-2022 11:04                2999
gmagickdraw.setstrokeopacity.php                   30-Sep-2022 11:04                2772
gmagickdraw.setstrokewidth.php                     30-Sep-2022 11:04                2682
gmagickdraw.settextdecoration.php                  30-Sep-2022 11:04                2816
gmagickdraw.settextencoding.php                    30-Sep-2022 11:04                3146
gmagickpixel.construct.php                         30-Sep-2022 11:04                2514
gmagickpixel.getcolor.php                          30-Sep-2022 11:04                4017
gmagickpixel.getcolorcount.php                     30-Sep-2022 11:04                2500
gmagickpixel.getcolorvalue.php                     30-Sep-2022 11:04                2890
gmagickpixel.setcolor.php                          30-Sep-2022 11:04                3078
gmagickpixel.setcolorvalue.php                     30-Sep-2022 11:04                3245
gmp.configuration.php                              30-Sep-2022 11:05                1221
gmp.constants.php                                  30-Sep-2022 11:05                3154
gmp.examples.php                                   30-Sep-2022 11:05                3240
gmp.installation.php                               30-Sep-2022 11:05                1324
gmp.requirements.php                               30-Sep-2022 11:05                1740
gmp.serialize.php                                  30-Sep-2022 11:05                2207
gmp.setup.php                                      30-Sep-2022 11:05                1484
gmp.unserialize.php                                30-Sep-2022 11:05                2507
gnupg.configuration.php                            30-Sep-2022 11:05                1215
gnupg.constants.php                                30-Sep-2022 11:05                6374
gnupg.examples-clearsign.php                       30-Sep-2022 11:05                6965
gnupg.examples.php                                 30-Sep-2022 11:05                1363
gnupg.installation.php                             30-Sep-2022 11:05                1709
gnupg.requirements.php                             30-Sep-2022 11:05                1257
gnupg.resources.php                                30-Sep-2022 11:05                1203
gnupg.setup.php                                    30-Sep-2022 11:05                1578
hash.configuration.php                             30-Sep-2022 11:04                1210
hash.constants.php                                 30-Sep-2022 11:04                1699
hash.installation.php                              30-Sep-2022 11:04                1716
hash.requirements.php                              30-Sep-2022 11:04                1215
hash.resources.php                                 30-Sep-2022 11:04                1341
hash.setup.php                                     30-Sep-2022 11:04                1556
hashcontext.construct.php                          30-Sep-2022 11:04                1912
hashcontext.serialize.php                          30-Sep-2022 11:04                2353
hashcontext.unserialize.php                        30-Sep-2022 11:04                2633
history.php                                        30-Sep-2022 11:05                2331
history.php.books.php                              30-Sep-2022 11:05                2726
history.php.php                                    30-Sep-2022 11:05               12257
history.php.publications.php                       30-Sep-2022 11:05                1852
history.php.related.php                            30-Sep-2022 11:05                6765
hrtime-performancecounter.getfrequency.php         30-Sep-2022 11:04                2703
hrtime-performancecounter.getticks.php             30-Sep-2022 11:04                2537
hrtime-performancecounter.gettickssince.php        30-Sep-2022 11:04                2804
hrtime-stopwatch.getelapsedticks.php               30-Sep-2022 11:04                2478
hrtime-stopwatch.getelapsedtime.php                30-Sep-2022 11:04                2830
hrtime-stopwatch.getlastelapsedticks.php           30-Sep-2022 11:04                2537
hrtime-stopwatch.getlastelapsedtime.php            30-Sep-2022 11:04                2838
hrtime-stopwatch.isrunning.php                     30-Sep-2022 11:04                2405
hrtime-stopwatch.start.php                         30-Sep-2022 11:04                2375
hrtime-stopwatch.stop.php                          30-Sep-2022 11:04                2227
hrtime.example.basic.php                           30-Sep-2022 11:04                6043
hrtime.examples.php                                30-Sep-2022 11:04                1331
hrtime.installation.php                            30-Sep-2022 11:04                2127
hrtime.setup.php                                   30-Sep-2022 11:04                1342
ibase.configuration.php                            30-Sep-2022 11:04                7537
ibase.constants.php                                30-Sep-2022 11:04               18679
ibase.installation.php                             30-Sep-2022 11:04                3606
ibase.requirements.php                             30-Sep-2022 11:04                1190
ibase.resources.php                                30-Sep-2022 11:04                1203
ibase.setup.php                                    30-Sep-2022 11:04                1598
ibm-db2.configuration.php                          30-Sep-2022 11:04               10262
ibm-db2.constants.php                              30-Sep-2022 11:04                7162
ibm-db2.installation.php                           30-Sep-2022 11:04                3944
ibm-db2.requirements.php                           30-Sep-2022 11:04                3314
ibm-db2.resources.php                              30-Sep-2022 11:04                1315
ibm-db2.setup.php                                  30-Sep-2022 11:04                1611
iconv.configuration.php                            30-Sep-2022 11:04                4892
iconv.constants.php                                30-Sep-2022 11:04                3226
iconv.installation.php                             30-Sep-2022 11:04                1664
iconv.requirements.php                             30-Sep-2022 11:04                1441
iconv.resources.php                                30-Sep-2022 11:04                1203
iconv.setup.php                                    30-Sep-2022 11:04                1584
igbinary.configuration.php                         30-Sep-2022 11:05                3430
igbinary.installation.php                          30-Sep-2022 11:05                2155
igbinary.requirements.php                          30-Sep-2022 11:05                1211
igbinary.setup.php                                 30-Sep-2022 11:05                1529
image.configuration.php                            30-Sep-2022 11:04                3420
image.constants.php                                30-Sep-2022 11:04               41503
image.examples-png.php                             30-Sep-2022 11:04                4946
image.examples-watermark.php                       30-Sep-2022 11:04                6489
image.examples.merged-watermark.php                30-Sep-2022 11:04                9381
image.examples.php                                 30-Sep-2022 11:04                1665
image.installation.php                             30-Sep-2022 11:04                6376
image.requirements.php                             30-Sep-2022 11:04                4096
image.resources.php                                30-Sep-2022 11:04                2080
image.setup.php                                    30-Sep-2022 11:04                1580
imagick.adaptiveblurimage.php                      30-Sep-2022 11:04                6828
imagick.adaptiveresizeimage.php                    30-Sep-2022 11:04                9358
imagick.adaptivesharpenimage.php                   30-Sep-2022 11:04                6402
imagick.adaptivethresholdimage.php                 30-Sep-2022 11:04                6173
imagick.addimage.php                               30-Sep-2022 11:04                2949
imagick.addnoiseimage.php                          30-Sep-2022 11:04                5476
imagick.affinetransformimage.php                   30-Sep-2022 11:04                6994
imagick.animateimages.php                          30-Sep-2022 11:04                3051
imagick.annotateimage.php                          30-Sep-2022 11:04                8866
imagick.appendimages.php                           30-Sep-2022 11:04                6975
imagick.autolevelimage.php                         30-Sep-2022 11:04                4375
imagick.averageimages.php                          30-Sep-2022 11:04                2878
imagick.blackthresholdimage.php                    30-Sep-2022 11:04                5639
imagick.blueshiftimage.php                         30-Sep-2022 11:04                4444
imagick.blurimage.php                              30-Sep-2022 11:04                5813
imagick.borderimage.php                            30-Sep-2022 11:04                6385
imagick.brightnesscontrastimage.php                30-Sep-2022 11:04                5496
imagick.charcoalimage.php                          30-Sep-2022 11:04                4917
imagick.chopimage.php                              30-Sep-2022 11:04                7058
imagick.clampimage.php                             30-Sep-2022 11:04                2470
imagick.clear.php                                  30-Sep-2022 11:04                2177
imagick.clipimage.php                              30-Sep-2022 11:04                2504
imagick.clipimagepath.php                          30-Sep-2022 11:04                2962
imagick.clippathimage.php                          30-Sep-2022 11:04                3358
imagick.clone.php                                  30-Sep-2022 11:04                4384
imagick.clutimage.php                              30-Sep-2022 11:04                6211
imagick.coalesceimages.php                         30-Sep-2022 11:04                2961
imagick.colorfloodfillimage.php                    30-Sep-2022 11:04                5789
imagick.colorizeimage.php                          30-Sep-2022 11:04                7190
imagick.colormatriximage.php                       30-Sep-2022 11:04                8403
imagick.combineimages.php                          30-Sep-2022 11:04                3353
imagick.commentimage.php                           30-Sep-2022 11:04                5129
imagick.compareimagechannels.php                   30-Sep-2022 11:04                3904
imagick.compareimagelayers.php                     30-Sep-2022 11:04                5778
imagick.compareimages.php                          30-Sep-2022 11:04                5713
imagick.compositeimage.php                         30-Sep-2022 11:04                7994
imagick.configuration.php                          30-Sep-2022 11:04                4291
imagick.constants.php                              30-Sep-2022 11:04              109968
imagick.construct.php                              30-Sep-2022 11:04                2776
imagick.contrastimage.php                          30-Sep-2022 11:04                5186
imagick.contraststretchimage.php                   30-Sep-2022 11:04                3698
imagick.convolveimage.php                          30-Sep-2022 11:04                6097
imagick.count.php                                  30-Sep-2022 11:04                2584
imagick.cropimage.php                              30-Sep-2022 11:04                6115
imagick.cropthumbnailimage.php                     30-Sep-2022 11:04                3290
imagick.current.php                                30-Sep-2022 11:04                2573
imagick.cyclecolormapimage.php                     30-Sep-2022 11:04                2964
imagick.decipherimage.php                          30-Sep-2022 11:04                3079
imagick.deconstructimages.php                      30-Sep-2022 11:04                2754
imagick.deleteimageartifact.php                    30-Sep-2022 11:04                3742
imagick.deleteimageproperty.php                    30-Sep-2022 11:04                2458
imagick.deskewimage.php                            30-Sep-2022 11:04               11778
imagick.despeckleimage.php                         30-Sep-2022 11:04                4372
imagick.destroy.php                                30-Sep-2022 11:04                2311
imagick.displayimage.php                           30-Sep-2022 11:04                2717
imagick.displayimages.php                          30-Sep-2022 11:04                2756
imagick.distortimage.php                           30-Sep-2022 11:04               13317
imagick.drawimage.php                              30-Sep-2022 11:04                2536
imagick.edgeimage.php                              30-Sep-2022 11:04                4775
imagick.embossimage.php                            30-Sep-2022 11:04                5430
imagick.encipherimage.php                          30-Sep-2022 11:04                3158
imagick.enhanceimage.php                           30-Sep-2022 11:04                4345
imagick.equalizeimage.php                          30-Sep-2022 11:04                4323
imagick.evaluateimage.php                          30-Sep-2022 11:04                5973
imagick.examples-1.php                             30-Sep-2022 11:04               33785
imagick.examples.php                               30-Sep-2022 11:04                1361
imagick.exportimagepixels.php                      30-Sep-2022 11:04                7946
imagick.extentimage.php                            30-Sep-2022 11:04                5373
imagick.filter.php                                 30-Sep-2022 11:04                7916
imagick.flattenimages.php                          30-Sep-2022 11:04                2934
imagick.flipimage.php                              30-Sep-2022 11:04                4680
imagick.floodfillpaintimage.php                    30-Sep-2022 11:04               11919
imagick.flopimage.php                              30-Sep-2022 11:04                4713
imagick.forwardfouriertransformimage.php           30-Sep-2022 11:04               12997
imagick.frameimage.php                             30-Sep-2022 11:04                8772
imagick.functionimage.php                          30-Sep-2022 11:04               13957
imagick.fximage.php                                30-Sep-2022 11:04                6306
imagick.gammaimage.php                             30-Sep-2022 11:04                5793
imagick.gaussianblurimage.php                      30-Sep-2022 11:04                6307
imagick.getcolorspace.php                          30-Sep-2022 11:04                2448
imagick.getcompression.php                         30-Sep-2022 11:04                2203
imagick.getcompressionquality.php                  30-Sep-2022 11:04                2290
imagick.getcopyright.php                           30-Sep-2022 11:04                2268
imagick.getfilename.php                            30-Sep-2022 11:04                2470
imagick.getfont.php                                30-Sep-2022 11:04                3196
imagick.getformat.php                              30-Sep-2022 11:04                2442
imagick.getgravity.php                             30-Sep-2022 11:04                2431
imagick.gethomeurl.php                             30-Sep-2022 11:04                2185
imagick.getimage.php                               30-Sep-2022 11:04                2477
imagick.getimagealphachannel.php                   30-Sep-2022 11:04                3436
imagick.getimageartifact.php                       30-Sep-2022 11:04                3691
imagick.getimageattribute.php                      30-Sep-2022 11:04                2718
imagick.getimagebackgroundcolor.php                30-Sep-2022 11:04                2681
imagick.getimageblob.php                           30-Sep-2022 11:04                2873
imagick.getimageblueprimary.php                    30-Sep-2022 11:04                2970
imagick.getimagebordercolor.php                    30-Sep-2022 11:04                2692
imagick.getimagechanneldepth.php                   30-Sep-2022 11:04                3033
imagick.getimagechanneldistortion.php              30-Sep-2022 11:04                3995
imagick.getimagechanneldistortions.php             30-Sep-2022 11:04                4377
imagick.getimagechannelextrema.php                 30-Sep-2022 11:04                3654
imagick.getimagechannelkurtosis.php                30-Sep-2022 11:04                3597
imagick.getimagechannelmean.php                    30-Sep-2022 11:04                3295
imagick.getimagechannelrange.php                   30-Sep-2022 11:04                3483
imagick.getimagechannelstatistics.php              30-Sep-2022 11:04                2526
imagick.getimageclipmask.php                       30-Sep-2022 11:04                3153
imagick.getimagecolormapcolor.php                  30-Sep-2022 11:04                2966
imagick.getimagecolors.php                         30-Sep-2022 11:04                2311
imagick.getimagecolorspace.php                     30-Sep-2022 11:04                2380
imagick.getimagecompose.php                        30-Sep-2022 11:04                2318
imagick.getimagecompression.php                    30-Sep-2022 11:04                2297
imagick.getimagecompressionquality.php             30-Sep-2022 11:04                2408
imagick.getimagedelay.php                          30-Sep-2022 11:04                2617
imagick.getimagedepth.php                          30-Sep-2022 11:04                2188
imagick.getimagedispose.php                        30-Sep-2022 11:04                2525
imagick.getimagedistortion.php                     30-Sep-2022 11:04                3281
imagick.getimageextrema.php                        30-Sep-2022 11:04                2960
imagick.getimagefilename.php                       30-Sep-2022 11:04                2610
imagick.getimageformat.php                         30-Sep-2022 11:04                2557
imagick.getimagegamma.php                          30-Sep-2022 11:04                2492
imagick.getimagegeometry.php                       30-Sep-2022 11:04                4274
imagick.getimagegravity.php                        30-Sep-2022 11:04                2779
imagick.getimagegreenprimary.php                   30-Sep-2022 11:04                2888
imagick.getimageheight.php                         30-Sep-2022 11:04                2523
imagick.getimagehistogram.php                      30-Sep-2022 11:04               20077
imagick.getimageindex.php                          30-Sep-2022 11:04                3041
imagick.getimageinterlacescheme.php                30-Sep-2022 11:04                2517
imagick.getimageinterpolatemethod.php              30-Sep-2022 11:04                2798
imagick.getimageiterations.php                     30-Sep-2022 11:04                2566
imagick.getimagelength.php                         30-Sep-2022 11:04                3388
imagick.getimagematte.php                          30-Sep-2022 11:04                2744
imagick.getimagemattecolor.php                     30-Sep-2022 11:04                2945
imagick.getimagemimetype.php                       30-Sep-2022 11:04                2195
imagick.getimageorientation.php                    30-Sep-2022 11:04                2699
imagick.getimagepage.php                           30-Sep-2022 11:04                3005
imagick.getimagepixelcolor.php                     30-Sep-2022 11:04                3211
imagick.getimageprofile.php                        30-Sep-2022 11:04                2796
imagick.getimageprofiles.php                       30-Sep-2022 11:04                3346
imagick.getimageproperties.php                     30-Sep-2022 11:04                5826
imagick.getimageproperty.php                       30-Sep-2022 11:04                5023
imagick.getimageredprimary.php                     30-Sep-2022 11:04                2844
imagick.getimageregion.php                         30-Sep-2022 11:04                3900
imagick.getimagerenderingintent.php                30-Sep-2022 11:04                2690
imagick.getimageresolution.php                     30-Sep-2022 11:04                2593
imagick.getimagesblob.php                          30-Sep-2022 11:04                2719
imagick.getimagescene.php                          30-Sep-2022 11:04                2485
imagick.getimagesignature.php                      30-Sep-2022 11:04                2563
imagick.getimagesize.php                           30-Sep-2022 11:04                2704
imagick.getimagetickspersecond.php                 30-Sep-2022 11:04                2615
imagick.getimagetotalinkdensity.php                30-Sep-2022 11:04                2490
imagick.getimagetype.php                           30-Sep-2022 11:04                4092
imagick.getimageunits.php                          30-Sep-2022 11:04                2552
imagick.getimagevirtualpixelmethod.php             30-Sep-2022 11:04                2699
imagick.getimagewhitepoint.php                     30-Sep-2022 11:04                2758
imagick.getimagewidth.php                          30-Sep-2022 11:04                2500
imagick.getinterlacescheme.php                     30-Sep-2022 11:04                2652
imagick.getiteratorindex.php                       30-Sep-2022 11:04                6328
imagick.getnumberimages.php                        30-Sep-2022 11:04                2553
imagick.getoption.php                              30-Sep-2022 11:04                2897
imagick.getpackagename.php                         30-Sep-2022 11:04                2517
imagick.getpage.php                                30-Sep-2022 11:04                2957
imagick.getpixeliterator.php                       30-Sep-2022 11:04                6983
