Index of /php.ihc-ru.net/manual/zh/


../
feeds/                                             30-Sep-2022 11:04                   -
images/                                            30-Sep-2022 11:04                   -
styles/                                            30-Sep-2022 11:03                   -
toc/                                               30-Sep-2022 11:04                   -
about.formats.php                                  30-Sep-2022 11:04                4196
about.generate.php                                 30-Sep-2022 11:04                2663
about.howtohelp.php                                30-Sep-2022 11:04                2902
about.more.php                                     30-Sep-2022 11:04                1722
about.notes.php                                    30-Sep-2022 11:04                2177
about.php                                          30-Sep-2022 11:04                1806
about.phpversions.php                              30-Sep-2022 11:04                3020
about.prototypes.php                               30-Sep-2022 11:04                7038
about.translations.php                             30-Sep-2022 11:04                2933
aliases.php                                        30-Sep-2022 11:04               29611
apache.configuration.php                           30-Sep-2022 11:03                4594
apache.constants.php                               30-Sep-2022 11:03                1091
apache.installation.php                            30-Sep-2022 11:03                1166
apache.requirements.php                            30-Sep-2022 11:03                1106
apache.resources.php                               30-Sep-2022 11:03                1126
apache.setup.php                                   30-Sep-2022 11:03                1496
apcu.configuration.php                             30-Sep-2022 11:03               14270
apcu.constants.php                                 30-Sep-2022 11:03                5155
apcu.installation.php                              30-Sep-2022 11:03                3106
apcu.requirements.php                              30-Sep-2022 11:03                1092
apcu.resources.php                                 30-Sep-2022 11:03                1112
apcu.setup.php                                     30-Sep-2022 11:03                1450
apcuiterator.construct.php                         30-Sep-2022 11:03                6364
apcuiterator.current.php                           30-Sep-2022 11:03                2926
apcuiterator.gettotalcount.php                     30-Sep-2022 11:03                3031
apcuiterator.gettotalhits.php                      30-Sep-2022 11:03                3115
apcuiterator.gettotalsize.php                      30-Sep-2022 11:03                2923
apcuiterator.key.php                               30-Sep-2022 11:03                2619
apcuiterator.next.php                              30-Sep-2022 11:03                2862
apcuiterator.rewind.php                            30-Sep-2022 11:03                2633
apcuiterator.valid.php                             30-Sep-2022 11:03                2715
appendices.php                                     30-Sep-2022 11:04               11064
appenditerator.append.php                          30-Sep-2022 11:03                5466
appenditerator.construct.php                       30-Sep-2022 11:03               10487
appenditerator.current.php                         30-Sep-2022 11:03                3433
appenditerator.getarrayiterator.php                30-Sep-2022 11:03                3114
appenditerator.getinneriterator.php                30-Sep-2022 11:03                6778
appenditerator.getiteratorindex.php                30-Sep-2022 11:03                6719
appenditerator.key.php                             30-Sep-2022 11:03                8126
appenditerator.next.php                            30-Sep-2022 11:03                3317
appenditerator.rewind.php                          30-Sep-2022 11:03                3307
appenditerator.valid.php                           30-Sep-2022 11:03                3161
array.configuration.php                            30-Sep-2022 11:03                1162
array.constants.php                                30-Sep-2022 11:03                7971
array.installation.php                             30-Sep-2022 11:03                1141
array.requirements.php                             30-Sep-2022 11:03                1099
array.resources.php                                30-Sep-2022 11:03                1119
array.setup.php                                    30-Sep-2022 11:03                1459
array.sorting.php                                  30-Sep-2022 11:03                6658
arrayaccess.offsetexists.php                       30-Sep-2022 11:03                9568
arrayaccess.offsetget.php                          30-Sep-2022 11:03                4666
arrayaccess.offsetset.php                          30-Sep-2022 11:03                5042
arrayaccess.offsetunset.php                        30-Sep-2022 11:03                2799
arrayiterator.append.php                           30-Sep-2022 11:03                3390
arrayiterator.asort.php                            30-Sep-2022 11:03                5780
arrayiterator.construct.php                        30-Sep-2022 11:03                3470
arrayiterator.count.php                            30-Sep-2022 11:03                2845
arrayiterator.current.php                          30-Sep-2022 11:03                5343
arrayiterator.getarraycopy.php                     30-Sep-2022 11:03                2810
arrayiterator.getflags.php                         30-Sep-2022 11:03                2970
arrayiterator.key.php                              30-Sep-2022 11:03                3764
arrayiterator.ksort.php                            30-Sep-2022 11:03                5759
arrayiterator.natcasesort.php                      30-Sep-2022 11:03                3968
arrayiterator.natsort.php                          30-Sep-2022 11:03                3768
arrayiterator.next.php                             30-Sep-2022 11:03                4630
arrayiterator.offsetexists.php                     30-Sep-2022 11:03                3124
arrayiterator.offsetget.php                        30-Sep-2022 11:03                3370
arrayiterator.offsetset.php                        30-Sep-2022 11:03                3609
arrayiterator.offsetunset.php                      30-Sep-2022 11:03                3738
arrayiterator.rewind.php                           30-Sep-2022 11:03                4616
arrayiterator.seek.php                             30-Sep-2022 11:03                2434
arrayiterator.serialize.php                        30-Sep-2022 11:03                2721
arrayiterator.setflags.php                         30-Sep-2022 11:03                3989
arrayiterator.uasort.php                           30-Sep-2022 11:03                5010
arrayiterator.uksort.php                           30-Sep-2022 11:03                4770
arrayiterator.unserialize.php                      30-Sep-2022 11:03                2951
arrayiterator.valid.php                            30-Sep-2022 11:03                4516
arrayobject.append.php                             30-Sep-2022 11:03                5413
arrayobject.asort.php                              30-Sep-2022 11:03                8791
arrayobject.construct.php                          30-Sep-2022 11:03                5989