imagick.getpixelregioniterator.php                 30-Sep-2022 11:04                7391
imagick.getpointsize.php                           30-Sep-2022 11:04                2797
imagick.getquantum.php                             30-Sep-2022 11:04                2158
imagick.getquantumdepth.php                        30-Sep-2022 11:04                2836
imagick.getquantumrange.php                        30-Sep-2022 11:04                2934
imagick.getregistry.php                            30-Sep-2022 11:04                2374
imagick.getreleasedate.php                         30-Sep-2022 11:04                2602
imagick.getresource.php                            30-Sep-2022 11:04                2927
imagick.getresourcelimit.php                       30-Sep-2022 11:04                3378
imagick.getsamplingfactors.php                     30-Sep-2022 11:04                2656
imagick.getsize.php                                30-Sep-2022 11:04                6127
imagick.getsizeoffset.php                          30-Sep-2022 11:04                2646
imagick.getversion.php                             30-Sep-2022 11:04                2593
imagick.haldclutimage.php                          30-Sep-2022 11:04                6261
imagick.hasnextimage.php                           30-Sep-2022 11:04                2366
imagick.haspreviousimage.php                       30-Sep-2022 11:04                2438
imagick.identifyformat.php                         30-Sep-2022 11:04                4500
imagick.identifyimage.php                          30-Sep-2022 11:04                3937
imagick.implodeimage.php                           30-Sep-2022 11:04                4702
imagick.importimagepixels.php                      30-Sep-2022 11:04               12178
imagick.installation.php                           30-Sep-2022 11:04                3324
imagick.inversefouriertransformimage.php           30-Sep-2022 11:04                3302
imagick.labelimage.php                             30-Sep-2022 11:04                2435
imagick.levelimage.php                             30-Sep-2022 11:04                7854
imagick.linearstretchimage.php                     30-Sep-2022 11:04                5700
imagick.liquidrescaleimage.php                     30-Sep-2022 11:04                4385
imagick.listregistry.php                           30-Sep-2022 11:04                2277
imagick.magnifyimage.php                           30-Sep-2022 11:04                4331
imagick.mapimage.php                               30-Sep-2022 11:04                3200
imagick.mattefloodfillimage.php                    30-Sep-2022 11:04                5723
imagick.medianfilterimage.php                      30-Sep-2022 11:04                5241
imagick.mergeimagelayers.php                       30-Sep-2022 11:04                6863
imagick.minifyimage.php                            30-Sep-2022 11:04                2374
imagick.modulateimage.php                          30-Sep-2022 11:04                5538
imagick.montageimage.php                           30-Sep-2022 11:04                4427
imagick.morphimages.php                            30-Sep-2022 11:04                2886
imagick.morphology.php                             30-Sep-2022 11:04               75799
imagick.mosaicimages.php                           30-Sep-2022 11:04                2733
imagick.motionblurimage.php                        30-Sep-2022 11:04                6706
imagick.negateimage.php                            30-Sep-2022 11:04                5701
imagick.newimage.php                               30-Sep-2022 11:04                6415
imagick.newpseudoimage.php                         30-Sep-2022 11:04                5874
imagick.nextimage.php                              30-Sep-2022 11:04                2207
imagick.normalizeimage.php                         30-Sep-2022 11:04                6523
imagick.oilpaintimage.php                          30-Sep-2022 11:04                4557
imagick.opaquepaintimage.php                       30-Sep-2022 11:04                5010
imagick.optimizeimagelayers.php                    30-Sep-2022 11:04                5573
imagick.orderedposterizeimage.php                  30-Sep-2022 11:04                6981
imagick.paintfloodfillimage.php                    30-Sep-2022 11:04                5977
imagick.paintopaqueimage.php                       30-Sep-2022 11:04                5544
imagick.painttransparentimage.php                  30-Sep-2022 11:04                4676
imagick.pingimage.php                              30-Sep-2022 11:04                2555
imagick.pingimageblob.php                          30-Sep-2022 11:04                6142
imagick.pingimagefile.php                          30-Sep-2022 11:04                5868
imagick.polaroidimage.php                          30-Sep-2022 11:04                4716
imagick.posterizeimage.php                         30-Sep-2022 11:04                5580
imagick.previewimages.php                          30-Sep-2022 11:04                3075
imagick.previousimage.php                          30-Sep-2022 11:04                2291
imagick.profileimage.php                           30-Sep-2022 11:04                3206
imagick.quantizeimage.php                          30-Sep-2022 11:04                6596
imagick.quantizeimages.php                         30-Sep-2022 11:04                3740
imagick.queryfontmetrics.php                       30-Sep-2022 11:04                5794
imagick.queryfonts.php                             30-Sep-2022 11:05                5156
imagick.queryformats.php                           30-Sep-2022 11:05                8343
imagick.radialblurimage.php                        30-Sep-2022 11:05                5574
imagick.raiseimage.php                             30-Sep-2022 11:05                6330
imagick.randomthresholdimage.php                   30-Sep-2022 11:05                6554
imagick.readimage.php                              30-Sep-2022 11:05                2393
imagick.readimageblob.php                          30-Sep-2022 11:05                5543
imagick.readimagefile.php                          30-Sep-2022 11:05                3047
imagick.readimages.php                             30-Sep-2022 11:05                2402
imagick.recolorimage.php                           30-Sep-2022 11:05                6812
imagick.reducenoiseimage.php                       30-Sep-2022 11:05                5427
imagick.remapimage.php                             30-Sep-2022 11:05                3484
imagick.removeimage.php                            30-Sep-2022 11:05                2475
imagick.removeimageprofile.php                     30-Sep-2022 11:05                2767
imagick.render.php                                 30-Sep-2022 11:05                2195
imagick.requirements.php                           30-Sep-2022 11:04                1593
imagick.resampleimage.php                          30-Sep-2022 11:05                5456
imagick.resetimagepage.php                         30-Sep-2022 11:05                2777
imagick.resizeimage.php                            30-Sep-2022 11:05               12066
imagick.resources.php                              30-Sep-2022 11:04                1217
imagick.rollimage.php                              30-Sep-2022 11:05                4749
imagick.rotateimage.php                            30-Sep-2022 11:05                5914
imagick.rotationalblurimage.php                    30-Sep-2022 11:05                5650
imagick.roundcorners.php                           30-Sep-2022 11:05                6495
imagick.sampleimage.php                            30-Sep-2022 11:05                2851
imagick.scaleimage.php                             30-Sep-2022 11:05                6944
imagick.segmentimage.php                           30-Sep-2022 11:05                6719
imagick.selectiveblurimage.php                     30-Sep-2022 11:05                6372
imagick.separateimagechannel.php                   30-Sep-2022 11:05                5534
imagick.sepiatoneimage.php                         30-Sep-2022 11:05                4949
imagick.setbackgroundcolor.php                     30-Sep-2022 11:05                3310
imagick.setcolorspace.php                          30-Sep-2022 11:05                3000
imagick.setcompression.php                         30-Sep-2022 11:05                2606
imagick.setcompressionquality.php                  30-Sep-2022 11:05                7394
imagick.setfilename.php                            30-Sep-2022 11:05                2487
imagick.setfirstiterator.php                       30-Sep-2022 11:05                2279
imagick.setfont.php                                30-Sep-2022 11:05                5820
imagick.setformat.php                              30-Sep-2022 11:05                2381
imagick.setgravity.php                             30-Sep-2022 11:05                2671
imagick.setimage.php                               30-Sep-2022 11:05                4947
imagick.setimagealphachannel.php                   30-Sep-2022 11:05                3680
imagick.setimageartifact.php                       30-Sep-2022 11:05                7606
imagick.setimageattribute.php                      30-Sep-2022 11:05                3128
imagick.setimagebackgroundcolor.php                30-Sep-2022 11:05                3667
imagick.setimagebias.php                           30-Sep-2022 11:05                7244
imagick.setimagebiasquantum.php                    30-Sep-2022 11:05                2876
imagick.setimageblueprimary.php                    30-Sep-2022 11:05                3010
imagick.setimagebordercolor.php                    30-Sep-2022 11:05                3640
imagick.setimagechanneldepth.php                   30-Sep-2022 11:05                3033
imagick.setimageclipmask.php                       30-Sep-2022 11:05                9596
imagick.setimagecolormapcolor.php                  30-Sep-2022 11:05                3126
imagick.setimagecolorspace.php                     30-Sep-2022 11:05                3264
imagick.setimagecompose.php                        30-Sep-2022 11:05                3044
imagick.setimagecompression.php                    30-Sep-2022 11:05                2891
imagick.setimagecompressionquality.php             30-Sep-2022 11:05                5001
imagick.setimagedelay.php                          30-Sep-2022 11:05                6448
imagick.setimagedepth.php                          30-Sep-2022 11:05                2716
imagick.setimagedispose.php                        30-Sep-2022 11:05                2740
imagick.setimageextent.php                         30-Sep-2022 11:05                2988
imagick.setimagefilename.php                       30-Sep-2022 11:05                2806
imagick.setimageformat.php                         30-Sep-2022 11:05                2617
imagick.setimagegamma.php                          30-Sep-2022 11:05                2700
imagick.setimagegravity.php                        30-Sep-2022 11:05                2885
imagick.setimagegreenprimary.php                   30-Sep-2022 11:05                3001
imagick.setimageindex.php                          30-Sep-2022 11:05                3344
imagick.setimageinterlacescheme.php                30-Sep-2022 11:05                2906
imagick.setimageinterpolatemethod.php              30-Sep-2022 11:05                2691
imagick.setimageiterations.php                     30-Sep-2022 11:05                5018
imagick.setimagematte.php                          30-Sep-2022 11:05                2683
imagick.setimagemattecolor.php                     30-Sep-2022 11:05                3872
imagick.setimageopacity.php                        30-Sep-2022 11:05                5141
imagick.setimageorientation.php                    30-Sep-2022 11:05                4650
imagick.setimagepage.php                           30-Sep-2022 11:05                3506
imagick.setimageprofile.php                        30-Sep-2022 11:05                3332
imagick.setimageproperty.php                       30-Sep-2022 11:05                5165
imagick.setimageredprimary.php                     30-Sep-2022 11:05                3003
imagick.setimagerenderingintent.php                30-Sep-2022 11:05                2870
imagick.setimageresolution.php                     30-Sep-2022 11:05                5057
imagick.setimagescene.php                          30-Sep-2022 11:05                2732
imagick.setimagetickspersecond.php                 30-Sep-2022 11:05                8531
imagick.setimagetype.php                           30-Sep-2022 11:05                2426
imagick.setimageunits.php                          30-Sep-2022 11:05                2478
imagick.setimagevirtualpixelmethod.php             30-Sep-2022 11:05                2785
imagick.setimagewhitepoint.php                     30-Sep-2022 11:05                3013
imagick.setinterlacescheme.php                     30-Sep-2022 11:05                2516
imagick.setiteratorindex.php                       30-Sep-2022 11:05                6281
imagick.setlastiterator.php                        30-Sep-2022 11:05                2297
imagick.setoption.php                              30-Sep-2022 11:05               12954
imagick.setpage.php                                30-Sep-2022 11:05                3161
imagick.setpointsize.php                           30-Sep-2022 11:05                5500
imagick.setprogressmonitor.php                     30-Sep-2022 11:05               12744
imagick.setregistry.php                            30-Sep-2022 11:05                2785
imagick.setresolution.php                          30-Sep-2022 11:05                3641
imagick.setresourcelimit.php                       30-Sep-2022 11:05                3549
imagick.setsamplingfactors.php                     30-Sep-2022 11:05                7191
imagick.setsize.php                                30-Sep-2022 11:05                2707
imagick.setsizeoffset.php                          30-Sep-2022 11:05                3100
imagick.settype.php                                30-Sep-2022 11:05                2374
imagick.setup.php                                  30-Sep-2022 11:04                1603
imagick.shadeimage.php                             30-Sep-2022 11:05                5431
imagick.shadowimage.php                            30-Sep-2022 11:05                5275
imagick.sharpenimage.php                           30-Sep-2022 11:05                5747
imagick.shaveimage.php                             30-Sep-2022 11:05                4698
imagick.shearimage.php                             30-Sep-2022 11:05                6571
imagick.sigmoidalcontrastimage.php                 30-Sep-2022 11:05                8276
imagick.sketchimage.php                            30-Sep-2022 11:05                5879
imagick.smushimages.php                            30-Sep-2022 11:05                5810
imagick.solarizeimage.php                          30-Sep-2022 11:05                4916
imagick.sparsecolorimage.php                       30-Sep-2022 11:05               31619
imagick.spliceimage.php                            30-Sep-2022 11:05                5659
imagick.spreadimage.php                            30-Sep-2022 11:05                4950
imagick.statisticimage.php                         30-Sep-2022 11:05                6713
imagick.steganoimage.php                           30-Sep-2022 11:05                3003
imagick.stereoimage.php                            30-Sep-2022 11:05                2826
imagick.stripimage.php                             30-Sep-2022 11:05                2526
imagick.subimagematch.php                          30-Sep-2022 11:05                7656
imagick.swirlimage.php                             30-Sep-2022 11:05                4859
imagick.textureimage.php                           30-Sep-2022 11:05                6539
imagick.thresholdimage.php                         30-Sep-2022 11:05                5243
imagick.thumbnailimage.php                         30-Sep-2022 11:05                7399
imagick.tintimage.php                              30-Sep-2022 11:05                8213
imagick.tostring.php                               30-Sep-2022 11:05                2931
imagick.transformimage.php                         30-Sep-2022 11:05                6174
imagick.transformimagecolorspace.php               30-Sep-2022 11:05                5832
imagick.transparentpaintimage.php                  30-Sep-2022 11:05                7476
imagick.transposeimage.php                         30-Sep-2022 11:05                4682
imagick.transverseimage.php                        30-Sep-2022 11:05                4677
imagick.trimimage.php                              30-Sep-2022 11:05                5981
imagick.uniqueimagecolors.php                      30-Sep-2022 11:05                5704
imagick.unsharpmaskimage.php                       30-Sep-2022 11:05                6649
imagick.valid.php                                  30-Sep-2022 11:05                2171
imagick.vignetteimage.php                          30-Sep-2022 11:05                6541
imagick.waveimage.php                              30-Sep-2022 11:05                6448
imagick.whitethresholdimage.php                    30-Sep-2022 11:05                5304
imagick.writeimage.php                             30-Sep-2022 11:05                2962
imagick.writeimagefile.php                         30-Sep-2022 11:05                3730
imagick.writeimages.php                            30-Sep-2022 11:05                2674
imagick.writeimagesfile.php                        30-Sep-2022 11:05                3821
imagickdraw.affine.php                             30-Sep-2022 11:05               18756
imagickdraw.annotation.php                         30-Sep-2022 11:05                3126
imagickdraw.arc.php                                30-Sep-2022 11:05               10040
imagickdraw.bezier.php                             30-Sep-2022 11:05               19744
imagickdraw.circle.php                             30-Sep-2022 11:05                9265
imagickdraw.clear.php                              30-Sep-2022 11:05                2313
imagickdraw.clone.php                              30-Sep-2022 11:05                2421
imagickdraw.color.php                              30-Sep-2022 11:05                3355
imagickdraw.comment.php                            30-Sep-2022 11:05                2593
imagickdraw.composite.php                          30-Sep-2022 11:05               12272
imagickdraw.construct.php                          30-Sep-2022 11:05                2243
imagickdraw.destroy.php                            30-Sep-2022 11:05                2359
imagickdraw.ellipse.php                            30-Sep-2022 11:05               12517
imagickdraw.getclippath.php                        30-Sep-2022 11:05                2284
imagickdraw.getcliprule.php                        30-Sep-2022 11:05                2395
imagickdraw.getclipunits.php                       30-Sep-2022 11:05                2324
imagickdraw.getfillcolor.php                       30-Sep-2022 11:05                2414
imagickdraw.getfillopacity.php                     30-Sep-2022 11:05                2263
imagickdraw.getfillrule.php                        30-Sep-2022 11:05                2376
imagickdraw.getfont.php                            30-Sep-2022 11:05                2255
imagickdraw.getfontfamily.php                      30-Sep-2022 11:05                2335
imagickdraw.getfontsize.php                        30-Sep-2022 11:05                2338
imagickdraw.getfontstretch.php                     30-Sep-2022 11:05                2261
imagickdraw.getfontstyle.php                       30-Sep-2022 11:05                2502
imagickdraw.getfontweight.php                      30-Sep-2022 11:05                2321
imagickdraw.getgravity.php                         30-Sep-2022 11:05                2466
imagickdraw.getstrokeantialias.php                 30-Sep-2022 11:05                2649
imagickdraw.getstrokecolor.php                     30-Sep-2022 11:05                2781
imagickdraw.getstrokedasharray.php                 30-Sep-2022 11:05                2402
imagickdraw.getstrokedashoffset.php                30-Sep-2022 11:05                2387
imagickdraw.getstrokelinecap.php                   30-Sep-2022 11:05                2531
imagickdraw.getstrokelinejoin.php                  30-Sep-2022 11:05                2604
imagickdraw.getstrokemiterlimit.php                30-Sep-2022 11:05                2782
imagickdraw.getstrokeopacity.php                   30-Sep-2022 11:05                2367
imagickdraw.getstrokewidth.php                     30-Sep-2022 11:05                2291
imagickdraw.gettextalignment.php                   30-Sep-2022 11:05                2445
imagickdraw.gettextantialias.php                   30-Sep-2022 11:05                2510
imagickdraw.gettextdecoration.php                  30-Sep-2022 11:05                2489
imagickdraw.gettextencoding.php                    30-Sep-2022 11:05                2475
imagickdraw.gettextinterlinespacing.php            30-Sep-2022 11:05                2345
imagickdraw.gettextinterwordspacing.php            30-Sep-2022 11:05                2369
imagickdraw.gettextkerning.php                     30-Sep-2022 11:05                2267
imagickdraw.gettextundercolor.php                  30-Sep-2022 11:05                2491
imagickdraw.getvectorgraphics.php                  30-Sep-2022 11:05                2497
imagickdraw.line.php                               30-Sep-2022 11:05                8473
imagickdraw.matte.php                              30-Sep-2022 11:05                8422
imagickdraw.pathclose.php                          30-Sep-2022 11:05                2414
imagickdraw.pathcurvetoabsolute.php                30-Sep-2022 11:05                4873