arrayobject.count.php                              30-Sep-2022 11:03                5369
arrayobject.exchangearray.php                      30-Sep-2022 11:03                6060
arrayobject.getarraycopy.php                       30-Sep-2022 11:03                5275
arrayobject.getflags.php                           30-Sep-2022 11:03                6136
arrayobject.getiterator.php                        30-Sep-2022 11:03                5482
arrayobject.getiteratorclass.php                   30-Sep-2022 11:03                6680
arrayobject.ksort.php                              30-Sep-2022 11:03                8481
arrayobject.natcasesort.php                        30-Sep-2022 11:03                7567
arrayobject.natsort.php                            30-Sep-2022 11:03                7267
arrayobject.offsetexists.php                       30-Sep-2022 11:03                4778
arrayobject.offsetget.php                          30-Sep-2022 11:03                5075
arrayobject.offsetset.php                          30-Sep-2022 11:03                6854
arrayobject.offsetunset.php                        30-Sep-2022 11:03                4203
arrayobject.serialize.php                          30-Sep-2022 11:03                4958
arrayobject.setflags.php                           30-Sep-2022 11:03                6760
arrayobject.setiteratorclass.php                   30-Sep-2022 11:03                5883
arrayobject.uasort.php                             30-Sep-2022 11:03                9864
arrayobject.uksort.php                             30-Sep-2022 11:03                9190
arrayobject.unserialize.php                        30-Sep-2022 11:03                3389
backedenum.from.php                                30-Sep-2022 11:03                5888
backedenum.tryfrom.php                             30-Sep-2022 11:03                6196
bc.configuration.php                               30-Sep-2022 11:03                2266
bc.constants.php                                   30-Sep-2022 11:03                1067
bc.installation.php                                30-Sep-2022 11:03                1305
bc.requirements.php                                30-Sep-2022 11:03                1078
bc.resources.php                                   30-Sep-2022 11:03                1098
bc.setup.php                                       30-Sep-2022 11:03                1454
book.apache.php                                    30-Sep-2022 11:03                3074
book.apcu.php                                      30-Sep-2022 11:03                4238
book.array.php                                     30-Sep-2022 11:03               10821
book.bc.php                                        30-Sep-2022 11:03                2718
book.bson.php                                      30-Sep-2022 11:03               19843
book.bzip2.php                                     30-Sep-2022 11:03                2805
book.calendar.php                                  30-Sep-2022 11:03                3866
book.classobj.php                                  30-Sep-2022 11:03                4113
book.cmark.php                                     30-Sep-2022 11:03                8621
book.com.php                                       30-Sep-2022 11:03                7803
book.componere.php                                 30-Sep-2022 11:03                6088
book.csprng.php                                    30-Sep-2022 11:03                2037
book.ctype.php                                     30-Sep-2022 11:03                2880
book.cubrid.php                                    30-Sep-2022 11:03               13736
book.curl.php                                      30-Sep-2022 11:03                6817
book.datetime.php                                  30-Sep-2022 11:03               15501
book.dba.php                                       30-Sep-2022 11:03                3302
book.dbase.php                                     30-Sep-2022 11:03                3114
book.dio.php                                       30-Sep-2022 11:03                2821
book.dir.php                                       30-Sep-2022 11:03                2867
book.dom.php                                       30-Sep-2022 11:03               17639
book.ds.php                                        30-Sep-2022 11:03               24995
book.eio.php                                       30-Sep-2022 11:03                7804
book.enchant.php                                   30-Sep-2022 11:03                5198
book.errorfunc.php                                 30-Sep-2022 11:03                3286
book.ev.php                                        30-Sep-2022 11:03               13253
book.event.php                                     30-Sep-2022 11:03               22860
book.exec.php                                      30-Sep-2022 11:03                3042
book.exif.php                                      30-Sep-2022 11:03                2355
book.expect.php                                    30-Sep-2022 11:03                2363
book.fann.php                                      30-Sep-2022 11:03               21759
book.fdf.php                                       30-Sep-2022 11:03                5510
book.ffi.php                                       30-Sep-2022 11:03                5525
book.fileinfo.php                                  30-Sep-2022 11:03                2901
book.filesystem.php                                30-Sep-2022 11:03                9291
book.filter.php                                    30-Sep-2022 11:03                3311
book.fpm.php                                       30-Sep-2022 11:03                1898
book.ftp.php                                       30-Sep-2022 11:03                5575
book.funchand.php                                  30-Sep-2022 11:03                3491
book.gearman.php                                   30-Sep-2022 11:03               14698
book.gender.php                                    30-Sep-2022 11:03                2483
book.geoip.php                                     30-Sep-2022 11:03                4091
book.gettext.php                                   30-Sep-2022 11:03                2809
book.gmagick.php                                   30-Sep-2022 11:03               22464
book.gmp.php                                       30-Sep-2022 11:03                6329
book.gnupg.php                                     30-Sep-2022 11:03                4760
book.hash.php                                      30-Sep-2022 11:03                3473
book.hrtime.php                                    30-Sep-2022 11:03                3382
book.ibase.php                                     30-Sep-2022 11:03               11832
book.ibm-db2.php                                   30-Sep-2022 11:03                8530
book.iconv.php                                     30-Sep-2022 11:03                3056
book.igbinary.php                                  30-Sep-2022 11:03                2033
book.image.php                                     30-Sep-2022 11:03               14979
book.imagick.php                                   30-Sep-2022 11:03               61191
book.imap.php                                      30-Sep-2022 11:03                9884
book.info.php                                      30-Sep-2022 11:03                7499
book.inotify.php                                   30-Sep-2022 11:03                2427