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-Sep-2022 11:05               12504
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-Sep-2022 11:05                4276
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-Sep-2022 11:05               11422
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-Sep-2022 11:05               11688
imagickdraw.pathcurvetorelative.php                30-Sep-2022 11:05                4883
imagickdraw.pathcurvetosmoothabsolute.php          30-Sep-2022 11:05                4690
imagickdraw.pathcurvetosmoothrelative.php          30-Sep-2022 11:05                4699
imagickdraw.pathellipticarcabsolute.php            30-Sep-2022 11:05                5534
imagickdraw.pathellipticarcrelative.php            30-Sep-2022 11:05                5523
imagickdraw.pathfinish.php                         30-Sep-2022 11:05                2224
imagickdraw.pathlinetoabsolute.php                 30-Sep-2022 11:05                3126
imagickdraw.pathlinetohorizontalabsolute.php       30-Sep-2022 11:05                3024
imagickdraw.pathlinetohorizontalrelative.php       30-Sep-2022 11:05                3027
imagickdraw.pathlinetorelative.php                 30-Sep-2022 11:05                3167
imagickdraw.pathlinetoverticalabsolute.php         30-Sep-2022 11:05                2991
imagickdraw.pathlinetoverticalrelative.php         30-Sep-2022 11:05                2999
imagickdraw.pathmovetoabsolute.php                 30-Sep-2022 11:05                3166
imagickdraw.pathmovetorelative.php                 30-Sep-2022 11:05                3134
imagickdraw.pathstart.php                          30-Sep-2022 11:05               12743
imagickdraw.point.php                              30-Sep-2022 11:05                7127
imagickdraw.polygon.php                            30-Sep-2022 11:05                9597
imagickdraw.polyline.php                           30-Sep-2022 11:05                9644
imagickdraw.pop.php                                30-Sep-2022 11:05                2562
imagickdraw.popclippath.php                        30-Sep-2022 11:05                2199
imagickdraw.popdefs.php                            30-Sep-2022 11:05                8127
imagickdraw.poppattern.php                         30-Sep-2022 11:05                2281
imagickdraw.push.php                               30-Sep-2022 11:05                8796
imagickdraw.pushclippath.php                       30-Sep-2022 11:05                2907
imagickdraw.pushdefs.php                           30-Sep-2022 11:05                2538
imagickdraw.pushpattern.php                        30-Sep-2022 11:05               15249
imagickdraw.rectangle.php                          30-Sep-2022 11:05                8648
imagickdraw.render.php                             30-Sep-2022 11:05                2321
imagickdraw.resetvectorgraphics.php                30-Sep-2022 11:05                2290
imagickdraw.rotate.php                             30-Sep-2022 11:05                8035
imagickdraw.roundrectangle.php                     30-Sep-2022 11:05                9496
imagickdraw.scale.php                              30-Sep-2022 11:05                8387
imagickdraw.setclippath.php                        30-Sep-2022 11:05                8737
imagickdraw.setcliprule.php                        30-Sep-2022 11:05                9922
imagickdraw.setclipunits.php                       30-Sep-2022 11:05                9277
imagickdraw.setfillalpha.php                       30-Sep-2022 11:05                8082
imagickdraw.setfillcolor.php                       30-Sep-2022 11:05                8132
imagickdraw.setfillopacity.php                     30-Sep-2022 11:05                8107
imagickdraw.setfillpatternurl.php                  30-Sep-2022 11:05                3129
imagickdraw.setfillrule.php                        30-Sep-2022 11:05               14833
imagickdraw.setfont.php                            30-Sep-2022 11:05                9598
imagickdraw.setfontfamily.php                      30-Sep-2022 11:05               10326
imagickdraw.setfontsize.php                        30-Sep-2022 11:05                8697
imagickdraw.setfontstretch.php                     30-Sep-2022 11:05               10576
imagickdraw.setfontstyle.php                       30-Sep-2022 11:05                9386
imagickdraw.setfontweight.php                      30-Sep-2022 11:05                9559
imagickdraw.setgravity.php                         30-Sep-2022 11:05               11491
imagickdraw.setresolution.php                      30-Sep-2022 11:05                2670
imagickdraw.setstrokealpha.php                     30-Sep-2022 11:05                8781
imagickdraw.setstrokeantialias.php                 30-Sep-2022 11:05                9381
imagickdraw.setstrokecolor.php                     30-Sep-2022 11:05                8900
imagickdraw.setstrokedasharray.php                 30-Sep-2022 11:05               14021
imagickdraw.setstrokedashoffset.php                30-Sep-2022 11:05               10428
imagickdraw.setstrokelinecap.php                   30-Sep-2022 11:05                8997
imagickdraw.setstrokelinejoin.php                  30-Sep-2022 11:05               12642
imagickdraw.setstrokemiterlimit.php                30-Sep-2022 11:05               12278
imagickdraw.setstrokeopacity.php                   30-Sep-2022 11:05               10716
imagickdraw.setstrokepatternurl.php                30-Sep-2022 11:05                2828
imagickdraw.setstrokewidth.php                     30-Sep-2022 11:05                8801
imagickdraw.settextalignment.php                   30-Sep-2022 11:05                9860
imagickdraw.settextantialias.php                   30-Sep-2022 11:05                9317
imagickdraw.settextdecoration.php                  30-Sep-2022 11:05                7742
imagickdraw.settextencoding.php                    30-Sep-2022 11:05                3103
imagickdraw.settextinterlinespacing.php            30-Sep-2022 11:05                2782
imagickdraw.settextinterwordspacing.php            30-Sep-2022 11:05                2594
imagickdraw.settextkerning.php                     30-Sep-2022 11:05                2694
imagickdraw.settextundercolor.php                  30-Sep-2022 11:05                8147
imagickdraw.setvectorgraphics.php                  30-Sep-2022 11:05                9557
imagickdraw.setviewbox.php                         30-Sep-2022 11:05               10986
imagickdraw.skewx.php                              30-Sep-2022 11:05                8534
imagickdraw.skewy.php                              30-Sep-2022 11:05                8545
imagickdraw.translate.php                          30-Sep-2022 11:05                8785
imagickkernel.addkernel.php                        30-Sep-2022 11:05                7627
imagickkernel.addunitykernel.php                   30-Sep-2022 11:05               15986
imagickkernel.frombuiltin.php                      30-Sep-2022 11:05               29681
imagickkernel.frommatrix.php                       30-Sep-2022 11:05               26053
imagickkernel.getmatrix.php                        30-Sep-2022 11:05                8230
imagickkernel.scale.php                            30-Sep-2022 11:05               15187
imagickkernel.separate.php                         30-Sep-2022 11:05               11763
imagickpixel.clear.php                             30-Sep-2022 11:05                2314
imagickpixel.construct.php                         30-Sep-2022 11:05               14331
imagickpixel.destroy.php                           30-Sep-2022 11:05                2389
imagickpixel.getcolor.php                          30-Sep-2022 11:05                8157
imagickpixel.getcolorasstring.php                  30-Sep-2022 11:05                5087
imagickpixel.getcolorcount.php                     30-Sep-2022 11:05                5178
imagickpixel.getcolorquantum.php                   30-Sep-2022 11:05                2792
imagickpixel.getcolorvalue.php                     30-Sep-2022 11:05                9069
imagickpixel.getcolorvaluequantum.php              30-Sep-2022 11:05                6569
imagickpixel.gethsl.php                            30-Sep-2022 11:05                4719
imagickpixel.getindex.php                          30-Sep-2022 11:05                2177
imagickpixel.ispixelsimilar.php                    30-Sep-2022 11:05                3472
imagickpixel.ispixelsimilarquantum.php             30-Sep-2022 11:05                2981
imagickpixel.issimilar.php                         30-Sep-2022 11:05               22931
imagickpixel.setcolor.php                          30-Sep-2022 11:05                7923
imagickpixel.setcolorcount.php                     30-Sep-2022 11:05                2465
imagickpixel.setcolorvalue.php                     30-Sep-2022 11:05                4993
imagickpixel.setcolorvaluequantum.php              30-Sep-2022 11:05                8555
imagickpixel.sethsl.php                            30-Sep-2022 11:05                7721
imagickpixel.setindex.php                          30-Sep-2022 11:05                2400
imagickpixeliterator.clear.php                     30-Sep-2022 11:05                7253
imagickpixeliterator.construct.php                 30-Sep-2022 11:05                7182
imagickpixeliterator.destroy.php                   30-Sep-2022 11:05                2397
imagickpixeliterator.getcurrentiteratorrow.php     30-Sep-2022 11:05                2605
imagickpixeliterator.getiteratorrow.php            30-Sep-2022 11:05                2626
imagickpixeliterator.getnextiteratorrow.php        30-Sep-2022 11:05                8251
imagickpixeliterator.getpreviousiteratorrow.php    30-Sep-2022 11:05                2787
imagickpixeliterator.newpixeliterator.php          30-Sep-2022 11:05                2730
imagickpixeliterator.newpixelregioniterator.php    30-Sep-2022 11:05                4252
imagickpixeliterator.resetiterator.php             30-Sep-2022 11:05               10690
imagickpixeliterator.setiteratorfirstrow.php       30-Sep-2022 11:05                2541
imagickpixeliterator.setiteratorlastrow.php        30-Sep-2022 11:05                2536
imagickpixeliterator.setiteratorrow.php            30-Sep-2022 11:05                7970
imagickpixeliterator.synciterator.php              30-Sep-2022 11:05                2373
imap.configuration.php                             30-Sep-2022 11:05                3313
imap.constants.php                                 30-Sep-2022 11:05               18241
imap.installation.php                              30-Sep-2022 11:05                2873
imap.requirements.php                              30-Sep-2022 11:05                3129
imap.resources.php                                 30-Sep-2022 11:05                1427
imap.setup.php                                     30-Sep-2022 11:05                1572
index.php                                          30-Sep-2022 11:05               15947
indexes.examples.php                               30-Sep-2022 11:05              742094
indexes.functions.php                              30-Sep-2022 11:05             1227731
indexes.php                                        30-Sep-2022 11:05                1431
infiniteiterator.construct.php                     30-Sep-2022 11:05                5241
infiniteiterator.next.php                          30-Sep-2022 11:05                3210
info.configuration.php                             30-Sep-2022 11:04               19256
info.constants.php                                 30-Sep-2022 11:04               16179
info.installation.php                              30-Sep-2022 11:04                1238
info.requirements.php                              30-Sep-2022 11:04                1183
info.resources.php                                 30-Sep-2022 11:04                1196
info.setup.php                                     30-Sep-2022 11:04                1574
ini.core.php                                       30-Sep-2022 11:05               73081
ini.list.php                                       30-Sep-2022 11:05               88497
ini.php                                            30-Sep-2022 11:05                1557
ini.sections.php                                   30-Sep-2022 11:05                4178
inotify.configuration.php                          30-Sep-2022 11:04                1240
inotify.constants.php                              30-Sep-2022 11:04                8288
inotify.install.php                                30-Sep-2022 11:04                1910
inotify.requirements.php                           30-Sep-2022 11:04                1225
inotify.resources.php                              30-Sep-2022 11:04                1345
inotify.setup.php                                  30-Sep-2022 11:04                1604
install.cloud.azure.php                            30-Sep-2022 11:04                4595
install.cloud.ec2.php                              30-Sep-2022 11:04                1409
install.cloud.php                                  30-Sep-2022 11:04                1609
install.fpm.configuration.php                      30-Sep-2022 11:04               36617
install.fpm.install.php                            30-Sep-2022 11:04                2839
install.fpm.php                                    30-Sep-2022 11:04                3682
install.general.php                                30-Sep-2022 11:04                4488
install.macosx.bundled.php                         30-Sep-2022 11:04               10970
install.macosx.compile.php                         30-Sep-2022 11:04                1377
install.macosx.packages.php                        30-Sep-2022 11:04                3151
install.macosx.php                                 30-Sep-2022 11:04                1975
install.pecl.downloads.php                         30-Sep-2022 11:04                3730
install.pecl.intro.php                             30-Sep-2022 11:04                3247
install.pecl.pear.php                              30-Sep-2022 11:04                3034
install.pecl.php                                   30-Sep-2022 11:04                1996
install.pecl.php-config.php                        30-Sep-2022 11:04                4026
install.pecl.phpize.php                            30-Sep-2022 11:04                3228
install.pecl.static.php                            30-Sep-2022 11:04                3248
install.pecl.windows.php                           30-Sep-2022 11:04               10016
install.php                                        30-Sep-2022 11:04                5832
install.problems.bugs.php                          30-Sep-2022 11:04                2176
install.problems.faq.php                           30-Sep-2022 11:04                1303
install.problems.php                               30-Sep-2022 11:04                1549
install.problems.support.php                       30-Sep-2022 11:04                2320
install.unix.apache2.php                           30-Sep-2022 11:04               14036
install.unix.commandline.php                       30-Sep-2022 11:04                3951
install.unix.debian.php                            30-Sep-2022 11:04                7181
install.unix.lighttpd-14.php                       30-Sep-2022 11:04                6178
install.unix.litespeed.php                         30-Sep-2022 11:04                8978
install.unix.nginx.php                             30-Sep-2022 11:04                8755
install.unix.openbsd.php                           30-Sep-2022 11:04                5861
install.unix.php                                   30-Sep-2022 11:04                7646
install.unix.solaris.php                           30-Sep-2022 11:04                3956
install.windows.apache2.php                        30-Sep-2022 11:04                6978
install.windows.building.php                       30-Sep-2022 11:04                1667
install.windows.commandline.php                    30-Sep-2022 11:04                8155
install.windows.manual.php                         30-Sep-2022 11:04                5630
install.windows.pecl.php                           30-Sep-2022 11:04                1624
install.windows.php                                30-Sep-2022 11:04                3277
install.windows.recommended.php                    30-Sep-2022 11:04                5308
install.windows.requirements.php                   30-Sep-2022 11:04                2378
install.windows.tools.php                          30-Sep-2022 11:04                1887
install.windows.troubleshooting.php                30-Sep-2022 11:04                1820
internaliterator.construct.php                     30-Sep-2022 11:04                1959
internaliterator.current.php                       30-Sep-2022 11:04                2309
internaliterator.key.php                           30-Sep-2022 11:04                2298
internaliterator.next.php                          30-Sep-2022 11:04                2231
internaliterator.rewind.php                        30-Sep-2022 11:04                2266
internaliterator.valid.php                         30-Sep-2022 11:04                2198
intl.configuration.php                             30-Sep-2022 11:04                5434
intl.constants.php                                 30-Sep-2022 11:04                7863
intl.examples.basic.php                            30-Sep-2022 11:04                4474
intl.examples.php                                  30-Sep-2022 11:04                1368
intl.installation.php                              30-Sep-2022 11:04                2572
intl.requirements.php                              30-Sep-2022 11:04                1598
intl.resources.php                                 30-Sep-2022 11:04                1196
intl.setup.php                                     30-Sep-2022 11:04                1575
intlbreakiterator.construct.php                    30-Sep-2022 11:04                2452
intlbreakiterator.createcharacterinstance.php      30-Sep-2022 11:04                3145
intlbreakiterator.createcodepointinstance.php      30-Sep-2022 11:04                2790
intlbreakiterator.createlineinstance.php           30-Sep-2022 11:04                3090
intlbreakiterator.createsentenceinstance.php       30-Sep-2022 11:04                3114
intlbreakiterator.createtitleinstance.php          30-Sep-2022 11:04                3062
intlbreakiterator.createwordinstance.php           30-Sep-2022 11:04                3049
intlbreakiterator.current.php                      30-Sep-2022 11:04                2436
intlbreakiterator.first.php                        30-Sep-2022 11:04                2406
intlbreakiterator.following.php                    30-Sep-2022 11:04                2647
intlbreakiterator.geterrorcode.php                 30-Sep-2022 11:04                2921
intlbreakiterator.geterrormessage.php              30-Sep-2022 11:04                3054
intlbreakiterator.getlocale.php                    30-Sep-2022 11:04                2643
intlbreakiterator.getpartsiterator.php             30-Sep-2022 11:04                3538
intlbreakiterator.gettext.php                      30-Sep-2022 11:04                2479
intlbreakiterator.isboundary.php                   30-Sep-2022 11:04                2614
intlbreakiterator.last.php                         30-Sep-2022 11:04                2427
intlbreakiterator.next.php                         30-Sep-2022 11:04                2706
intlbreakiterator.preceding.php                    30-Sep-2022 11:04                2640
intlbreakiterator.previous.php                     30-Sep-2022 11:04                2468
intlbreakiterator.settext.php                      30-Sep-2022 11:04                2633
intlcalendar.add.php                               30-Sep-2022 11:04                8582
intlcalendar.after.php                             30-Sep-2022 11:04                6868
intlcalendar.before.php                            30-Sep-2022 11:04                4066
intlcalendar.clear.php                             30-Sep-2022 11:04               20989
intlcalendar.construct.php                         30-Sep-2022 11:04                2363
intlcalendar.createinstance.php                    30-Sep-2022 11:04               13227
intlcalendar.equals.php                            30-Sep-2022 11:04               11051
intlcalendar.fielddifference.php                   30-Sep-2022 11:04               11553
intlcalendar.fromdatetime.php                      30-Sep-2022 11:04                7450
intlcalendar.get.php                               30-Sep-2022 11:04                8918
intlcalendar.getactualmaximum.php                  30-Sep-2022 11:04                8432
intlcalendar.getactualminimum.php                  30-Sep-2022 11:04                5593
intlcalendar.getavailablelocales.php               30-Sep-2022 11:04                4189
intlcalendar.getdayofweektype.php                  30-Sep-2022 11:04                9825
intlcalendar.geterrorcode.php                      30-Sep-2022 11:04                9074
intlcalendar.geterrormessage.php                   30-Sep-2022 11:04                5952
intlcalendar.getfirstdayofweek.php                 30-Sep-2022 11:04                8482
intlcalendar.getgreatestminimum.php                30-Sep-2022 11:04                4433
intlcalendar.getkeywordvaluesforlocale.php         30-Sep-2022 11:04                7545
intlcalendar.getleastmaximum.php                   30-Sep-2022 11:04                8229
intlcalendar.getlocale.php                         30-Sep-2022 11:04                5927
intlcalendar.getmaximum.php                        30-Sep-2022 11:04                5126
intlcalendar.getminimaldaysinfirstweek.php         30-Sep-2022 11:04                9021
intlcalendar.getminimum.php                        30-Sep-2022 11:04                4377
intlcalendar.getnow.php                            30-Sep-2022 11:04                5385
intlcalendar.getrepeatedwalltimeoption.php         30-Sep-2022 11:04               10307
intlcalendar.getskippedwalltimeoption.php          30-Sep-2022 11:04               12716
intlcalendar.gettime.php                           30-Sep-2022 11:04                6473
intlcalendar.gettimezone.php                       30-Sep-2022 11:04                7616
intlcalendar.gettype.php                           30-Sep-2022 11:04                5691
intlcalendar.getweekendtransition.php              30-Sep-2022 11:04                4701
intlcalendar.indaylighttime.php                    30-Sep-2022 11:04                8802
intlcalendar.isequivalentto.php                    30-Sep-2022 11:04                8499
intlcalendar.islenient.php                         30-Sep-2022 11:04                8328
intlcalendar.isset.php                             30-Sep-2022 11:04                4612
intlcalendar.isweekend.php                         30-Sep-2022 11:04                8737
intlcalendar.roll.php                              30-Sep-2022 11:04                9060
intlcalendar.set.php                               30-Sep-2022 11:04               14142
intlcalendar.setfirstdayofweek.php                 30-Sep-2022 11:04                8127
intlcalendar.setlenient.php                        30-Sep-2022 11:04                4071
intlcalendar.setminimaldaysinfirstweek.php         30-Sep-2022 11:04                4070
intlcalendar.setrepeatedwalltimeoption.php         30-Sep-2022 11:04                5373
intlcalendar.setskippedwalltimeoption.php          30-Sep-2022 11:04                6082
intlcalendar.settime.php                           30-Sep-2022 11:04                8689
intlcalendar.settimezone.php                       30-Sep-2022 11:04               11094
intlcalendar.todatetime.php                        30-Sep-2022 11:04                7295
intlchar.charage.php                               30-Sep-2022 11:04                5576
intlchar.chardigitvalue.php                        30-Sep-2022 11:04                5248
intlchar.chardirection.php                         30-Sep-2022 11:04                8691
intlchar.charfromname.php                          30-Sep-2022 11:04                6693
intlchar.charmirror.php                            30-Sep-2022 11:04                6195
intlchar.charname.php                              30-Sep-2022 11:04                7041
intlchar.chartype.php                              30-Sep-2022 11:04                9232
intlchar.chr.php                                   30-Sep-2022 11:04                5488
intlchar.digit.php                                 30-Sep-2022 11:04                7970
intlchar.enumcharnames.php                         30-Sep-2022 11:04                7697
intlchar.enumchartypes.php                         30-Sep-2022 11:04                5753
intlchar.foldcase.php                              30-Sep-2022 11:04                3531
intlchar.fordigit.php                              30-Sep-2022 11:04                6846
intlchar.getbidipairedbracket.php                  30-Sep-2022 11:04                5793
intlchar.getblockcode.php                          30-Sep-2022 11:04                5324
intlchar.getcombiningclass.php                     30-Sep-2022 11:04                4638
intlchar.getfc-nfkc-closure.php                    30-Sep-2022 11:04                4579
intlchar.getintpropertymaxvalue.php                30-Sep-2022 11:04                6330
intlchar.getintpropertyminvalue.php                30-Sep-2022 11:04                6323
intlchar.getintpropertyvalue.php                   30-Sep-2022 11:04                7723
intlchar.getnumericvalue.php                       30-Sep-2022 11:04                5148
intlchar.getpropertyenum.php                       30-Sep-2022 11:04                6499
intlchar.getpropertyname.php                       30-Sep-2022 11:04                8171
intlchar.getpropertyvalueenum.php                  30-Sep-2022 11:04                7833
intlchar.getpropertyvaluename.php                  30-Sep-2022 11:04                9911
intlchar.getunicodeversion.php                     30-Sep-2022 11:04                3909
intlchar.hasbinaryproperty.php                     30-Sep-2022 11:04                8586
intlchar.isalnum.php                               30-Sep-2022 11:04                5370
intlchar.isalpha.php                               30-Sep-2022 11:04                5258
intlchar.isbase.php                                30-Sep-2022 11:04                5735
intlchar.isblank.php                               30-Sep-2022 11:04                6447
intlchar.iscntrl.php                               30-Sep-2022 11:04                6047
intlchar.isdefined.php                             30-Sep-2022 11:04                6477
intlchar.isdigit.php                               30-Sep-2022 11:04                5596
intlchar.isgraph.php                               30-Sep-2022 11:04                5288
intlchar.isidignorable.php                         30-Sep-2022 11:04                5874
intlchar.isidpart.php                              30-Sep-2022 11:04                6454
intlchar.isidstart.php                             30-Sep-2022 11:04                5961
intlchar.isisocontrol.php                          30-Sep-2022 11:04                5213
intlchar.isjavaidpart.php                          30-Sep-2022 11:04                6553
intlchar.isjavaidstart.php                         30-Sep-2022 11:04                6253
intlchar.isjavaspacechar.php                       30-Sep-2022 11:04                6491
intlchar.islower.php                               30-Sep-2022 11:04                6757
intlchar.ismirrored.php                            30-Sep-2022 11:04                5323
intlchar.isprint.php                               30-Sep-2022 11:04                5567
intlchar.ispunct.php                               30-Sep-2022 11:04                5035
intlchar.isspace.php                               30-Sep-2022 11:04                6134
intlchar.istitle.php                               30-Sep-2022 11:04                6195
intlchar.isualphabetic.php                         30-Sep-2022 11:04                5554
intlchar.isulowercase.php                          30-Sep-2022 11:04                6534
intlchar.isupper.php                               30-Sep-2022 11:04                6755
intlchar.isuuppercase.php                          30-Sep-2022 11:04                6572
intlchar.isuwhitespace.php                         30-Sep-2022 11:04                7078
intlchar.iswhitespace.php                          30-Sep-2022 11:04                7206
intlchar.isxdigit.php                              30-Sep-2022 11:04                6637
intlchar.ord.php                                   30-Sep-2022 11:04                5313
intlchar.tolower.php                               30-Sep-2022 11:04                7392
intlchar.totitle.php                               30-Sep-2022 11:04                7395
intlchar.toupper.php                               30-Sep-2022 11:04                7335
intlcodepointbreakiterator.getlastcodepoint.php    30-Sep-2022 11:04                2678
intldateformatter.create.php                       30-Sep-2022 11:04               27955
intldateformatter.format.php                       30-Sep-2022 11:04               28196
intldateformatter.formatobject.php                 30-Sep-2022 11:04               14327
intldateformatter.getcalendar.php                  30-Sep-2022 11:04                9639
intldateformatter.getcalendarobject.php            30-Sep-2022 11:04                7761
intldateformatter.getdatetype.php                  30-Sep-2022 11:04               12673
intldateformatter.geterrorcode.php                 30-Sep-2022 11:04                9328
intldateformatter.geterrormessage.php              30-Sep-2022 11:04                9331
intldateformatter.getlocale.php                    30-Sep-2022 11:04               12760
intldateformatter.getpattern.php                   30-Sep-2022 11:04               11050
intldateformatter.gettimetype.php                  30-Sep-2022 11:04               12493
intldateformatter.gettimezone.php                  30-Sep-2022 11:04                8825
intldateformatter.gettimezoneid.php                30-Sep-2022 11:04                9269
intldateformatter.islenient.php                    30-Sep-2022 11:04               16028
intldateformatter.localtime.php                    30-Sep-2022 11:04               11152
intldateformatter.parse.php                        30-Sep-2022 11:04               12817
intldateformatter.setcalendar.php                  30-Sep-2022 11:04               14826
intldateformatter.setlenient.php                   30-Sep-2022 11:04               16989
intldateformatter.setpattern.php                   30-Sep-2022 11:04               12212
intldateformatter.settimezone.php                  30-Sep-2022 11:04               11811
intldatepatterngenerator.create.php                30-Sep-2022 11:04                3781
intldatepatterngenerator.getbestpattern.php        30-Sep-2022 11:04                6824
intlgregoriancalendar.construct.php                30-Sep-2022 11:04                5109
intlgregoriancalendar.getgregorianchange.php       30-Sep-2022 11:04                2624
intlgregoriancalendar.isleapyear.php               30-Sep-2022 11:04                2842
intlgregoriancalendar.setgregorianchange.php       30-Sep-2022 11:04                2886
intliterator.current.php                           30-Sep-2022 11:04                2403
intliterator.key.php                               30-Sep-2022 11:04                2368
intliterator.next.php                              30-Sep-2022 11:04                2318
intliterator.rewind.php                            30-Sep-2022 11:04                2350
intliterator.valid.php                             30-Sep-2022 11:04                2288
intlpartsiterator.getbreakiterator.php             30-Sep-2022 11:04                2594
intlrulebasedbreakiterator.construct.php           30-Sep-2022 11:04                3045
intlrulebasedbreakiterator.getbinaryrules.php      30-Sep-2022 11:04                2745
intlrulebasedbreakiterator.getrules.php            30-Sep-2022 11:04                2712
intlrulebasedbreakiterator.getrulestatus.php       30-Sep-2022 11:04                2723
intlrulebasedbreakiterator.getrulestatusvec.php    30-Sep-2022 11:04                2828
intltimezone.construct.php                         30-Sep-2022 11:04                1958
intltimezone.countequivalentids.php                30-Sep-2022 11:04                3414
intltimezone.createdefault.php                     30-Sep-2022 11:04                3023
intltimezone.createenumeration.php                 30-Sep-2022 11:04                4153
intltimezone.createtimezone.php                    30-Sep-2022 11:04                3438
intltimezone.createtimezoneidenumeration.php       30-Sep-2022 11:04                5072
intltimezone.fromdatetimezone.php                  30-Sep-2022 11:04                3673
intltimezone.getcanonicalid.php                    30-Sep-2022 11:04                3956
intltimezone.getdisplayname.php                    30-Sep-2022 11:04                4818
intltimezone.getdstsavings.php                     30-Sep-2022 11:04                3037
intltimezone.getequivalentid.php                   30-Sep-2022 11:04                3721
intltimezone.geterrorcode.php                      30-Sep-2022 11:04                3178
intltimezone.geterrormessage.php                   30-Sep-2022 11:04                3202
intltimezone.getgmt.php                            30-Sep-2022 11:04                2866
intltimezone.getid.php                             30-Sep-2022 11:04                3051
intltimezone.getidforwindowsid.php                 30-Sep-2022 11:04                5236
intltimezone.getoffset.php                         30-Sep-2022 11:04                4561
intltimezone.getrawoffset.php                      30-Sep-2022 11:04                2994
intltimezone.getregion.php                         30-Sep-2022 11:04                3341
intltimezone.gettzdataversion.php                  30-Sep-2022 11:04                3078
intltimezone.getunknown.php                        30-Sep-2022 11:04                3074
intltimezone.getwindowsid.php                      30-Sep-2022 11:04                4095
intltimezone.hassamerules.php                      30-Sep-2022 11:04                3398
intltimezone.todatetimezone.php                    30-Sep-2022 11:04                3391
intltimezone.usedaylighttime.php                   30-Sep-2022 11:04                3014
intro-whatcando.php                                30-Sep-2022 11:04                8198
intro-whatis.php                                   30-Sep-2022 11:04                4246
intro.apache.php                                   30-Sep-2022 11:05                1161
intro.apcu.php                                     30-Sep-2022 11:04                1742
intro.array.php                                    30-Sep-2022 11:05                2074
intro.bc.php                                       30-Sep-2022 11:05                4898
intro.bzip2.php                                    30-Sep-2022 11:04                1179
intro.calendar.php                                 30-Sep-2022 11:04                2031
intro.classobj.php                                 30-Sep-2022 11:05                1811
intro.cmark.php                                    30-Sep-2022 11:05                6344
intro.com.php                                      30-Sep-2022 11:05                3334
intro.componere.php                                30-Sep-2022 11:04                6107
intro.csprng.php                                   30-Sep-2022 11:04                1703
intro.ctype.php                                    30-Sep-2022 11:05                4021
intro.cubrid.php                                   30-Sep-2022 11:04                1476
intro.curl.php                                     30-Sep-2022 11:05                1683
intro.datetime.php                                 30-Sep-2022 11:04                2506
intro.dba.php                                      30-Sep-2022 11:04                1534
intro.dbase.php                                    30-Sep-2022 11:04                7043
intro.dio.php                                      30-Sep-2022 11:04                1735
intro.dom.php                                      30-Sep-2022 11:05                1667
intro.ds.php                                       30-Sep-2022 11:05                1384
intro.eio.php                                      30-Sep-2022 11:05               16144
intro.enchant.php                                  30-Sep-2022 11:04                2621
intro.errorfunc.php                                30-Sep-2022 11:04                2012
intro.ev.php                                       30-Sep-2022 11:05                2481
intro.event.php                                    30-Sep-2022 11:05                2062
intro.exec.php                                     30-Sep-2022 11:05                1824
intro.exif.php                                     30-Sep-2022 11:04                1473
intro.expect.php                                   30-Sep-2022 11:05                1421
intro.fann.php                                     30-Sep-2022 11:05                1377
intro.fdf.php                                      30-Sep-2022 11:05                4006
intro.ffi.php                                      30-Sep-2022 11:04                2808
intro.fileinfo.php                                 30-Sep-2022 11:04                1469
intro.filesystem.php                               30-Sep-2022 11:04                1494
intro.filter.php                                   30-Sep-2022 11:05                2751
intro.fpm.php                                      30-Sep-2022 11:05                1368
intro.ftp.php                                      30-Sep-2022 11:05                1766
intro.funchand.php                                 30-Sep-2022 11:05                1192
intro.gearman.php                                  30-Sep-2022 11:05                1730
intro.gender.php                                   30-Sep-2022 11:04                1323
intro.geoip.php                                    30-Sep-2022 11:05                1579
intro.gettext.php                                  30-Sep-2022 11:04                1524
intro.gmagick.php                                  30-Sep-2022 11:04                1753
intro.gmp.php                                      30-Sep-2022 11:05                3586
intro.gnupg.php                                    30-Sep-2022 11:05                1181
intro.hash.php                                     30-Sep-2022 11:04                1215
intro.hrtime.php                                   30-Sep-2022 11:04                1714
intro.ibase.php                                    30-Sep-2022 11:04                3415
intro.ibm-db2.php                                  30-Sep-2022 11:04                1259
intro.iconv.php                                    30-Sep-2022 11:04                1823
intro.igbinary.php                                 30-Sep-2022 11:05                1865
intro.image.php                                    30-Sep-2022 11:04                6436
intro.imagick.php                                  30-Sep-2022 11:04                1807
intro.imap.php                                     30-Sep-2022 11:05                1726
intro.info.php                                     30-Sep-2022 11:04                1477
intro.inotify.php                                  30-Sep-2022 11:04                2349
intro.intl.php                                     30-Sep-2022 11:04                5458
intro.json.php                                     30-Sep-2022 11:05                1669
intro.ldap.php                                     30-Sep-2022 11:05                4460
intro.libxml.php                                   30-Sep-2022 11:05                1754
intro.lua.php                                      30-Sep-2022 11:05                1245
intro.luasandbox.php                               30-Sep-2022 11:05                2320
intro.lzf.php                                      30-Sep-2022 11:04                1437
intro.mail.php                                     30-Sep-2022 11:05                1177
intro.mailparse.php                                30-Sep-2022 11:05                1913
intro.math.php                                     30-Sep-2022 11:05                1584
intro.mbstring.php                                 30-Sep-2022 11:04                2326
intro.mcrypt.php                                   30-Sep-2022 11:04                2395
intro.memcache.php                                 30-Sep-2022 11:05                1879
intro.memcached.php                                30-Sep-2022 11:05                1937
intro.mhash.php                                    30-Sep-2022 11:04                2916
intro.misc.php                                     30-Sep-2022 11:05                1145
intro.mqseries.php                                 30-Sep-2022 11:05                1742
intro.mysql-xdevapi.php                            30-Sep-2022 11:04                1892
intro.mysql.php                                    30-Sep-2022 11:04                1926
intro.mysqli.php                                   30-Sep-2022 11:04                2269
intro.mysqlnd.php                                  30-Sep-2022 11:04                2073
intro.network.php                                  30-Sep-2022 11:05                1124
intro.oauth.php                                    30-Sep-2022 11:05                1355
intro.oci8.php                                     30-Sep-2022 11:04                1522
intro.opcache.php                                  30-Sep-2022 11:04                1577
intro.openal.php                                   30-Sep-2022 11:04                1235
intro.openssl.php                                  30-Sep-2022 11:04                1579
intro.outcontrol.php                               30-Sep-2022 11:04                1889
intro.parallel.php                                 30-Sep-2022 11:05                6813
intro.parle.php                                    30-Sep-2022 11:05                3394
intro.password.php                                 30-Sep-2022 11:04                1473
intro.pcntl.php                                    30-Sep-2022 11:05                2741
intro.pcre.php                                     30-Sep-2022 11:05                2782
intro.pdo.php                                      30-Sep-2022 11:04                2343
intro.pgsql.php                                    30-Sep-2022 11:04                1527
intro.phar.php                                     30-Sep-2022 11:04               10948
intro.phpdbg.php                                   30-Sep-2022 11:04                5996
intro.posix.php                                    30-Sep-2022 11:05                1710
intro.ps.php                                       30-Sep-2022 11:05                1849
intro.pspell.php                                   30-Sep-2022 11:04                1182
intro.pthreads.php                                 30-Sep-2022 11:05               10202
intro.quickhash.php                                30-Sep-2022 11:05                1222
intro.radius.php                                   30-Sep-2022 11:04                2266
intro.rar.php                                      30-Sep-2022 11:04                1536
intro.readline.php                                 30-Sep-2022 11:04                2128
intro.recode.php                                   30-Sep-2022 11:04                2277