book.intl.php                                      30-Sep-2022 11:03               44237
book.json.php                                      30-Sep-2022 11:03                2692
book.ldap.php                                      30-Sep-2022 11:03                8809
book.libxml.php                                    30-Sep-2022 11:03                2851
book.lua.php                                       30-Sep-2022 11:03                2519
book.luasandbox.php                                30-Sep-2022 11:03                5459
book.lzf.php                                       30-Sep-2022 11:03                2068
book.mail.php                                      30-Sep-2022 11:03                1953
book.mailparse.php                                 30-Sep-2022 11:03                3796
book.math.php                                      30-Sep-2022 11:03                5634
book.mbstring.php                                  30-Sep-2022 11:03                9305
book.mcrypt.php                                    30-Sep-2022 11:03                5870
book.memcache.php                                  30-Sep-2022 11:03                4114
book.memcached.php                                 30-Sep-2022 11:03                7855
book.mhash.php                                     30-Sep-2022 11:03                2350
book.misc.php                                      30-Sep-2022 11:03                5042
book.mongodb.php                                   30-Sep-2022 11:03               18461
book.mqseries.php                                  30-Sep-2022 11:03                3065
book.mysql-xdevapi.php                             30-Sep-2022 11:03               28889
book.mysql.php                                     30-Sep-2022 11:03                7416
book.mysqli.php                                    30-Sep-2022 11:03               17233
book.mysqlnd.php                                   30-Sep-2022 11:03                2393
book.network.php                                   30-Sep-2022 11:03                5447
book.oauth.php                                     30-Sep-2022 11:03                7046
book.oci8.php                                      30-Sep-2022 11:03               16269
book.opcache.php                                   30-Sep-2022 11:03                2530
book.openal.php                                    30-Sep-2022 11:03                4303
book.openssl.php                                   30-Sep-2022 11:03               10293
book.outcontrol.php                                30-Sep-2022 11:03                4080
book.parallel.php                                  30-Sep-2022 11:03                5660
book.parle.php                                     30-Sep-2022 11:03                8717
book.password.php                                  30-Sep-2022 11:03                2453
book.pcntl.php                                     30-Sep-2022 11:03                5045
book.pcre.php                                      30-Sep-2022 11:03                3591
book.pdo.php                                       30-Sep-2022 11:03                7513
book.pgsql.php                                     30-Sep-2022 11:03               11847
book.phar.php                                      30-Sep-2022 11:03               15602
book.phpdbg.php                                    30-Sep-2022 11:03                2797
book.posix.php                                     30-Sep-2022 11:03                6015
book.ps.php                                        30-Sep-2022 11:03                9076
book.pspell.php                                    30-Sep-2022 11:03                4311
book.pthreads.php                                  30-Sep-2022 11:03                5274
book.quickhash.php                                 30-Sep-2022 11:03                8787
book.radius.php                                    30-Sep-2022 11:03                5408
book.rar.php                                       30-Sep-2022 11:03                5127
book.readline.php                                  30-Sep-2022 11:03                3483
book.recode.php                                    30-Sep-2022 11:03                2154
book.reflection.php                                30-Sep-2022 11:03               35388
book.rpminfo.php                                   30-Sep-2022 11:03                2309
book.rrd.php                                       30-Sep-2022 11:03                4985
book.runkit7.php                                   30-Sep-2022 11:03                4110
book.scoutapm.php                                  30-Sep-2022 11:03                2083
book.seaslog.php                                   30-Sep-2022 11:03                5053
book.sem.php                                       30-Sep-2022 11:03                4029
book.session.php                                   30-Sep-2022 11:03                6685
book.shmop.php                                     30-Sep-2022 11:03                2671
book.simplexml.php                                 30-Sep-2022 11:03                5407
book.snmp.php                                      30-Sep-2022 11:03                5644
book.soap.php                                      30-Sep-2022 11:03                5972
book.sockets.php                                   30-Sep-2022 11:03                6786
book.sodium.php                                    30-Sep-2022 11:03               17204
book.solr.php                                      30-Sep-2022 11:03               52961
book.spl.php                                       30-Sep-2022 11:03                9730
book.sqlite3.php                                   30-Sep-2022 11:03                6868
book.sqlsrv.php                                    30-Sep-2022 11:03                5221
book.ssdeep.php                                    30-Sep-2022 11:03                2204
book.ssh2.php                                      30-Sep-2022 11:03                5337
book.stats.php                                     30-Sep-2022 11:03               11687
book.stomp.php                                     30-Sep-2022 11:03                4022
book.stream.php                                    30-Sep-2022 11:03               11416
book.strings.php                                   30-Sep-2022 11:03               12444
book.svm.php                                       30-Sep-2022 11:03                3557
book.svn.php                                       30-Sep-2022 11:03                7445
book.swoole.php                                    30-Sep-2022 11:03               37202
book.sync.php                                      30-Sep-2022 11:03                4647
book.taint.php                                     30-Sep-2022 11:03                2407
book.tcpwrap.php                                   30-Sep-2022 11:03                1929
book.tidy.php                                      30-Sep-2022 11:03                6458
book.tokenizer.php                                 30-Sep-2022 11:03                3003
book.trader.php                                    30-Sep-2022 11:03               17387
book.ui.php                                        30-Sep-2022 11:04               27864
book.uodbc.php                                     30-Sep-2022 11:03                6423
book.uopz.php                                      30-Sep-2022 11:03                4978
book.url.php                                       30-Sep-2022 11:03                2872
book.v8js.php                                      30-Sep-2022 11:03                2981