intro.reflection.php                               30-Sep-2022 11:05                1876
intro.rpminfo.php                                  30-Sep-2022 11:05                1181
intro.rrd.php                                      30-Sep-2022 11:05                1534
intro.runkit7.php                                  30-Sep-2022 11:04                1434
intro.scoutapm.php                                 30-Sep-2022 11:05                1442
intro.seaslog.php                                  30-Sep-2022 11:05                4128
intro.sem.php                                      30-Sep-2022 11:05                3504
intro.session.php                                  30-Sep-2022 11:05                5179
intro.shmop.php                                    30-Sep-2022 11:05                1286
intro.simplexml.php                                30-Sep-2022 11:05                1295
intro.snmp.php                                     30-Sep-2022 11:05                1692
intro.soap.php                                     30-Sep-2022 11:05                1445
intro.sockets.php                                  30-Sep-2022 11:05                2667
intro.sodium.php                                   30-Sep-2022 11:04                1368
intro.solr.php                                     30-Sep-2022 11:05                1862
intro.spl.php                                      30-Sep-2022 11:05                1639
intro.sqlite3.php                                  30-Sep-2022 11:04                1123
intro.sqlsrv.php                                   30-Sep-2022 11:04                2195
intro.ssdeep.php                                   30-Sep-2022 11:05                1839
intro.ssh2.php                                     30-Sep-2022 11:05                1333
intro.stats.php                                    30-Sep-2022 11:05                1466
intro.stomp.php                                    30-Sep-2022 11:05                1311
intro.stream.php                                   30-Sep-2022 11:05                4639
intro.strings.php                                  30-Sep-2022 11:05                1776
intro.svm.php                                      30-Sep-2022 11:05                1236
intro.svn.php                                      30-Sep-2022 11:05                1825
intro.swoole.php                                   30-Sep-2022 11:05                1621
intro.sync.php                                     30-Sep-2022 11:05                2626
intro.taint.php                                    30-Sep-2022 11:05                4559
intro.tcpwrap.php                                  30-Sep-2022 11:05                1236
intro.tidy.php                                     30-Sep-2022 11:05                1352
intro.tokenizer.php                                30-Sep-2022 11:05                1506
intro.trader.php                                   30-Sep-2022 11:05                2652
intro.ui.php                                       30-Sep-2022 11:05                1180
intro.uodbc.php                                    30-Sep-2022 11:04                2856
intro.uopz.php                                     30-Sep-2022 11:04                2581
intro.url.php                                      30-Sep-2022 11:05                1108
intro.v8js.php                                     30-Sep-2022 11:05                1191
intro.var.php                                      30-Sep-2022 11:05                1301
intro.var_representation.php                       30-Sep-2022 11:05                1384
intro.varnish.php                                  30-Sep-2022 11:05                1286
intro.wddx.php                                     30-Sep-2022 11:05                2373
intro.win32service.php                             30-Sep-2022 11:05                1410
intro.wincache.php                                 30-Sep-2022 11:04                5635
intro.wkhtmltox.php                                30-Sep-2022 11:05                1259
intro.xattr.php                                    30-Sep-2022 11:04                1161
intro.xdiff.php                                    30-Sep-2022 11:04                2777
intro.xhprof.php                                   30-Sep-2022 11:04                3027
intro.xlswriter.php                                30-Sep-2022 11:05                1170
intro.xml.php                                      30-Sep-2022 11:05                2483
intro.xmldiff.php                                  30-Sep-2022 11:05                1452
intro.xmlreader.php                                30-Sep-2022 11:05                1571
intro.xmlrpc.php                                   30-Sep-2022 11:05                1915
intro.xmlwriter.php                                30-Sep-2022 11:05                1478
intro.xsl.php                                      30-Sep-2022 11:05                1313
intro.yac.php                                      30-Sep-2022 11:04                1187
intro.yaconf.php                                   30-Sep-2022 11:05                2690
intro.yaf.php                                      30-Sep-2022 11:05                1531
intro.yaml.php                                     30-Sep-2022 11:05                1408
intro.yar.php                                      30-Sep-2022 11:05                1245
intro.yaz.php                                      30-Sep-2022 11:05                2584
intro.zip.php                                      30-Sep-2022 11:04                1200
intro.zlib.php                                     30-Sep-2022 11:04                1578
intro.zmq.php                                      30-Sep-2022 11:05                1370
intro.zookeeper.php                                30-Sep-2022 11:05                1453
introduction.php                                   30-Sep-2022 11:04                1429
iterator.current.php                               30-Sep-2022 11:04                2185
iterator.key.php                                   30-Sep-2022 11:04                2554
iterator.next.php                                  30-Sep-2022 11:04                2412
iterator.rewind.php                                30-Sep-2022 11:04                2630
iterator.valid.php                                 30-Sep-2022 11:04                2602
iteratoraggregate.getiterator.php                  30-Sep-2022 11:04                2861
iteratoriterator.construct.php                     30-Sep-2022 11:05                2962
iteratoriterator.current.php                       30-Sep-2022 11:05                2783
iteratoriterator.getinneriterator.php              30-Sep-2022 11:05                3135
iteratoriterator.key.php                           30-Sep-2022 11:05                2718
iteratoriterator.next.php                          30-Sep-2022 11:05                2849
iteratoriterator.rewind.php                        30-Sep-2022 11:05                2868
iteratoriterator.valid.php                         30-Sep-2022 11:05                2911
json.configuration.php                             30-Sep-2022 11:05                1210
json.constants.php                                 30-Sep-2022 11:05               13193
json.installation.php                              30-Sep-2022 11:05                1932
json.requirements.php                              30-Sep-2022 11:05                1213
json.resources.php                                 30-Sep-2022 11:05                1196
json.setup.php                                     30-Sep-2022 11:05                1540
jsonserializable.jsonserialize.php                 30-Sep-2022 11:05               13135
langref.php                                        30-Sep-2022 11:04               20003
language.attributes.classes.php                    30-Sep-2022 11:04                5501
language.attributes.overview.php                   30-Sep-2022 11:04               11503
language.attributes.php                            30-Sep-2022 11:04                1712
language.attributes.reflection.php                 30-Sep-2022 11:04                8613
language.attributes.syntax.php                     30-Sep-2022 11:04                5074
language.basic-syntax.comments.php                 30-Sep-2022 11:04                4578
language.basic-syntax.instruction-separation.php   30-Sep-2022 11:04                4553
language.basic-syntax.php                          30-Sep-2022 11:04                1673
language.basic-syntax.phpmode.php                  30-Sep-2022 11:04                5011
language.basic-syntax.phptags.php                  30-Sep-2022 11:04                5484
language.constants.magic.php                       30-Sep-2022 11:04                5178
language.constants.php                             30-Sep-2022 11:04                6592
language.constants.predefined.php                  30-Sep-2022 11:04                1486
language.constants.syntax.php                      30-Sep-2022 11:04               10857
language.control-structures.php                    30-Sep-2022 11:04                2751
language.enumerations.backed.php                   30-Sep-2022 11:04               10168
language.enumerations.basics.php                   30-Sep-2022 11:04                7504
language.enumerations.constants.php                30-Sep-2022 11:04                2371
language.enumerations.examples.php                 30-Sep-2022 11:04                7797
language.enumerations.expressions.php              30-Sep-2022 11:04                5804
language.enumerations.listing.php                  30-Sep-2022 11:04                2184
language.enumerations.methods.php                  30-Sep-2022 11:04               15832
language.enumerations.object-differences.php       30-Sep-2022 11:04                4851
language.enumerations.overview.php                 30-Sep-2022 11:04                2176
language.enumerations.php                          30-Sep-2022 11:04                2351
language.enumerations.serialization.php            30-Sep-2022 11:04                4878
language.enumerations.static-methods.php           30-Sep-2022 11:04                3661
language.enumerations.traits.php                   30-Sep-2022 11:04                4953
language.errors.basics.php                         30-Sep-2022 11:04                5408
language.errors.php                                30-Sep-2022 11:04                1910
language.errors.php7.php                           30-Sep-2022 11:04                5967
language.exceptions.extending.php                  30-Sep-2022 11:04               24300
language.exceptions.php                            30-Sep-2022 11:04               31486
language.expressions.php                           30-Sep-2022 11:04               17829
language.fibers.php                                30-Sep-2022 11:04                6227
language.functions.php                             30-Sep-2022 11:04                1982
language.generators.comparison.php                 30-Sep-2022 11:04               10613
language.generators.overview.php                   30-Sep-2022 11:04               10751
language.generators.php                            30-Sep-2022 11:04                1664
language.generators.syntax.php                     30-Sep-2022 11:04               27732
language.namespaces.basics.php                     30-Sep-2022 11:04               13103
language.namespaces.definition.php                 30-Sep-2022 11:04                4680
language.namespaces.definitionmultiple.php         30-Sep-2022 11:04               10176
language.namespaces.dynamic.php                    30-Sep-2022 11:04                9009
language.namespaces.fallback.php                   30-Sep-2022 11:04                6891
language.namespaces.faq.php                        30-Sep-2022 11:04               35992
language.namespaces.global.php                     30-Sep-2022 11:04                3179
language.namespaces.importing.php                  30-Sep-2022 11:04               19232
language.namespaces.nested.php                     30-Sep-2022 11:04                3155
language.namespaces.nsconstants.php                30-Sep-2022 11:04               10291
language.namespaces.php                            30-Sep-2022 11:04                2652
language.namespaces.rationale.php                  30-Sep-2022 11:04                7202
language.namespaces.rules.php                      30-Sep-2022 11:04               16475
language.oop5.abstract.php                         30-Sep-2022 11:04               12513
language.oop5.anonymous.php                        30-Sep-2022 11:04               12262
language.oop5.autoload.php                         30-Sep-2022 11:04                6966
language.oop5.basic.php                            30-Sep-2022 11:04               50317
language.oop5.changelog.php                        30-Sep-2022 11:04               14161
language.oop5.cloning.php                          30-Sep-2022 11:04                9314
language.oop5.constants.php                        30-Sep-2022 11:04                9786
language.oop5.decon.php                            30-Sep-2022 11:04               31123
language.oop5.final.php                            30-Sep-2022 11:04                7043
language.oop5.inheritance.php                      30-Sep-2022 11:04               14639
language.oop5.interfaces.php                       30-Sep-2022 11:04               24376
language.oop5.iterations.php                       30-Sep-2022 11:04                6346
language.oop5.late-static-bindings.php             30-Sep-2022 11:04               17027
language.oop5.magic.php                            30-Sep-2022 11:04               43456
language.oop5.object-comparison.php                30-Sep-2022 11:04                9795
language.oop5.overloading.php                      30-Sep-2022 11:04               27114
language.oop5.paamayim-nekudotayim.php             30-Sep-2022 11:04                9208
language.oop5.php                                  30-Sep-2022 11:04                3468
language.oop5.properties.php                       30-Sep-2022 11:04               29216
language.oop5.references.php                       30-Sep-2022 11:04                6399
language.oop5.serialization.php                    30-Sep-2022 11:04                8084
language.oop5.static.php                           30-Sep-2022 11:04                9833
language.oop5.traits.php                           30-Sep-2022 11:04               35605
language.oop5.variance.php                         30-Sep-2022 11:04               17222
language.oop5.visibility.php                       30-Sep-2022 11:04               28978
language.operators.arithmetic.php                  30-Sep-2022 11:04                6291
language.operators.array.php                       30-Sep-2022 11:04                9305
language.operators.assignment.php                  30-Sep-2022 11:04               13012
language.operators.bitwise.php                     30-Sep-2022 11:04               48305
language.operators.comparison.php                  30-Sep-2022 11:04               44631
language.operators.errorcontrol.php                30-Sep-2022 11:04                6574
language.operators.execution.php                   30-Sep-2022 11:04                3717
language.operators.increment.php                   30-Sep-2022 11:04               11940
language.operators.logical.php                     30-Sep-2022 11:04                7924
language.operators.php                             30-Sep-2022 11:04                4100
language.operators.precedence.php                  30-Sep-2022 11:04               21299
language.operators.string.php                      30-Sep-2022 11:04                3374
language.operators.type.php                        30-Sep-2022 11:04               19292
language.references.arent.php                      30-Sep-2022 11:04                3360
language.references.pass.php                       30-Sep-2022 11:04                7387
language.references.php                            30-Sep-2022 11:04                2060
language.references.return.php                     30-Sep-2022 11:04                7796
language.references.spot.php                       30-Sep-2022 11:04                2647
language.references.unset.php                      30-Sep-2022 11:04                2366
language.references.whatare.php                    30-Sep-2022 11:04                2297
language.references.whatdo.php                     30-Sep-2022 11:04               20138
language.types.array.php                           30-Sep-2022 11:04              110758
language.types.boolean.php                         30-Sep-2022 11:04                9677
language.types.callable.php                        30-Sep-2022 11:04               13618
language.types.declarations.php                    30-Sep-2022 11:04               54966
language.types.enumerations.php                    30-Sep-2022 11:04                3578
language.types.float.php                           30-Sep-2022 11:04                9781
language.types.integer.php                         30-Sep-2022 11:04               21968
language.types.intro.php                           30-Sep-2022 11:04                7930
language.types.iterable.php                        30-Sep-2022 11:04                6978
language.types.null.php                            30-Sep-2022 11:04                3596
language.types.numeric-strings.php                 30-Sep-2022 11:04               10729
language.types.object.php                          30-Sep-2022 11:04                5475
language.types.php                                 30-Sep-2022 11:04                2449
language.types.resource.php                        30-Sep-2022 11:04                3033
language.types.string.php                          30-Sep-2022 11:04               90007
language.types.type-juggling.php                   30-Sep-2022 11:04               19379
language.variables.basics.php                      30-Sep-2022 11:04               15337
language.variables.external.php                    30-Sep-2022 11:04               18663
language.variables.php                             30-Sep-2022 11:04                1727
language.variables.predefined.php                  30-Sep-2022 11:04                3010
language.variables.scope.php                       30-Sep-2022 11:04               30753
language.variables.superglobals.php                30-Sep-2022 11:04                4597
language.variables.variable.php                    30-Sep-2022 11:04               10796
ldap.configuration.php                             30-Sep-2022 11:05                2402
ldap.constants.php                                 30-Sep-2022 11:05               25843
ldap.controls.php                                  30-Sep-2022 11:05                8688
ldap.examples-basic.php                            30-Sep-2022 11:05                9755
ldap.examples-controls.php                         30-Sep-2022 11:05               19155
ldap.examples.php                                  30-Sep-2022 11:05                1375
ldap.installation.php                              30-Sep-2022 11:05                2994
ldap.requirements.php                              30-Sep-2022 11:05                1515
ldap.resources.php                                 30-Sep-2022 11:05                1472
ldap.setup.php                                     30-Sep-2022 11:05                1573
ldap.using.php                                     30-Sep-2022 11:05                2243
libxml.configuration.php                           30-Sep-2022 11:05                1224
libxml.constants.php                               30-Sep-2022 11:05               10422
libxml.installation.php                            30-Sep-2022 11:05                2673
libxml.requirements.php                            30-Sep-2022 11:05                1242
libxml.resources.php                               30-Sep-2022 11:05                1210
libxml.setup.php                                   30-Sep-2022 11:05                1582
limititerator.construct.php                        30-Sep-2022 11:05                7398
limititerator.current.php                          30-Sep-2022 11:05                3757
limititerator.getinneriterator.php                 30-Sep-2022 11:05                3205
limititerator.getposition.php                      30-Sep-2022 11:05                6006
limititerator.key.php                              30-Sep-2022 11:05                3850
limititerator.next.php                             30-Sep-2022 11:05                3483
limititerator.rewind.php                           30-Sep-2022 11:05                3633
limititerator.seek.php                             30-Sep-2022 11:05                4210
limititerator.valid.php                            30-Sep-2022 11:05                3560
locale.acceptfromhttp.php                          30-Sep-2022 11:04                6032
locale.canonicalize.php                            30-Sep-2022 11:04                2910
locale.composelocale.php                           30-Sep-2022 11:04               14179
locale.filtermatches.php                           30-Sep-2022 11:04                8715
locale.getallvariants.php                          30-Sep-2022 11:04                6344
locale.getdefault.php                              30-Sep-2022 11:04                6014
locale.getdisplaylanguage.php                      30-Sep-2022 11:04                9342
locale.getdisplayname.php                          30-Sep-2022 11:04                9330
locale.getdisplayregion.php                        30-Sep-2022 11:04                9208
locale.getdisplayscript.php                        30-Sep-2022 11:04                9215
locale.getdisplayvariant.php                       30-Sep-2022 11:04                9260
locale.getkeywords.php                             30-Sep-2022 11:04                7121
locale.getprimarylanguage.php                      30-Sep-2022 11:04                5753