book.var.php                                       30-Sep-2022 11:03                5342
book.var_representation.php                        30-Sep-2022 11:03                2030
book.varnish.php                                   30-Sep-2022 11:03                5248
book.wddx.php                                      30-Sep-2022 11:03                2674
book.win32service.php                              30-Sep-2022 11:03                5032
book.wincache.php                                  30-Sep-2022 11:03                5482
book.wkhtmltox.php                                 30-Sep-2022 11:03                3207
book.xattr.php                                     30-Sep-2022 11:03                2315
book.xdiff.php                                     30-Sep-2022 11:03                3958
book.xhprof.php                                    30-Sep-2022 11:03                2353
book.xlswriter.php                                 30-Sep-2022 11:03                4318
book.xml.php                                       30-Sep-2022 11:03                5240
book.xmldiff.php                                   30-Sep-2022 11:03                3021
book.xmlreader.php                                 30-Sep-2022 11:03                4708
book.xmlrpc.php                                    30-Sep-2022 11:03                3609
book.xmlwriter.php                                 30-Sep-2022 11:03                6399
book.xsl.php                                       30-Sep-2022 11:03                3631
book.yac.php                                       30-Sep-2022 11:03                2473
book.yaconf.php                                    30-Sep-2022 11:03                2020
book.yaf.php                                       30-Sep-2022 11:03               34566
book.yaml.php                                      30-Sep-2022 11:03                2639
book.yar.php                                       30-Sep-2022 11:03                3609
book.yaz.php                                       30-Sep-2022 11:03                4229
book.zip.php                                       30-Sep-2022 11:03                9665
book.zlib.php                                      30-Sep-2022 11:03                4812
book.zmq.php                                       30-Sep-2022 11:03                5409
book.zookeeper.php                                 30-Sep-2022 11:03                6531
bzip2.configuration.php                            30-Sep-2022 11:03                1162
bzip2.constants.php                                30-Sep-2022 11:03                1081
bzip2.examples.php                                 30-Sep-2022 11:03                4136
bzip2.installation.php                             30-Sep-2022 11:03                1248
bzip2.requirements.php                             30-Sep-2022 11:03                1268
bzip2.resources.php                                30-Sep-2022 11:03                1173
bzip2.setup.php                                    30-Sep-2022 11:03                1480
cachingiterator.construct.php                      30-Sep-2022 11:03                2682
cachingiterator.count.php                          30-Sep-2022 11:03                2339
cachingiterator.current.php                        30-Sep-2022 11:03                2747
cachingiterator.getcache.php                       30-Sep-2022 11:03                5556
cachingiterator.getflags.php                       30-Sep-2022 11:03                2351
cachingiterator.getinneriterator.php               30-Sep-2022 11:03                2490
cachingiterator.hasnext.php                        30-Sep-2022 11:03                2365
cachingiterator.key.php                            30-Sep-2022 11:03                2135
cachingiterator.next.php                           30-Sep-2022 11:03                2283
cachingiterator.offsetexists.php                   30-Sep-2022 11:03                2651
cachingiterator.offsetget.php                      30-Sep-2022 11:03                2602
cachingiterator.offsetset.php                      30-Sep-2022 11:03                2944
cachingiterator.offsetunset.php                    30-Sep-2022 11:03                2572
cachingiterator.rewind.php                         30-Sep-2022 11:03                2299
cachingiterator.setflags.php                       30-Sep-2022 11:03                2606
cachingiterator.tostring.php                       30-Sep-2022 11:03                2409
cachingiterator.valid.php                          30-Sep-2022 11:03                2396
calendar.configuration.php                         30-Sep-2022 11:03                1183
calendar.constants.php                             30-Sep-2022 11:03                5745
calendar.installation.php                          30-Sep-2022 11:03                1349
calendar.requirements.php                          30-Sep-2022 11:03                1120
calendar.resources.php                             30-Sep-2022 11:03                1140
calendar.setup.php                                 30-Sep-2022 11:03                1519
callbackfilteriterator.accept.php                  30-Sep-2022 11:03                3273
callbackfilteriterator.construct.php               30-Sep-2022 11:03                3818
cc.license.php                                     30-Sep-2022 11:04               21001
changelog.misc.php                                 30-Sep-2022 11:03                3156
changelog.mysql.php                                30-Sep-2022 11:03                3534
changelog.mysql_xdevapi.php                        30-Sep-2022 11:03                2229
changelog.strings.php                              30-Sep-2022 11:03               11232
class.addressinfo.php                              30-Sep-2022 11:03                1742
class.apcuiterator.php                             30-Sep-2022 11:03                5434
class.appenditerator.php                           30-Sep-2022 11:03                8045
class.argumentcounterror.php                       30-Sep-2022 11:03                6587
class.arithmeticerror.php                          30-Sep-2022 11:03                6766
class.arrayaccess.php                              30-Sep-2022 11:03               13030
class.arrayiterator.php                            30-Sep-2022 11:03               15381
class.arrayobject.php                              30-Sep-2022 11:03               14766
class.assertionerror.php                           30-Sep-2022 11:03                6601
class.backedenum.php                               30-Sep-2022 11:03                3924
class.badfunctioncallexception.php                 30-Sep-2022 11:03                6720
class.badmethodcallexception.php                   30-Sep-2022 11:03                6733
class.cachingiterator.php                          30-Sep-2022 11:03               16085
class.callbackfilteriterator.php                   30-Sep-2022 11:03               12150
class.closure.php                                  30-Sep-2022 11:03                6229
class.collator.php                                 30-Sep-2022 11:03               24128
class.collectable.php                              30-Sep-2022 11:03                2390
class.com-exception.php                            30-Sep-2022 11:03                6531
class.com.php                                      30-Sep-2022 11:03               12768
class.commonmark-cql.php                           30-Sep-2022 11:03                7541