locale.getregion.php                               30-Sep-2022 11:04                5672
locale.getscript.php                               30-Sep-2022 11:04                5441
locale.lookup.php                                  30-Sep-2022 11:04                9502
locale.parselocale.php                             30-Sep-2022 11:04                7387
locale.setdefault.php                              30-Sep-2022 11:04                5178
lua.assign.php                                     30-Sep-2022 11:05                4593
lua.call.php                                       30-Sep-2022 11:05                7537
lua.configuration.php                              30-Sep-2022 11:05                1203
lua.construct.php                                  30-Sep-2022 11:05                2356
lua.eval.php                                       30-Sep-2022 11:05                3736
lua.getversion.php                                 30-Sep-2022 11:05                2232
lua.include.php                                    30-Sep-2022 11:05                2637
lua.installation.php                               30-Sep-2022 11:05                2194
lua.registercallback.php                           30-Sep-2022 11:05                4548
lua.requirements.php                               30-Sep-2022 11:05                1280
lua.resources.php                                  30-Sep-2022 11:05                1177
lua.setup.php                                      30-Sep-2022 11:05                1527
luaclosure.invoke.php                              30-Sep-2022 11:05                4256
luasandbox.callfunction.php                        30-Sep-2022 11:05                4887
luasandbox.configuration.php                       30-Sep-2022 11:05                1252
luasandbox.disableprofiler.php                     30-Sep-2022 11:05                2867
luasandbox.enableprofiler.php                      30-Sep-2022 11:05                3398
luasandbox.examples-basic.php                      30-Sep-2022 11:05                7405
luasandbox.examples.php                            30-Sep-2022 11:05                1421
luasandbox.getcpuusage.php                         30-Sep-2022 11:05                3587
luasandbox.getmemoryusage.php                      30-Sep-2022 11:05                3167
luasandbox.getpeakmemoryusage.php                  30-Sep-2022 11:05                3217
luasandbox.getprofilerfunctionreport.php           30-Sep-2022 11:05                5653
luasandbox.getversioninfo.php                      30-Sep-2022 11:05                2915
luasandbox.installation.php                        30-Sep-2022 11:05                2260
luasandbox.loadbinary.php                          30-Sep-2022 11:05                3513
luasandbox.loadstring.php                          30-Sep-2022 11:05                5631
luasandbox.pauseusagetimer.php                     30-Sep-2022 11:05               10297
luasandbox.registerlibrary.php                     30-Sep-2022 11:05                6898
luasandbox.requirements.php                        30-Sep-2022 11:05                1737
luasandbox.resources.php                           30-Sep-2022 11:05                1242
luasandbox.setcpulimit.php                         30-Sep-2022 11:05                6008
luasandbox.setmemorylimit.php                      30-Sep-2022 11:05                5663
luasandbox.setup.php                               30-Sep-2022 11:05                1618
luasandbox.unpauseusagetimer.php                   30-Sep-2022 11:05                3163
luasandbox.wrapphpfunction.php                     30-Sep-2022 11:05                4331
luasandboxfunction.call.php                        30-Sep-2022 11:05                6858
luasandboxfunction.construct.php                   30-Sep-2022 11:05                2670
luasandboxfunction.dump.php                        30-Sep-2022 11:05                2374
lzf.configuration.php                              30-Sep-2022 11:04                1203
lzf.constants.php                                  30-Sep-2022 11:04                1121
lzf.installation.php                               30-Sep-2022 11:04                2780
lzf.requirements.php                               30-Sep-2022 11:04                1176
lzf.resources.php                                  30-Sep-2022 11:04                1189
lzf.setup.php                                      30-Sep-2022 11:04                1551
mail.configuration.php                             30-Sep-2022 11:05                7920
mail.constants.php                                 30-Sep-2022 11:05                1130
mail.installation.php                              30-Sep-2022 11:05                1238
mail.requirements.php                              30-Sep-2022 11:05                1980
mail.resources.php                                 30-Sep-2022 11:05                1196
mail.setup.php                                     30-Sep-2022 11:05                1566
mailparse.configuration.php                        30-Sep-2022 11:05                2519
mailparse.constants.php                            30-Sep-2022 11:05                1971
mailparse.installation.php                         30-Sep-2022 11:05                2730
mailparse.requirements.php                         30-Sep-2022 11:05                1218
mailparse.resources.php                            30-Sep-2022 11:05                1563
mailparse.setup.php                                30-Sep-2022 11:05                1628
manual.php                                         30-Sep-2022 11:04                1238
math.configuration.php                             30-Sep-2022 11:05                1210
math.constants.php                                 30-Sep-2022 11:05                6079
math.installation.php                              30-Sep-2022 11:05                1238
math.requirements.php                              30-Sep-2022 11:05                1183
math.resources.php                                 30-Sep-2022 11:05                1196
math.setup.php                                     30-Sep-2022 11:05                1556
mbstring.configuration.php                         30-Sep-2022 11:04               14907
mbstring.constants.php                             30-Sep-2022 11:04                5755
mbstring.encodings.php                             30-Sep-2022 11:04               16205
mbstring.http.php                                  30-Sep-2022 11:04                5426
mbstring.installation.php                          30-Sep-2022 11:04                3458
mbstring.ja-basic.php                              30-Sep-2022 11:04                4103
mbstring.overload.php                              30-Sep-2022 11:04                7534
mbstring.php4.req.php                              30-Sep-2022 11:04                4277
mbstring.requirements.php                          30-Sep-2022 11:04                1211
mbstring.resources.php                             30-Sep-2022 11:04                1224
mbstring.setup.php                                 30-Sep-2022 11:04                1662
mbstring.supported-encodings.php                   30-Sep-2022 11:04                8360
mcrypt.ciphers.php                                 30-Sep-2022 11:04                6595
mcrypt.configuration.php                           30-Sep-2022 11:04                3571
mcrypt.constants.php                               30-Sep-2022 11:04                6197
mcrypt.installation.php                            30-Sep-2022 11:04                1929
mcrypt.requirements.php                            30-Sep-2022 11:04                2694
mcrypt.resources.php                               30-Sep-2022 11:04                1322
mcrypt.setup.php                                   30-Sep-2022 11:04                1598
memcache.add.php                                   30-Sep-2022 11:05                7130
memcache.addserver.php                             30-Sep-2022 11:05               14192
memcache.close.php                                 30-Sep-2022 11:05                5312
memcache.connect.php                               30-Sep-2022 11:05                7706
memcache.constants.php                             30-Sep-2022 11:05                4523
memcache.decrement.php                             30-Sep-2022 11:05                7550
memcache.delete.php                                30-Sep-2022 11:05                6653
memcache.examples-overview.php                     30-Sep-2022 11:05                6937
memcache.examples.php                              30-Sep-2022 11:05                1383
memcache.flush.php                                 30-Sep-2022 11:05                4658
memcache.get.php                                   30-Sep-2022 11:05                9143
memcache.getextendedstats.php                      30-Sep-2022 11:05                8577
memcache.getserverstatus.php                       30-Sep-2022 11:05                6254
memcache.getstats.php                              30-Sep-2022 11:05                5044
memcache.getversion.php                            30-Sep-2022 11:05                5190
memcache.increment.php                             30-Sep-2022 11:05                7339
memcache.ini.php                                   30-Sep-2022 11:05               10137
memcache.installation.php                          30-Sep-2022 11:05                2318
memcache.pconnect.php                              30-Sep-2022 11:05                6382
memcache.replace.php                               30-Sep-2022 11:05                7517
memcache.requirements.php                          30-Sep-2022 11:05                1372
memcache.resources.php                             30-Sep-2022 11:05                1363
memcache.set.php                                   30-Sep-2022 11:05               10430
memcache.setcompressthreshold.php                  30-Sep-2022 11:05                5986
memcache.setserverparams.php                       30-Sep-2022 11:05               11351
memcache.setup.php                                 30-Sep-2022 11:05                1613
memcached.add.php                                  30-Sep-2022 11:05                4529
memcached.addbykey.php                             30-Sep-2022 11:05                5459
memcached.addserver.php                            30-Sep-2022 11:05                7544
memcached.addservers.php                           30-Sep-2022 11:05                5416
memcached.append.php                               30-Sep-2022 11:05                6868
memcached.appendbykey.php                          30-Sep-2022 11:05                4676
memcached.callbacks.php                            30-Sep-2022 11:05                1554
memcached.callbacks.read-through.php               30-Sep-2022 11:05                4808
memcached.callbacks.result.php                     30-Sep-2022 11:05                5214
memcached.cas.php                                  30-Sep-2022 11:05               10019
memcached.casbykey.php                             30-Sep-2022 11:05                5459
memcached.configuration.php                        30-Sep-2022 11:05               23166
memcached.constants.php                            30-Sep-2022 11:05               25620
memcached.construct.php                            30-Sep-2022 11:05                4407
memcached.decrement.php                            30-Sep-2022 11:05                9272
memcached.decrementbykey.php                       30-Sep-2022 11:05                6012
memcached.delete.php                               30-Sep-2022 11:05                5963
memcached.deletebykey.php                          30-Sep-2022 11:05                4936
memcached.deletemulti.php                          30-Sep-2022 11:05                5025
memcached.deletemultibykey.php                     30-Sep-2022 11:05                5020
memcached.expiration.php                           30-Sep-2022 11:05                2057
memcached.fetch.php                                30-Sep-2022 11:05                6622
memcached.fetchall.php                             30-Sep-2022 11:05                6467
memcached.flush.php                                30-Sep-2022 11:05                4691
memcached.get.php                                  30-Sep-2022 11:05               10382
memcached.getallkeys.php                           30-Sep-2022 11:05                2832
memcached.getbykey.php                             30-Sep-2022 11:05                6228
memcached.getdelayed.php                           30-Sep-2022 11:05                8472
memcached.getdelayedbykey.php                      30-Sep-2022 11:05                5373
memcached.getmulti.php                             30-Sep-2022 11:05               21375
memcached.getmultibykey.php                        30-Sep-2022 11:05                5543
memcached.getoption.php                            30-Sep-2022 11:05                5169
memcached.getresultcode.php                        30-Sep-2022 11:05                4314
memcached.getresultmessage.php                     30-Sep-2022 11:05                4704
memcached.getserverbykey.php                       30-Sep-2022 11:05                6968
memcached.getserverlist.php                        30-Sep-2022 11:05                4645
memcached.getstats.php                             30-Sep-2022 11:05                5134
memcached.getversion.php                           30-Sep-2022 11:05                3866
memcached.increment.php                            30-Sep-2022 11:05                8604
memcached.incrementbykey.php                       30-Sep-2022 11:05                5937
memcached.installation.php                         30-Sep-2022 11:05                2957
memcached.ispersistent.php                         30-Sep-2022 11:05                2934
memcached.ispristine.php                           30-Sep-2022 11:05                2836
memcached.prepend.php                              30-Sep-2022 11:05                6876
memcached.prependbykey.php                         30-Sep-2022 11:05                4676
memcached.quit.php                                 30-Sep-2022 11:05                2324
memcached.replace.php                              30-Sep-2022 11:05                4625
memcached.replacebykey.php                         30-Sep-2022 11:05                5659
memcached.requirements.php                         30-Sep-2022 11:05                1591
memcached.resetserverlist.php                      30-Sep-2022 11:05                3049
memcached.resources.php                            30-Sep-2022 11:05                1231
memcached.sessions.php                             30-Sep-2022 11:05                2448
memcached.set.php                                  30-Sep-2022 11:05                9265
memcached.setbykey.php                             30-Sep-2022 11:05                7057
memcached.setmulti.php                             30-Sep-2022 11:05                6317
memcached.setmultibykey.php                        30-Sep-2022 11:05                4893
memcached.setoption.php                            30-Sep-2022 11:05                7590
memcached.setoptions.php                           30-Sep-2022 11:05                6983
memcached.setsaslauthdata.php                      30-Sep-2022 11:05                3385
memcached.setup.php                                30-Sep-2022 11:05                1628
memcached.touch.php                                30-Sep-2022 11:05                3609
memcached.touchbykey.php                           30-Sep-2022 11:05                4553
messageformatter.create.php                        30-Sep-2022 11:04               11167
messageformatter.format.php                        30-Sep-2022 11:04               10057
messageformatter.formatmessage.php                 30-Sep-2022 11:04               10191
messageformatter.geterrorcode.php                  30-Sep-2022 11:04                4096
messageformatter.geterrormessage.php               30-Sep-2022 11:04                8133
messageformatter.getlocale.php                     30-Sep-2022 11:04                5654
messageformatter.getpattern.php                    30-Sep-2022 11:04               10843
messageformatter.parse.php                         30-Sep-2022 11:04               10132
messageformatter.parsemessage.php                  30-Sep-2022 11:04               10574
messageformatter.setpattern.php                    30-Sep-2022 11:04               11155
mhash.configuration.php                            30-Sep-2022 11:04                1217
mhash.constants.php                                30-Sep-2022 11:04                4873
mhash.examples.php                                 30-Sep-2022 11:04                3454
mhash.installation.php                             30-Sep-2022 11:04                1727
mhash.requirements.php                             30-Sep-2022 11:04                1343
mhash.resources.php                                30-Sep-2022 11:04                1203
mhash.setup.php                                    30-Sep-2022 11:04                1577
migration56.changed-functions.php                  30-Sep-2022 11:05                6807
migration56.constants.php                          30-Sep-2022 11:05                5234
migration56.deprecated.php                         30-Sep-2022 11:05                6366
migration56.extensions.php                         30-Sep-2022 11:05                4579
migration56.incompatible.php                       30-Sep-2022 11:05                9390
migration56.new-features.php                       30-Sep-2022 11:05               32507
migration56.new-functions.php                      30-Sep-2022 11:05                7551
migration56.openssl.php                            30-Sep-2022 11:05               27547
migration56.php                                    30-Sep-2022 11:05                2686
migration70.changed-functions.php                  30-Sep-2022 11:05                5671
migration70.classes.php                            30-Sep-2022 11:05                3911
migration70.constants.php                          30-Sep-2022 11:05                7088
migration70.deprecated.php                         30-Sep-2022 11:05                6214
migration70.incompatible.php                       30-Sep-2022 11:05               66044
migration70.new-features.php                       30-Sep-2022 11:05               45935
migration70.new-functions.php                      30-Sep-2022 11:05                7414
migration70.other-changes.php                      30-Sep-2022 11:05                3755
migration70.php                                    30-Sep-2022 11:05                3062
migration70.removed-exts-sapis.php                 30-Sep-2022 11:05                3158
migration70.sapi-changes.php                       30-Sep-2022 11:05                2085
migration71.changed-functions.php                  30-Sep-2022 11:05                7580
migration71.constants.php                          30-Sep-2022 11:05                7244
migration71.deprecated.php                         30-Sep-2022 11:05                2384
migration71.incompatible.php                       30-Sep-2022 11:05               34275
migration71.new-features.php                       30-Sep-2022 11:05               29974
migration71.new-functions.php                      30-Sep-2022 11:05                5075
migration71.other-changes.php                      30-Sep-2022 11:05                9048
migration71.php                                    30-Sep-2022 11:05                2706
migration71.windows-support.php                    30-Sep-2022 11:05                7877
migration72.constants.php                          30-Sep-2022 11:05               24775
migration72.deprecated.php                         30-Sep-2022 11:05               11020
migration72.incompatible.php                       30-Sep-2022 11:05               20885
migration72.new-features.php                       30-Sep-2022 11:05               19537
migration72.new-functions.php                      30-Sep-2022 11:05               24423
migration72.other-changes.php                      30-Sep-2022 11:05                6057
migration72.php                                    30-Sep-2022 11:05                2589
migration73.constants.php                          30-Sep-2022 11:05               17786
migration73.deprecated.php                         30-Sep-2022 11:05                8936
migration73.incompatible.php                       30-Sep-2022 11:05               20722
migration73.new-features.php                       30-Sep-2022 11:05               17391
migration73.new-functions.php                      30-Sep-2022 11:05                7410
migration73.other-changes.php                      30-Sep-2022 11:05               16312
migration73.php                                    30-Sep-2022 11:05                2702
migration73.windows-support.php                    30-Sep-2022 11:05                1966
migration74.constants.php                          30-Sep-2022 11:05                5905
migration74.deprecated.php                         30-Sep-2022 11:05               16689
migration74.incompatible.php                       30-Sep-2022 11:05               18586
migration74.new-classes.php                        30-Sep-2022 11:05                1517
migration74.new-features.php                       30-Sep-2022 11:05               23972
migration74.new-functions.php                      30-Sep-2022 11:05                3728
migration74.other-changes.php                      30-Sep-2022 11:05               22682
migration74.php                                    30-Sep-2022 11:05                2920
migration74.removed-extensions.php                 30-Sep-2022 11:05                1967
migration74.windows-support.php                    30-Sep-2022 11:05                4008