class.commonmark-interfaces-ivisitable.php         30-Sep-2022 11:03                2865
class.commonmark-interfaces-ivisitor.php           30-Sep-2022 11:03                4228
class.commonmark-node-blockquote.php               30-Sep-2022 11:03                8222
class.commonmark-node-bulletlist.php               30-Sep-2022 11:03               10091
class.commonmark-node-code.php                     30-Sep-2022 11:03                9096
class.commonmark-node-codeblock.php                30-Sep-2022 11:03               10286
class.commonmark-node-customblock.php              30-Sep-2022 11:03                8846
class.commonmark-node-custominline.php             30-Sep-2022 11:03                8826
class.commonmark-node-document.php                 30-Sep-2022 11:03                8168
class.commonmark-node-heading.php                  30-Sep-2022 11:03                9447
class.commonmark-node-htmlblock.php                30-Sep-2022 11:03                9154
class.commonmark-node-htmlinline.php               30-Sep-2022 11:03                9130
class.commonmark-node-image.php                    30-Sep-2022 11:03               10171
class.commonmark-node-item.php                     30-Sep-2022 11:03                8189
class.commonmark-node-linebreak.php                30-Sep-2022 11:03                8203
class.commonmark-node-link.php                     30-Sep-2022 11:03               10164
class.commonmark-node-orderedlist.php              30-Sep-2022 11:03               10825
class.commonmark-node-paragraph.php                30-Sep-2022 11:03                8228
class.commonmark-node-softbreak.php                30-Sep-2022 11:03                8221
class.commonmark-node-text-emphasis.php            30-Sep-2022 11:03                8250
class.commonmark-node-text-strong.php              30-Sep-2022 11:03                8239
class.commonmark-node-text.php                     30-Sep-2022 11:03                9481
class.commonmark-node-thematicbreak.php            30-Sep-2022 11:03                8250
class.commonmark-node.php                          30-Sep-2022 11:03                9127
class.commonmark-parser.php                        30-Sep-2022 11:03                3598
class.compersisthelper.php                         30-Sep-2022 11:03                6512
class.compileerror.php                             30-Sep-2022 11:03                6522
class.componere-abstract-definition.php            30-Sep-2022 11:03                4566
class.componere-definition.php                     30-Sep-2022 11:03                9356
class.componere-method.php                         30-Sep-2022 11:03                4332
class.componere-patch.php                          30-Sep-2022 11:03                7742
class.componere-value.php                          30-Sep-2022 11:03                5196
class.countable.php                                30-Sep-2022 11:03                2503
class.curlfile.php                                 30-Sep-2022 11:03                6515
class.curlhandle.php                               30-Sep-2022 11:03                1770
class.curlmultihandle.php                          30-Sep-2022 11:03                1809
class.curlsharehandle.php                          30-Sep-2022 11:03                1805
class.curlstringfile.php                           30-Sep-2022 11:03                5169
class.dateinterval.php                             30-Sep-2022 11:03               12703
class.dateperiod.php                               30-Sep-2022 11:03               12933
class.datetime.php                                 30-Sep-2022 11:03               20375
class.datetimeimmutable.php                        30-Sep-2022 11:03               20279
class.datetimeinterface.php                        30-Sep-2022 11:03               16594
class.datetimezone.php                             30-Sep-2022 11:03               12858
class.deflatecontext.php                           30-Sep-2022 11:03                1815
class.directory.php                                30-Sep-2022 11:03                5216
class.directoryiterator.php                        30-Sep-2022 11:03               23231
class.divisionbyzeroerror.php                      30-Sep-2022 11:03                6553
class.domainexception.php                          30-Sep-2022 11:03                6657
class.domattr.php                                  30-Sep-2022 11:03               21334
class.domcdatasection.php                          30-Sep-2022 11:03               22870
class.domcharacterdata.php                         30-Sep-2022 11:03               23994
class.domchildnode.php                             30-Sep-2022 11:03                3932
class.domcomment.php                               30-Sep-2022 11:03               21812
class.domdocument.php                              30-Sep-2022 11:03               54193
class.domdocumentfragment.php                      30-Sep-2022 11:03               20913
class.domdocumenttype.php                          30-Sep-2022 11:03               21041
class.domelement.php                               30-Sep-2022 11:03               35874
class.domentity.php                                30-Sep-2022 11:03               21369
class.domentityreference.php                       30-Sep-2022 11:03               17451
class.domexception.php                             30-Sep-2022 11:03                7413
class.domimplementation.php                        30-Sep-2022 11:03                5326
class.domnamednodemap.php                          30-Sep-2022 11:03                6449
class.domnode.php                                  30-Sep-2022 11:03               25142
class.domnodelist.php                              30-Sep-2022 11:03                5290
class.domnotation.php                              30-Sep-2022 11:03               17672
class.domparentnode.php                            30-Sep-2022 11:03                3022
class.domprocessinginstruction.php                 30-Sep-2022 11:03               18782
class.domtext.php                                  30-Sep-2022 11:03               24463
class.domxpath.php                                 30-Sep-2022 11:03                7609
class.dotnet.php                                   30-Sep-2022 11:03                6774
class.ds-collection.php                            30-Sep-2022 11:03                5071
class.ds-deque.php                                 30-Sep-2022 11:03               21357
class.ds-hashable.php                              30-Sep-2022 11:03                4043
class.ds-map.php                                   30-Sep-2022 11:03               22535
class.ds-pair.php                                  30-Sep-2022 11:03                4442
class.ds-priorityqueue.php                         30-Sep-2022 11:03                7888
class.ds-queue.php                                 30-Sep-2022 11:03                7442
class.ds-sequence.php                              30-Sep-2022 11:03               19125
class.ds-set.php                                   30-Sep-2022 11:03               17967
class.ds-stack.php                                 30-Sep-2022 11:03                6882
class.ds-vector.php                                30-Sep-2022 11:03               20924
class.emptyiterator.php                            30-Sep-2022 11:03                3901
class.enchantbroker.php                            30-Sep-2022 11:03                1827
class.enchantdictionary.php                        30-Sep-2022 11:03                1817