migration80.deprecated.php                         30-Sep-2022 11:05               19184
migration80.incompatible.php                       30-Sep-2022 11:05               96968
migration80.new-features.php                       30-Sep-2022 11:05               32952
migration80.other-changes.php                      30-Sep-2022 11:05               14803
migration80.php                                    30-Sep-2022 11:05                2374
migration81.constants.php                          30-Sep-2022 11:05                6172
migration81.deprecated.php                         30-Sep-2022 11:05               18228
migration81.incompatible.php                       30-Sep-2022 11:05               22782
migration81.new-classes.php                        30-Sep-2022 11:05                2117
migration81.new-features.php                       30-Sep-2022 11:05               23475
migration81.new-functions.php                      30-Sep-2022 11:05                8457
migration81.other-changes.php                      30-Sep-2022 11:05                9551
migration81.php                                    30-Sep-2022 11:05                2594
migration82.constants.php                          30-Sep-2022 11:05               16108
migration82.deprecated.php                         30-Sep-2022 11:05                6000
migration82.incompatible.php                       30-Sep-2022 11:05                8210
migration82.new-features.php                       30-Sep-2022 11:05                6780
migration82.new-functions.php                      30-Sep-2022 11:05                3401
migration82.other-changes.php                      30-Sep-2022 11:05               24982
migration82.php                                    30-Sep-2022 11:05                2658
migration82.windows-support.php                    30-Sep-2022 11:05                2291
misc.configuration.php                             30-Sep-2022 11:05                5493
misc.constants.php                                 30-Sep-2022 11:05                2109
misc.installation.php                              30-Sep-2022 11:05                1238
misc.requirements.php                              30-Sep-2022 11:05                1183
misc.resources.php                                 30-Sep-2022 11:05                1196
misc.setup.php                                     30-Sep-2022 11:05                1549
mongodb-bson-binary.construct.php                  30-Sep-2022 11:04                7180
mongodb-bson-binary.getdata.php                    30-Sep-2022 11:04                4671
mongodb-bson-binary.gettype.php                    30-Sep-2022 11:04                4645
mongodb-bson-binary.jsonserialize.php              30-Sep-2022 11:04                5596
mongodb-bson-binary.serialize.php                  30-Sep-2022 11:04                3520
mongodb-bson-binary.tostring.php                   30-Sep-2022 11:04                4469
mongodb-bson-binary.unserialize.php                30-Sep-2022 11:04                4441
mongodb-bson-binaryinterface.getdata.php           30-Sep-2022 11:04                2802
mongodb-bson-binaryinterface.gettype.php           30-Sep-2022 11:04                2793
mongodb-bson-binaryinterface.tostring.php          30-Sep-2022 11:04                3296
mongodb-bson-dbpointer.construct.php               30-Sep-2022 11:04                2703
mongodb-bson-dbpointer.jsonserialize.php           30-Sep-2022 11:04                5665
mongodb-bson-dbpointer.serialize.php               30-Sep-2022 11:04                3602
mongodb-bson-dbpointer.tostring.php                30-Sep-2022 11:04                2634
mongodb-bson-dbpointer.unserialize.php             30-Sep-2022 11:04                3849
mongodb-bson-decimal128.construct.php              30-Sep-2022 11:04                6221
mongodb-bson-decimal128.jsonserialize.php          30-Sep-2022 11:04                5686
mongodb-bson-decimal128.serialize.php              30-Sep-2022 11:04                3627
mongodb-bson-decimal128.tostring.php               30-Sep-2022 11:04                5018
mongodb-bson-decimal128.unserialize.php            30-Sep-2022 11:04                4534
mongodb-bson-decimal128interface.tostring.php      30-Sep-2022 11:04                3029
mongodb-bson-int64.construct.php                   30-Sep-2022 11:04                2655
mongodb-bson-int64.jsonserialize.php               30-Sep-2022 11:04                5361
mongodb-bson-int64.serialize.php                   30-Sep-2022 11:04                3502
mongodb-bson-int64.tostring.php                    30-Sep-2022 11:04                3916
mongodb-bson-int64.unserialize.php                 30-Sep-2022 11:04                4411
mongodb-bson-javascript.construct.php              30-Sep-2022 11:04                7196
mongodb-bson-javascript.getcode.php                30-Sep-2022 11:04                4503
mongodb-bson-javascript.getscope.php               30-Sep-2022 11:04                5601
mongodb-bson-javascript.jsonserialize.php          30-Sep-2022 11:04                5682
mongodb-bson-javascript.serialize.php              30-Sep-2022 11:04                3627
mongodb-bson-javascript.tostring.php               30-Sep-2022 11:04                4309
mongodb-bson-javascript.unserialize.php            30-Sep-2022 11:04                4526
mongodb-bson-javascriptinterface.getcode.php       30-Sep-2022 11:04                2872
mongodb-bson-javascriptinterface.getscope.php      30-Sep-2022 11:04                3005
mongodb-bson-javascriptinterface.tostring.php      30-Sep-2022 11:04                3359
mongodb-bson-maxkey.construct.php                  30-Sep-2022 11:04                3800
mongodb-bson-maxkey.jsonserialize.php              30-Sep-2022 11:04                5602
mongodb-bson-maxkey.serialize.php                  30-Sep-2022 11:04                3531
mongodb-bson-maxkey.unserialize.php                30-Sep-2022 11:04                3782
mongodb-bson-minkey.construct.php                  30-Sep-2022 11:04                3800
mongodb-bson-minkey.jsonserialize.php              30-Sep-2022 11:04                5602
mongodb-bson-minkey.serialize.php                  30-Sep-2022 11:04                3531
mongodb-bson-minkey.unserialize.php                30-Sep-2022 11:04                3786
mongodb-bson-objectid.construct.php                30-Sep-2022 11:04                5471
mongodb-bson-objectid.gettimestamp.php             30-Sep-2022 11:04                5850
mongodb-bson-objectid.jsonserialize.php            30-Sep-2022 11:04                5648
mongodb-bson-objectid.serialize.php                30-Sep-2022 11:04                3577
mongodb-bson-objectid.tostring.php                 30-Sep-2022 11:04                4466
mongodb-bson-objectid.unserialize.php              30-Sep-2022 11:04                4478
mongodb-bson-objectidinterface.gettimestamp.php    30-Sep-2022 11:04                2957
mongodb-bson-objectidinterface.tostring.php        30-Sep-2022 11:04                2945
mongodb-bson-regex.construct.php                   30-Sep-2022 11:04                7060
mongodb-bson-regex.getflags.php                    30-Sep-2022 11:04                4654
mongodb-bson-regex.getpattern.php                  30-Sep-2022 11:04                4464
mongodb-bson-regex.jsonserialize.php               30-Sep-2022 11:04                5581
mongodb-bson-regex.serialize.php                   30-Sep-2022 11:04                3502
mongodb-bson-regex.tostring.php                    30-Sep-2022 11:04                4009
mongodb-bson-regex.unserialize.php                 30-Sep-2022 11:04                4417
mongodb-bson-regexinterface.getflags.php           30-Sep-2022 11:04                2794
mongodb-bson-regexinterface.getpattern.php         30-Sep-2022 11:04                2820
mongodb-bson-regexinterface.tostring.php           30-Sep-2022 11:04                2986
mongodb-bson-serializable.bsonserialize.php        30-Sep-2022 11:04               16545
mongodb-bson-symbol.construct.php                  30-Sep-2022 11:04                2643
mongodb-bson-symbol.jsonserialize.php              30-Sep-2022 11:04                5602
mongodb-bson-symbol.serialize.php                  30-Sep-2022 11:04                3527
mongodb-bson-symbol.tostring.php                   30-Sep-2022 11:04                2676
mongodb-bson-symbol.unserialize.php                30-Sep-2022 11:04                3788
mongodb-bson-timestamp.construct.php               30-Sep-2022 11:04                4816
mongodb-bson-timestamp.getincrement.php            30-Sep-2022 11:04                4450
mongodb-bson-timestamp.gettimestamp.php            30-Sep-2022 11:04                4403
mongodb-bson-timestamp.jsonserialize.php           30-Sep-2022 11:04                5669
mongodb-bson-timestamp.serialize.php               30-Sep-2022 11:04                3602
mongodb-bson-timestamp.tostring.php                30-Sep-2022 11:04                4209
mongodb-bson-timestamp.unserialize.php             30-Sep-2022 11:04                4513
mongodb-bson-timestampinterface.getincrement.php   30-Sep-2022 11:04                3409
mongodb-bson-timestampinterface.gettimestamp.php   30-Sep-2022 11:04                3392
mongodb-bson-timestampinterface.tostring.php       30-Sep-2022 11:04                3030
mongodb-bson-undefined.construct.php               30-Sep-2022 11:04                2703
mongodb-bson-undefined.jsonserialize.php           30-Sep-2022 11:04                5665
mongodb-bson-undefined.serialize.php               30-Sep-2022 11:04                3602
mongodb-bson-undefined.tostring.php                30-Sep-2022 11:04                2634
mongodb-bson-undefined.unserialize.php             30-Sep-2022 11:04                3850
mongodb-bson-unserializable.bsonunserialize.php    30-Sep-2022 11:04                7783
mongodb-bson-utcdatetime.construct.php             30-Sep-2022 11:04                8538
mongodb-bson-utcdatetime.jsonserialize.php         30-Sep-2022 11:04                5707
mongodb-bson-utcdatetime.serialize.php             30-Sep-2022 11:04                3654
mongodb-bson-utcdatetime.todatetime.php            30-Sep-2022 11:04                6016
mongodb-bson-utcdatetime.tostring.php              30-Sep-2022 11:04                4126
mongodb-bson-utcdatetime.unserialize.php           30-Sep-2022 11:04                4545
mongodb-bson-utcdatetimeinterface.todatetime.php   30-Sep-2022 11:04                3293
mongodb-bson-utcdatetimeinterface.tostring.php     30-Sep-2022 11:04                3044
mongodb-driver-bulkwrite.construct.php             30-Sep-2022 11:04               20318
mongodb-driver-bulkwrite.count.php                 30-Sep-2022 11:04                7116
mongodb-driver-bulkwrite.delete.php                30-Sep-2022 11:04               11777
mongodb-driver-bulkwrite.insert.php                30-Sep-2022 11:04               10074
mongodb-driver-bulkwrite.update.php                30-Sep-2022 11:04               15034
mongodb-driver-clientencryption.construct.php      30-Sep-2022 11:04                8633
mongodb-driver-clientencryption.createdatakey.php  30-Sep-2022 11:04               10226
mongodb-driver-clientencryption.decrypt.php        30-Sep-2022 11:04                4268
mongodb-driver-clientencryption.encrypt.php        30-Sep-2022 11:04                9985
mongodb-driver-command.construct.php               30-Sep-2022 11:04               15693
mongodb-driver-commandexception.getresultdocume..> 30-Sep-2022 11:04                3223
mongodb-driver-cursor.construct.php                30-Sep-2022 11:04                3514
mongodb-driver-cursor.current.php                  30-Sep-2022 11:04                2898
mongodb-driver-cursor.getid.php                    30-Sep-2022 11:04                8490
mongodb-driver-cursor.getserver.php                30-Sep-2022 11:04                8009
mongodb-driver-cursor.isdead.php                   30-Sep-2022 11:04               11413
mongodb-driver-cursor.key.php                      30-Sep-2022 11:04                2626
mongodb-driver-cursor.next.php                     30-Sep-2022 11:04                3295
mongodb-driver-cursor.rewind.php                   30-Sep-2022 11:04                3713
mongodb-driver-cursor.settypemap.php               30-Sep-2022 11:04                8570
mongodb-driver-cursor.toarray.php                  30-Sep-2022 11:04                8233
mongodb-driver-cursor.valid.php                    30-Sep-2022 11:04                2704
mongodb-driver-cursorid.construct.php              30-Sep-2022 11:04                2857
mongodb-driver-cursorid.serialize.php              30-Sep-2022 11:04                3593
mongodb-driver-cursorid.tostring.php               30-Sep-2022 11:04                7777
mongodb-driver-cursorid.unserialize.php            30-Sep-2022 11:04                4469
mongodb-driver-cursorinterface.getid.php           30-Sep-2022 11:04                4090
mongodb-driver-cursorinterface.getserver.php       30-Sep-2022 11:04                4158
mongodb-driver-cursorinterface.isdead.php          30-Sep-2022 11:04                4043
mongodb-driver-cursorinterface.settypemap.php      30-Sep-2022 11:04                4048
mongodb-driver-cursorinterface.toarray.php         30-Sep-2022 11:04                3912
mongodb-driver-manager.addsubscriber.php           30-Sep-2022 11:04                5152
mongodb-driver-manager.construct.php               30-Sep-2022 11:04               73451
mongodb-driver-manager.createclientencryption.php  30-Sep-2022 11:04               10402
mongodb-driver-manager.executebulkwrite.php        30-Sep-2022 11:04               23685
mongodb-driver-manager.executecommand.php          30-Sep-2022 11:04               26005
mongodb-driver-manager.executequery.php            30-Sep-2022 11:04               16857
mongodb-driver-manager.executereadcommand.php      30-Sep-2022 11:04                9712
mongodb-driver-manager.executereadwritecommand.php 30-Sep-2022 11:04               10727
mongodb-driver-manager.executewritecommand.php     30-Sep-2022 11:04               10837
mongodb-driver-manager.getencryptedfieldsmap.php   30-Sep-2022 11:04                3707
mongodb-driver-manager.getreadconcern.php          30-Sep-2022 11:04                6239
mongodb-driver-manager.getreadpreference.php       30-Sep-2022 11:04                6834
mongodb-driver-manager.getservers.php              30-Sep-2022 11:04                8308
mongodb-driver-manager.getwriteconcern.php         30-Sep-2022 11:04                6292
mongodb-driver-manager.removesubscriber.php        30-Sep-2022 11:04                5013
mongodb-driver-manager.selectserver.php            30-Sep-2022 11:04                6813
mongodb-driver-manager.startsession.php            30-Sep-2022 11:04               11650
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                3676
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                3771
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                3660
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                4828
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                3970
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                4242
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                4228
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                3876
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:04                3718
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:04                3977
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:04                3708
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:04                3610
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:04                5152
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:04                4718
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:04                4534
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:04                3896
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:04                3738
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:04                4979
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:04                5029
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:04                5044
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:04                3733
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:04                3840
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:04                4915
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:04                4027
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:04                4305
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:04                4799
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:04                3936
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:04                3764
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:04                4847
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:04                4817
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:04                5384
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:04                5429
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:04                5460
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:04                4847
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:04                4922
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:04                4859
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:04                4842
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:04                3130
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:04                3506
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:04                3200
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:04                3583
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:04                3306
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:04                3092
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:04                3144
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:04                3262
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:04                3580
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:04                3490
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:04                3267
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:04                3298
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:04                3549
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:04                3272
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:04                3316
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:04                3569
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:04                3632
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:04                3339
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:04                3350
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:04                4164
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:04                3585
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:04                3110
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:04                3162
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:04                3294
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:04                3575
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:04                3653
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:04                3314
mongodb-driver-monitoring-topologyclosedevent.g..> 30-Sep-2022 11:04                3259
mongodb-driver-monitoring-topologyopeningevent...> 30-Sep-2022 11:04                3269
mongodb-driver-query.construct.php                 30-Sep-2022 11:04               31744
mongodb-driver-readconcern.bsonserialize.php       30-Sep-2022 11:04                7808
mongodb-driver-readconcern.construct.php           30-Sep-2022 11:04                6523
mongodb-driver-readconcern.getlevel.php            30-Sep-2022 11:04                6442
mongodb-driver-readconcern.isdefault.php           30-Sep-2022 11:04                8720
mongodb-driver-readconcern.serialize.php           30-Sep-2022 11:04                3670
mongodb-driver-readconcern.unserialize.php         30-Sep-2022 11:04                4520
mongodb-driver-readpreference.bsonserialize.php    30-Sep-2022 11:04               12458
mongodb-driver-readpreference.construct.php        30-Sep-2022 11:04               19584
mongodb-driver-readpreference.gethedge.php         30-Sep-2022 11:04                3328
mongodb-driver-readpreference.getmaxstalenessse..> 30-Sep-2022 11:04                9616
mongodb-driver-readpreference.getmode.php          30-Sep-2022 11:04                8961
mongodb-driver-readpreference.getmodestring.php    30-Sep-2022 11:04                9165
mongodb-driver-readpreference.gettagsets.php       30-Sep-2022 11:04                9162
mongodb-driver-readpreference.serialize.php        30-Sep-2022 11:04                3747
mongodb-driver-readpreference.unserialize.php      30-Sep-2022 11:04                4599
mongodb-driver-runtimeexception.haserrorlabel.php  30-Sep-2022 11:04                4269
mongodb-driver-server.construct.php                30-Sep-2022 11:04                3448
mongodb-driver-server.executebulkwrite.php         30-Sep-2022 11:04               10874
mongodb-driver-server.executecommand.php           30-Sep-2022 11:04               13602
mongodb-driver-server.executequery.php             30-Sep-2022 11:04                8109
mongodb-driver-server.executereadcommand.php       30-Sep-2022 11:04               10145
mongodb-driver-server.executereadwritecommand.php  30-Sep-2022 11:04               11348
mongodb-driver-server.executewritecommand.php      30-Sep-2022 11:04               11424