class.error.php                                    30-Sep-2022 11:03                9694
class.errorexception.php                           30-Sep-2022 11:03               12869
class.ev.php                                       30-Sep-2022 11:03               37613
class.evcheck.php                                  30-Sep-2022 11:03               10042
class.evchild.php                                  30-Sep-2022 11:03               11482
class.evembed.php                                  30-Sep-2022 11:03                9205
class.event.php                                    30-Sep-2022 11:03               17052
class.eventbase.php                                30-Sep-2022 11:03               13294
class.eventbuffer.php                              30-Sep-2022 11:03               20176
class.eventbufferevent.php                         30-Sep-2022 11:03               33409
class.eventconfig.php                              30-Sep-2022 11:03                6635
class.eventdnsbase.php                             30-Sep-2022 11:03               10143
class.eventhttp.php                                30-Sep-2022 11:03                8466
class.eventhttpconnection.php                      30-Sep-2022 11:03                9438
class.eventhttprequest.php                         30-Sep-2022 11:03               19826
class.eventlistener.php                            30-Sep-2022 11:03               11565
class.eventsslcontext.php                          30-Sep-2022 11:03               16411
class.eventutil.php                                30-Sep-2022 11:03               22302
class.evfork.php                                   30-Sep-2022 11:03                8187
class.evidle.php                                   30-Sep-2022 11:03                9219
class.evio.php                                     30-Sep-2022 11:03               11883
class.evloop.php                                   30-Sep-2022 11:03               29188
class.evperiodic.php                               30-Sep-2022 11:03               13863
class.evprepare.php                                30-Sep-2022 11:03               10190
class.evsignal.php                                 30-Sep-2022 11:03               10906
class.evstat.php                                   30-Sep-2022 11:03               13295
class.evtimer.php                                  30-Sep-2022 11:03               13274
class.evwatcher.php                                30-Sep-2022 11:03                9161
class.exception.php                                30-Sep-2022 11:03                9873
class.fannconnection.php                           30-Sep-2022 11:03                5942
class.ffi-cdata.php                                30-Sep-2022 11:03                5453
class.ffi-ctype.php                                30-Sep-2022 11:03                7824
class.ffi-exception.php                            30-Sep-2022 11:03                6378
class.ffi-parserexception.php                      30-Sep-2022 11:03                6434
class.ffi.php                                      30-Sep-2022 11:03               17721
class.fiber.php                                    30-Sep-2022 11:03                7522
class.fibererror.php                               30-Sep-2022 11:03                7250
class.filesystemiterator.php                       30-Sep-2022 11:03               29865
class.filteriterator.php                           30-Sep-2022 11:03                5694
class.finfo.php                                    30-Sep-2022 11:03                4921
class.gdimage.php                                  30-Sep-2022 11:03                1725
class.gearmanclient.php                            30-Sep-2022 11:03               29642
class.gearmanexception.php                         30-Sep-2022 11:03                6604
class.gearmanjob.php                               30-Sep-2022 11:03                9823
class.gearmantask.php                              30-Sep-2022 11:03                8138
class.gearmanworker.php                            30-Sep-2022 11:03               11320
class.gender.php                                   30-Sep-2022 11:03               32986
class.generator.php                                30-Sep-2022 11:03                6624
class.globiterator.php                             30-Sep-2022 11:03               26020
class.gmagick.php                                  30-Sep-2022 11:03               75767
class.gmagickdraw.php                              30-Sep-2022 11:03               21439
class.gmagickpixel.php                             30-Sep-2022 11:03                5241
class.gmp.php                                      30-Sep-2022 11:03                3242
class.hrtime-performancecounter.php                30-Sep-2022 11:03                3503
class.hrtime-stopwatch.php                         30-Sep-2022 11:03                6251
class.hrtime-unit.php                              30-Sep-2022 11:03                3827
class.imagick.php                                  30-Sep-2022 11:03              239311
class.imagickdraw.php                              30-Sep-2022 11:03               66320
class.imagickpixel.php                             30-Sep-2022 11:03               11186
class.imagickpixeliterator.php                     30-Sep-2022 11:03                8486
class.infiniteiterator.php                         30-Sep-2022 11:03                5211
class.inflatecontext.php                           30-Sep-2022 11:03                1789
class.internaliterator.php                         30-Sep-2022 11:03                4707
class.intlbreakiterator.php                        30-Sep-2022 11:03               25862
class.intlcalendar.php                             30-Sep-2022 11:03               57620
class.intlchar.php                                 30-Sep-2022 11:03              340792
class.intlcodepointbreakiterator.php               30-Sep-2022 11:03               18365
class.intldateformatter.php                        30-Sep-2022 11:03               23238
class.intldatepatterngenerator.php                 30-Sep-2022 11:03                4097
class.intlexception.php                            30-Sep-2022 11:03                6781
class.intlgregoriancalendar.php                    30-Sep-2022 11:03               38837
class.intliterator.php                             30-Sep-2022 11:03                5050
class.intlpartsiterator.php                        30-Sep-2022 11:03                6703
class.intlrulebasedbreakiterator.php               30-Sep-2022 11:03               20840
class.intltimezone.php                             30-Sep-2022 11:03               18937
class.invalidargumentexception.php                 30-Sep-2022 11:03                6680
class.iterator.php                                 30-Sep-2022 11:03               12429
class.iteratoraggregate.php                        30-Sep-2022 11:03                6389
class.iteratoriterator.php                         30-Sep-2022 11:03                6090
class.jsonexception.php                            30-Sep-2022 11:03                6994
class.jsonserializable.php                         30-Sep-2022 11:03                2802
class.ldap-connection.php                          30-Sep-2022 11:03                1812
class.ldap-result-entry.php                        30-Sep-2022 11:03                1827
class.ldap-result.php                              30-Sep-2022 11:03                1804