mongodb-driver-server.gethost.php                  30-Sep-2022 11:04                5908
mongodb-driver-server.getinfo.php                  30-Sep-2022 11:04               11069
mongodb-driver-server.getlatency.php               30-Sep-2022 11:04                7540
mongodb-driver-server.getport.php                  30-Sep-2022 11:04                5928
mongodb-driver-server.getserverdescription.php     30-Sep-2022 11:04                3430
mongodb-driver-server.gettags.php                  30-Sep-2022 11:04                3579
mongodb-driver-server.gettype.php                  30-Sep-2022 11:04                3755
mongodb-driver-server.isarbiter.php                30-Sep-2022 11:04                3504
mongodb-driver-server.ishidden.php                 30-Sep-2022 11:04                3498
mongodb-driver-server.ispassive.php                30-Sep-2022 11:04                3595
mongodb-driver-server.isprimary.php                30-Sep-2022 11:04                3511
mongodb-driver-server.issecondary.php              30-Sep-2022 11:04                3546
mongodb-driver-serverapi.bsonserialize.php         30-Sep-2022 11:04                3297
mongodb-driver-serverapi.construct.php             30-Sep-2022 11:04                3128
mongodb-driver-serverapi.serialize.php             30-Sep-2022 11:04                3623
mongodb-driver-serverapi.unserialize.php           30-Sep-2022 11:04                4487
mongodb-driver-serverdescription.gethellorespon..> 30-Sep-2022 11:04                5196
mongodb-driver-serverdescription.gethost.php       30-Sep-2022 11:04                3411
mongodb-driver-serverdescription.getlastupdatet..> 30-Sep-2022 11:04                3547
mongodb-driver-serverdescription.getport.php       30-Sep-2022 11:04                3466
mongodb-driver-serverdescription.getroundtripti..> 30-Sep-2022 11:04                3807
mongodb-driver-serverdescription.gettype.php       30-Sep-2022 11:04                3683
mongodb-driver-session.aborttransaction.php        30-Sep-2022 11:04                4254
mongodb-driver-session.advanceclustertime.php      30-Sep-2022 11:04                4780
mongodb-driver-session.advanceoperationtime.php    30-Sep-2022 11:04                4838
mongodb-driver-session.committransaction.php       30-Sep-2022 11:04                5667
mongodb-driver-session.construct.php               30-Sep-2022 11:04                2900
mongodb-driver-session.endsession.php              30-Sep-2022 11:04                4386
mongodb-driver-session.getclustertime.php          30-Sep-2022 11:04                3777
mongodb-driver-session.getlogicalsessionid.php     30-Sep-2022 11:04                3080
mongodb-driver-session.getoperationtime.php        30-Sep-2022 11:04                3917
mongodb-driver-session.getserver.php               30-Sep-2022 11:04                3797
mongodb-driver-session.gettransactionoptions.php   30-Sep-2022 11:04                3627
mongodb-driver-session.gettransactionstate.php     30-Sep-2022 11:04                3709
mongodb-driver-session.isdirty.php                 30-Sep-2022 11:04                2966
mongodb-driver-session.isintransaction.php         30-Sep-2022 11:04                3654
mongodb-driver-session.starttransaction.php        30-Sep-2022 11:04                8773
mongodb-driver-topologydescription.getservers.php  30-Sep-2022 11:04                3409
mongodb-driver-topologydescription.gettype.php     30-Sep-2022 11:04                3335
mongodb-driver-topologydescription.hasreadables..> 30-Sep-2022 11:04                3814
mongodb-driver-topologydescription.haswritables..> 30-Sep-2022 11:04                3176
mongodb-driver-writeconcern.bsonserialize.php      30-Sep-2022 11:04                8263
mongodb-driver-writeconcern.construct.php          30-Sep-2022 11:04               11253
mongodb-driver-writeconcern.getjournal.php         30-Sep-2022 11:04                6361
mongodb-driver-writeconcern.getw.php               30-Sep-2022 11:04                5557
mongodb-driver-writeconcern.getwtimeout.php        30-Sep-2022 11:04                6300
mongodb-driver-writeconcern.isdefault.php          30-Sep-2022 11:04                8219
mongodb-driver-writeconcern.serialize.php          30-Sep-2022 11:04                3695
mongodb-driver-writeconcern.unserialize.php        30-Sep-2022 11:04                4559
mongodb-driver-writeconcernerror.getcode.php       30-Sep-2022 11:04                7050
mongodb-driver-writeconcernerror.getinfo.php       30-Sep-2022 11:04                7292
mongodb-driver-writeconcernerror.getmessage.php    30-Sep-2022 11:04                7137
mongodb-driver-writeerror.getcode.php              30-Sep-2022 11:04                6219
mongodb-driver-writeerror.getindex.php             30-Sep-2022 11:04                6759
mongodb-driver-writeerror.getinfo.php              30-Sep-2022 11:04                3009
mongodb-driver-writeerror.getmessage.php           30-Sep-2022 11:04                6352
mongodb-driver-writeexception.getwriteresult.php   30-Sep-2022 11:04                8867
mongodb-driver-writeresult.getdeletedcount.php     30-Sep-2022 11:04                8529
mongodb-driver-writeresult.getinsertedcount.php    30-Sep-2022 11:04                8644
mongodb-driver-writeresult.getmatchedcount.php     30-Sep-2022 11:04                9288
mongodb-driver-writeresult.getmodifiedcount.php    30-Sep-2022 11:04                9553
mongodb-driver-writeresult.getserver.php           30-Sep-2022 11:04                7226
mongodb-driver-writeresult.getupsertedcount.php    30-Sep-2022 11:04                8760
mongodb-driver-writeresult.getupsertedids.php      30-Sep-2022 11:04                9311
mongodb-driver-writeresult.getwriteconcernerror..> 30-Sep-2022 11:04                7896
mongodb-driver-writeresult.getwriteerrors.php      30-Sep-2022 11:04               14652
mongodb-driver-writeresult.isacknowledged.php      30-Sep-2022 11:04                8936
mongodb.architecture.php                           30-Sep-2022 11:04                1922
mongodb.configuration.php                          30-Sep-2022 11:04                3936
mongodb.connection-handling.php                    30-Sep-2022 11:04                9494
mongodb.constants.php                              30-Sep-2022 11:04                1905
mongodb.exceptions.php                             30-Sep-2022 11:04                5208
mongodb.exceptions.tree.php                        30-Sep-2022 11:04                5559
mongodb.installation.homebrew.php                  30-Sep-2022 11:04                1975
mongodb.installation.manual.php                    30-Sep-2022 11:04                6535
mongodb.installation.pecl.php                      30-Sep-2022 11:04                3762
mongodb.installation.php                           30-Sep-2022 11:04                1768
mongodb.installation.windows.php                   30-Sep-2022 11:04                2984
mongodb.monitoring.php                             30-Sep-2022 11:04               18606
mongodb.overview.php                               30-Sep-2022 11:04                7234
mongodb.persistence.deserialization.php            30-Sep-2022 11:04               20897
mongodb.persistence.php                            30-Sep-2022 11:04                1799
mongodb.persistence.serialization.php              30-Sep-2022 11:04               23894
mongodb.requirements.php                           30-Sep-2022 11:04                3117
mongodb.security.php                               30-Sep-2022 11:04                1484
mongodb.security.request_injection.php             30-Sep-2022 11:04                3004
mongodb.security.script_injection.php              30-Sep-2022 11:04               10544
mongodb.setup.php                                  30-Sep-2022 11:04                2065
mongodb.tutorial.apm.php                           30-Sep-2022 11:04               24275
mongodb.tutorial.library.php                       30-Sep-2022 11:04               11315
mongodb.tutorial.php                               30-Sep-2022 11:04                1711
mqseries.configure.php                             30-Sep-2022 11:05                3052
mqseries.constants.php                             30-Sep-2022 11:05                2241
mqseries.ini.php                                   30-Sep-2022 11:05                1339
mqseries.requirements.php                          30-Sep-2022 11:05                1673
mqseries.resources.php                             30-Sep-2022 11:05                1732
mqseries.setup.php                                 30-Sep-2022 11:05                1619
multipleiterator.attachiterator.php                30-Sep-2022 11:05                4270
multipleiterator.construct.php                     30-Sep-2022 11:05                8237
multipleiterator.containsiterator.php              30-Sep-2022 11:05                3408
multipleiterator.countiterators.php                30-Sep-2022 11:05                3162
multipleiterator.current.php                       30-Sep-2022 11:05                4407
multipleiterator.detachiterator.php                30-Sep-2022 11:05                3249
multipleiterator.getflags.php                      30-Sep-2022 11:05                3316
multipleiterator.key.php                           30-Sep-2022 11:05                4281
multipleiterator.next.php                          30-Sep-2022 11:05                2960
multipleiterator.rewind.php                        30-Sep-2022 11:05                2974
multipleiterator.setflags.php                      30-Sep-2022 11:05                3579
multipleiterator.valid.php                         30-Sep-2022 11:05                2987
mysql-xdevapi-baseresult.getwarnings.php           30-Sep-2022 11:04                7070
mysql-xdevapi-baseresult.getwarningscount.php      30-Sep-2022 11:04                6802
mysql-xdevapi-client.close.php                     30-Sep-2022 11:04                2337
mysql-xdevapi-client.construct.php                 30-Sep-2022 11:04                3619
mysql-xdevapi-client.getsession.php                30-Sep-2022 11:04                2403
mysql-xdevapi-collection.add.php                   30-Sep-2022 11:04                9940
mysql-xdevapi-collection.addorreplaceone.php       30-Sep-2022 11:04                8574
mysql-xdevapi-collection.construct.php             30-Sep-2022 11:04                6810
mysql-xdevapi-collection.count.php                 30-Sep-2022 11:04                6918
mysql-xdevapi-collection.createindex.php           30-Sep-2022 11:04               10061
mysql-xdevapi-collection.dropindex.php             30-Sep-2022 11:04                6936
mysql-xdevapi-collection.existsindatabase.php      30-Sep-2022 11:04                6184
mysql-xdevapi-collection.find.php                  30-Sep-2022 11:04               10209
mysql-xdevapi-collection.getname.php               30-Sep-2022 11:04                5251
mysql-xdevapi-collection.getone.php                30-Sep-2022 11:04                7480
mysql-xdevapi-collection.getschema.php             30-Sep-2022 11:04                5458
mysql-xdevapi-collection.getsession.php            30-Sep-2022 11:04                5733
mysql-xdevapi-collection.modify.php                30-Sep-2022 11:04                8543
mysql-xdevapi-collection.remove.php                30-Sep-2022 11:04                8873
mysql-xdevapi-collection.removeone.php             30-Sep-2022 11:04                8126
mysql-xdevapi-collection.replaceone.php            30-Sep-2022 11:04                8389
mysql-xdevapi-collectionadd.construct.php          30-Sep-2022 11:04                8413
mysql-xdevapi-collectionadd.execute.php            30-Sep-2022 11:04                8399
mysql-xdevapi-collectionfind.bind.php              30-Sep-2022 11:04                8284
mysql-xdevapi-collectionfind.construct.php         30-Sep-2022 11:04                7287
mysql-xdevapi-collectionfind.execute.php           30-Sep-2022 11:04                7468
mysql-xdevapi-collectionfind.fields.php            30-Sep-2022 11:04                7886
mysql-xdevapi-collectionfind.groupby.php           30-Sep-2022 11:04                4352
mysql-xdevapi-collectionfind.having.php            30-Sep-2022 11:04                4596
mysql-xdevapi-collectionfind.limit.php             30-Sep-2022 11:04                8551
mysql-xdevapi-collectionfind.lockexclusive.php     30-Sep-2022 11:04                6716
mysql-xdevapi-collectionfind.lockshared.php        30-Sep-2022 11:04                6519
mysql-xdevapi-collectionfind.offset.php            30-Sep-2022 11:04                8298
mysql-xdevapi-collectionfind.sort.php              30-Sep-2022 11:04                8408
mysql-xdevapi-collectionmodify.arrayappend.php     30-Sep-2022 11:04                8367
mysql-xdevapi-collectionmodify.arrayinsert.php     30-Sep-2022 11:04                8786
mysql-xdevapi-collectionmodify.bind.php            30-Sep-2022 11:04                8511
mysql-xdevapi-collectionmodify.construct.php       30-Sep-2022 11:04                7156
mysql-xdevapi-collectionmodify.execute.php         30-Sep-2022 11:04                3293
mysql-xdevapi-collectionmodify.limit.php           30-Sep-2022 11:04                8962
mysql-xdevapi-collectionmodify.patch.php           30-Sep-2022 11:04                4211
mysql-xdevapi-collectionmodify.replace.php         30-Sep-2022 11:04                8184
mysql-xdevapi-collectionmodify.set.php             30-Sep-2022 11:04                8126
mysql-xdevapi-collectionmodify.skip.php            30-Sep-2022 11:04                4880
mysql-xdevapi-collectionmodify.sort.php            30-Sep-2022 11:04                4923
mysql-xdevapi-collectionmodify.unset.php           30-Sep-2022 11:04                4511
mysql-xdevapi-collectionremove.bind.php            30-Sep-2022 11:04                5172
mysql-xdevapi-collectionremove.construct.php       30-Sep-2022 11:04                7662
mysql-xdevapi-collectionremove.execute.php         30-Sep-2022 11:04                4081
mysql-xdevapi-collectionremove.limit.php           30-Sep-2022 11:04                4512
mysql-xdevapi-collectionremove.sort.php            30-Sep-2022 11:04                4590
mysql-xdevapi-columnresult.construct.php           30-Sep-2022 11:04               10028
mysql-xdevapi-columnresult.getcharactersetname.php 30-Sep-2022 11:04                3281
mysql-xdevapi-columnresult.getcollationname.php    30-Sep-2022 11:04                3260
mysql-xdevapi-columnresult.getcolumnlabel.php      30-Sep-2022 11:04                3226
mysql-xdevapi-columnresult.getcolumnname.php       30-Sep-2022 11:04                3221
mysql-xdevapi-columnresult.getfractionaldigits.php 30-Sep-2022 11:04                3332
mysql-xdevapi-columnresult.getlength.php           30-Sep-2022 11:04                3176
mysql-xdevapi-columnresult.getschemaname.php       30-Sep-2022 11:04                3250
mysql-xdevapi-columnresult.gettablelabel.php       30-Sep-2022 11:04                3205
mysql-xdevapi-columnresult.gettablename.php        30-Sep-2022 11:04                3215
mysql-xdevapi-columnresult.gettype.php             30-Sep-2022 11:04                3132
mysql-xdevapi-columnresult.isnumbersigned.php      30-Sep-2022 11:04                3378
mysql-xdevapi-columnresult.ispadded.php            30-Sep-2022 11:04                3219
mysql-xdevapi-crudoperationbindable.bind.php       30-Sep-2022 11:04                5822
mysql-xdevapi-crudoperationlimitable.limit.php     30-Sep-2022 11:04                5913
mysql-xdevapi-crudoperationskippable.skip.php      30-Sep-2022 11:04                4584
mysql-xdevapi-crudoperationsortable.sort.php       30-Sep-2022 11:04                4620
mysql-xdevapi-databaseobject.existsindatabase.php  30-Sep-2022 11:04                3510
mysql-xdevapi-databaseobject.getname.php           30-Sep-2022 11:04                3452
mysql-xdevapi-databaseobject.getsession.php        30-Sep-2022 11:04                3555
mysql-xdevapi-docresult.construct.php              30-Sep-2022 11:04                7821
mysql-xdevapi-docresult.fetchall.php               30-Sep-2022 11:04                8274
mysql-xdevapi-docresult.fetchone.php               30-Sep-2022 11:04                7916
mysql-xdevapi-docresult.getwarnings.php            30-Sep-2022 11:04                8937
mysql-xdevapi-docresult.getwarningscount.php       30-Sep-2022 11:04                8749
mysql-xdevapi-executable.execute.php               30-Sep-2022 11:04                6776
mysql-xdevapi-executionstatus.construct.php        30-Sep-2022 11:04                3001
mysql-xdevapi-expression.construct.php             30-Sep-2022 11:04                3089
mysql-xdevapi-result.construct.php                 30-Sep-2022 11:04                7363
mysql-xdevapi-result.getaffecteditemscount.php     30-Sep-2022 11:04                6164
mysql-xdevapi-result.getautoincrementvalue.php     30-Sep-2022 11:04                7703
mysql-xdevapi-result.getgeneratedids.php           30-Sep-2022 11:04                6989
mysql-xdevapi-result.getwarnings.php               30-Sep-2022 11:04                6952
mysql-xdevapi-result.getwarningscount.php          30-Sep-2022 11:04                6648
mysql-xdevapi-rowresult.construct.php              30-Sep-2022 11:04                5024
mysql-xdevapi-rowresult.fetchall.php               30-Sep-2022 11:04                6722
mysql-xdevapi-rowresult.fetchone.php               30-Sep-2022 11:04                6912
mysql-xdevapi-rowresult.getcolumncount.php         30-Sep-2022 11:04                6200
mysql-xdevapi-rowresult.getcolumnnames.php         30-Sep-2022 11:04                6239
mysql-xdevapi-rowresult.getcolumns.php             30-Sep-2022 11:04                7200
mysql-xdevapi-rowresult.getwarnings.php            30-Sep-2022 11:04                6999
mysql-xdevapi-rowresult.getwarningscount.php       30-Sep-2022 11:04                6694
mysql-xdevapi-schema.construct.php                 30-Sep-2022 11:04                5549
mysql-xdevapi-schema.createcollection.php          30-Sep-2022 11:04               10332
mysql-xdevapi-schema.dropcollection.php            30-Sep-2022 11:04                6686
mysql-xdevapi-schema.existsindatabase.php          30-Sep-2022 11:04                6551
mysql-xdevapi-schema.getcollection.php             30-Sep-2022 11:04                5697
mysql-xdevapi-schema.getcollectionastable.php      30-Sep-2022 11:04                7329
mysql-xdevapi-schema.getcollections.php            30-Sep-2022 11:04                6436
mysql-xdevapi-schema.getname.php                   30-Sep-2022 11:04                4838
mysql-xdevapi-schema.getsession.php                30-Sep-2022 11:04                5336
mysql-xdevapi-schema.gettable.php                  30-Sep-2022 11:04                6896
mysql-xdevapi-schema.gettables.php                 30-Sep-2022 11:04                7141
mysql-xdevapi-schemaobject.getschema.php           30-Sep-2022 11:04                4105
mysql-xdevapi-session.close.php                    30-Sep-2022 11:04                3984
mysql-xdevapi-session.commit.php                   30-Sep-2022 11:04                4785
mysql-xdevapi-session.construct.php                30-Sep-2022 11:04                3144
mysql-xdevapi-session.createschema.php             30-Sep-2022 11:04                4999
mysql-xdevapi-session.dropschema.php               30-Sep-2022 11:04                4091
mysql-xdevapi-session.generateuuid.php             30-Sep-2022 11:04                4013
mysql-xdevapi-session.getdefaultschema.php         30-Sep-2022 11:04                4171
mysql-xdevapi-session.getschema.php                30-Sep-2022 11:04                4275
mysql-xdevapi-session.getschemas.php               30-Sep-2022 11:04                4106
mysql-xdevapi-session.getserverversion.php         30-Sep-2022 11:04                3949
mysql-xdevapi-session.listclients.php              30-Sep-2022 11:04                4273
mysql-xdevapi-session.quotename.php                30-Sep-2022 11:04                5376
mysql-xdevapi-session.releasesavepoint.php         30-Sep-2022 11:04                5706
mysql-xdevapi-session.rollback.php                 30-Sep-2022 11:04                5411
mysql-xdevapi-session.rollbackto.php               30-Sep-2022 11:04                5785
mysql-xdevapi-session.setsavepoint.php             30-Sep-2022 11:04                6025
mysql-xdevapi-session.sql.php                      30-Sep-2022 11:04                3949
mysql-xdevapi-session.starttransaction.php         30-Sep-2022 11:04                5487
mysql-xdevapi-sqlstatement.bind.php                30-Sep-2022 11:04                3378
mysql-xdevapi-sqlstatement.construct.php           30-Sep-2022 11:04                2939
mysql-xdevapi-sqlstatement.execute.php             30-Sep-2022 11:04                3230
mysql-xdevapi-sqlstatement.getnextresult.php       30-Sep-2022 11:04                3282
mysql-xdevapi-sqlstatement.getresult.php           30-Sep-2022 11:04                3251
mysql-xdevapi-sqlstatement.hasmoreresults.php      30-Sep-2022 11:04                3301
mysql-xdevapi-sqlstatementresult.construct.php     30-Sep-2022 11:04                3059
mysql-xdevapi-sqlstatementresult.fetchall.php      30-Sep-2022 11:04                7156
mysql-xdevapi-sqlstatementresult.fetchone.php      30-Sep-2022 11:04                6985
mysql-xdevapi-sqlstatementresult.getaffectedite..> 30-Sep-2022 11:04                3416
mysql-xdevapi-sqlstatementresult.getcolumncount..> 30-Sep-2022 11:04                3944
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 30-Sep-2022 11:04                3332
mysql-xdevapi-sqlstatementresult.getcolumns.php    30-Sep-2022 11:04                3288
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 30-Sep-2022 11:04                3446
mysql-xdevapi-sqlstatementresult.getlastinserti..> 30-Sep-2022 11:04                3389