class.lengthexception.php                          30-Sep-2022 11:03                6606
class.libxmlerror.php                              30-Sep-2022 11:03                5091
class.limititerator.php                            30-Sep-2022 11:03               11620
class.locale.php                                   30-Sep-2022 11:03               20630
class.logicexception.php                           30-Sep-2022 11:03                6666
class.lua.php                                      30-Sep-2022 11:03                7130
class.luaclosure.php                               30-Sep-2022 11:03                2810
class.luasandbox.php                               30-Sep-2022 11:03               12379
class.luasandboxerror.php                          30-Sep-2022 11:03                8638
class.luasandboxerrorerror.php                     30-Sep-2022 11:03                6683
class.luasandboxfatalerror.php                     30-Sep-2022 11:03                6805
class.luasandboxfunction.php                       30-Sep-2022 11:03                3607
class.luasandboxmemoryerror.php                    30-Sep-2022 11:03                7005
class.luasandboxruntimeerror.php                   30-Sep-2022 11:03                6825
class.luasandboxsyntaxerror.php                    30-Sep-2022 11:03                6687
class.luasandboxtimeouterror.php                   30-Sep-2022 11:03                6989
class.memcache.php                                 30-Sep-2022 11:03               14941
class.memcached.php                                30-Sep-2022 11:03               34528
class.messageformatter.php                         30-Sep-2022 11:03               10673
class.mongodb-bson-binary.php                      30-Sep-2022 11:03               13669
class.mongodb-bson-binaryinterface.php             30-Sep-2022 11:03                4448
class.mongodb-bson-dbpointer.php                   30-Sep-2022 11:03                5789
class.mongodb-bson-decimal128.php                  30-Sep-2022 11:03                7452
class.mongodb-bson-decimal128interface.php         30-Sep-2022 11:03                3693
class.mongodb-bson-int64.php                       30-Sep-2022 11:03                6517
class.mongodb-bson-javascript.php                  30-Sep-2022 11:03                8057
class.mongodb-bson-javascriptinterface.php         30-Sep-2022 11:03                4620
class.mongodb-bson-maxkey.php                      30-Sep-2022 11:03                5677
class.mongodb-bson-maxkeyinterface.php             30-Sep-2022 11:03                2135
class.mongodb-bson-minkey.php                      30-Sep-2022 11:03                5668
class.mongodb-bson-minkeyinterface.php             30-Sep-2022 11:03                2116
class.mongodb-bson-objectid.php                    30-Sep-2022 11:03                8781
class.mongodb-bson-objectidinterface.php           30-Sep-2022 11:03                4125
class.mongodb-bson-persistable.php                 30-Sep-2022 11:03                4506
class.mongodb-bson-regex.php                       30-Sep-2022 11:03                7709
class.mongodb-bson-regexinterface.php              30-Sep-2022 11:03                4465
class.mongodb-bson-serializable.php                30-Sep-2022 11:03                3738
class.mongodb-bson-symbol.php                      30-Sep-2022 11:03                5677
class.mongodb-bson-timestamp.php                   30-Sep-2022 11:03                7964
class.mongodb-bson-timestampinterface.php          30-Sep-2022 11:03                4627
class.mongodb-bson-type.php                        30-Sep-2022 11:03                1964
class.mongodb-bson-undefined.php                   30-Sep-2022 11:03                5765
class.mongodb-bson-unserializable.php              30-Sep-2022 11:03                3803
class.mongodb-bson-utcdatetime.php                 30-Sep-2022 11:03                7516
class.mongodb-bson-utcdatetimeinterface.php        30-Sep-2022 11:03                4256
class.mongodb-driver-bulkwrite.php                 30-Sep-2022 11:03               25853
class.mongodb-driver-command.php                   30-Sep-2022 11:03               15921
class.mongodb-driver-cursor.php                    30-Sep-2022 11:03               27465
class.mongodb-driver-cursorid.php                  30-Sep-2022 11:03                5267
class.mongodb-driver-exception-authenticationex..> 30-Sep-2022 11:03                8060
class.mongodb-driver-exception-bulkwriteexcepti..> 30-Sep-2022 11:03                8920
class.mongodb-driver-exception-connectionexcept..> 30-Sep-2022 11:03                8112
class.mongodb-driver-exception-connectiontimeou..> 30-Sep-2022 11:03                8497
class.mongodb-driver-exception-exception.php       30-Sep-2022 11:03                2144
class.mongodb-driver-exception-executiontimeout..> 30-Sep-2022 11:03                9068
class.mongodb-driver-exception-invalidargumente..> 30-Sep-2022 11:03                7266
class.mongodb-driver-exception-logicexception.php  30-Sep-2022 11:03                7150
class.mongodb-driver-exception-runtimeexception..> 30-Sep-2022 11:03               10544
class.mongodb-driver-exception-sslconnectionexc..> 30-Sep-2022 11:03                8421
class.mongodb-driver-exception-unexpectedvaluee..> 30-Sep-2022 11:03                7283
class.mongodb-driver-exception-writeexception.php  30-Sep-2022 11:03               10966
class.mongodb-driver-manager.php                   30-Sep-2022 11:03               19549
class.mongodb-driver-monitoring-commandfailedev..> 30-Sep-2022 11:03                7514
class.mongodb-driver-monitoring-commandstartede..> 30-Sep-2022 11:03                7016
class.mongodb-driver-monitoring-commandsubscrib..> 30-Sep-2022 11:03                6117
class.mongodb-driver-monitoring-commandsucceede..> 30-Sep-2022 11:03                7096
class.mongodb-driver-monitoring-sdamsubscriber.php 30-Sep-2022 11:03               11351
class.mongodb-driver-monitoring-serverchangedev..> 30-Sep-2022 11:03                5470
class.mongodb-driver-monitoring-serverclosedeve..> 30-Sep-2022 11:03                4205
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:03                5439
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:03                4324
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:03                5451
class.mongodb-driver-monitoring-serveropeningev..> 30-Sep-2022 11:03                4225
class.mongodb-driver-monitoring-subscriber.php     30-Sep-2022 11:03                2579
class.mongodb-driver-monitoring-topologychanged..> 30-Sep-2022 11:03                4579
class.mongodb-driver-monitoring-topologyclosede..> 30-Sep-2022 11:03                3282
class.mongodb-driver-monitoring-topologyopening..> 30-Sep-2022 11:03                3296
class.mongodb-driver-query.php                     30-Sep-2022 11:03                3098
class.mongodb-driver-readconcern.php               30-Sep-2022 11:03               15970
class.mongodb-driver-readpreference.php            30-Sep-2022 11:03               18126
class.mongodb-driver-server.php                    30-Sep-2022 11:03               23483
class.mongodb-driver-writeconcern.php              30-Sep-2022 11:03                9051
class.mongodb-driver-writeconcernerror.php         30-Sep-2022 11:03                4042
class.mongodb-driver-writeerror.php                30-Sep-2022 11:03                4346
class.mongodb-driver-writeresult.php               30-Sep-2022 11:03                7815
class.multipleiterator.php                         30-Sep-2022 11:03               10190
class.mysql-xdevapi-baseresult.php                 30-Sep-2022 11:03                2863
class.mysql-xdevapi-client.php                     30-Sep-2022 11:03                3002
class.mysql-xdevapi-collection.php                 30-Sep-2022 11:03                9906
class.mysql-xdevapi-collectionadd.php              30-Sep-2022 11:03                2880
class.mysql-xdevapi-collectionfind.php             30-Sep-2022 11:03                8238
class.mysql-xdevapi-collectionmodify.php           30-Sep-2022 11:03                9395
class.mysql-xdevapi-collectionremove.php           30-Sep-2022 11:03                4978
class.mysql-xdevapi-columnresult.php               30-Sep-2022 11:03                5994
class.mysql-xdevapi-crudoperationbindable.php      30-Sep-2022 11:03                2858
class.mysql-xdevapi-crudoperationlimitable.php     30-Sep-2022 11:03                2864
class.mysql-xdevapi-crudoperationskippable.php     30-Sep-2022 11:03                2875
class.mysql-xdevapi-crudoperationsortable.php      30-Sep-2022 11:03                2849
class.mysql-xdevapi-databaseobject.php             30-Sep-2022 11:03                3361
class.mysql-xdevapi-docresult.php                  30-Sep-2022 11:03                3750
class.mysql-xdevapi-exception.php                  30-Sep-2022 11:03                2146
class.mysql-xdevapi-executable.php                 30-Sep-2022 11:03                2558
class.mysql-xdevapi-executionstatus.php            30-Sep-2022 11:03                4806
class.mysql-xdevapi-expression.php                 30-Sep-2022 11:03                3127
class.mysql-xdevapi-result.php                     30-Sep-2022 11:03                4076
class.mysql-xdevapi-rowresult.php                  30-Sep-2022 11:03                4673
class.mysql-xdevapi-schema.php                     30-Sep-2022 11:03                7133
class.mysql-xdevapi-schemaobject.php               30-Sep-2022 11:03                2743
class.mysql-xdevapi-session.php                    30-Sep-2022 11:03                8472
class.mysql-xdevapi-sqlstatement.php               30-Sep-2022 11:03                6171
class.mysql-xdevapi-sqlstatementresult.php         30-Sep-2022 11:03                6620
class.mysql-xdevapi-statement.php                  30-Sep-2022 11:03                4607
class.mysql-xdevapi-table.php                      30-Sep-2022 11:03                7286
class.mysql-xdevapi-tabledelete.php                30-Sep-2022 11:03                4883
class.mysql-xdevapi-tableinsert.php                30-Sep-2022 11:03                3382
class.mysql-xdevapi-tableselect.php                30-Sep-2022 11:03                7977
class.mysql-xdevapi-tableupdate.php                30-Sep-2022 11:03                5840
class.mysql-xdevapi-warning.php                    30-Sep-2022 11:03                3690
class.mysqli-driver.php                            30-Sep-2022 11:03                7192
class.mysqli-result.php                            30-Sep-2022 11:03               12647
class.mysqli-sql-exception.php                     30-Sep-2022 11:03                4641
class.mysqli-stmt.php                              30-Sep-2022 11:03               17051
class.mysqli-warning.php                           30-Sep-2022 11:03                3803
class.mysqli.php                                   30-Sep-2022 11:03               31933
class.norewinditerator.php                         30-Sep-2022 11:03                7081
class.normalizer.php                               30-Sep-2022 11:03                8197
class.numberformatter.php                          30-Sep-2022 11:03               39349
class.oauth.php                                    30-Sep-2022 11:03               16563
class.oauthexception.php                           30-Sep-2022 11:03                7571
class.oauthprovider.php                            30-Sep-2022 11:03               11456
class.ocicollection.php                            30-Sep-2022 11:03                6168
class.ocilob.php                                   30-Sep-2022 11:03               12439
class.opensslasymmetrickey.php                     30-Sep-2022 11:03                1901
class.opensslcertificate.php                       30-Sep-2022 11:03                1903
class.opensslcertificatesigningrequest.php         30-Sep-2022 11:03                1990
class.outeriterator.php                            30-Sep-2022 11:03                4280
class.outofboundsexception.php                     30-Sep-2022 11:03                6715
class.outofrangeexception.php                      30-Sep-2022 11:03                6717
class.overflowexception.php                        30-Sep-2022 11:03                6636
class.parallel-channel.php                         30-Sep-2022 11:03                7980
class.parallel-events-event-type.php               30-Sep-2022 11:03                3312
class.parallel-events-event.php                    30-Sep-2022 11:03                3287
class.parallel-events-input.php                    30-Sep-2022 11:03                4536
class.parallel-events.php                          30-Sep-2022 11:03                6651
class.parallel-future.php                          30-Sep-2022 11:03                8159
class.parallel-runtime.php                         30-Sep-2022 11:03                6125
class.parallel-sync.php                            30-Sep-2022 11:03                5203
class.parentiterator.php                           30-Sep-2022 11:03                9505
class.parle-errorinfo.php                          30-Sep-2022 11:03                3666
class.parle-lexer.php                              30-Sep-2022 11:03               11728
class.parle-lexerexception.php                     30-Sep-2022 11:03                6818
class.parle-parser.php                             30-Sep-2022 11:03               14667
class.parle-parserexception.php                    30-Sep-2022 11:03                6800
class.parle-rlexer.php                             30-Sep-2022 11:03               13369
class.parle-rparser.php                            30-Sep-2022 11:03               14818
class.parle-stack.php                              30-Sep-2022 11:03                4613
class.parle-token.php                              30-Sep-2022 11:03                4382
class.parseerror.php                               30-Sep-2022 11:03                7063
class.pdo.php                                      30-Sep-2022 11:03                8723
class.pdoexception.php                             30-Sep-2022 11:03                6629
class.pdostatement.php                             30-Sep-2022 11:03               14550
class.pgsql-connection.php                         30-Sep-2022 11:03                1835
class.pgsql-lob.php                                30-Sep-2022 11:03                1777
class.pgsql-result.php                             30-Sep-2022 11:03                1809
class.phar.php                                     30-Sep-2022 11:03               60147
class.phardata.php                                 30-Sep-2022 11:03               44272
class.pharexception.php                            30-Sep-2022 11:03                6610
class.pharfileinfo.php                             30-Sep-2022 11:03               18162
class.php-user-filter.php                          30-Sep-2022 11:03                5971
class.phptoken.php                                 30-Sep-2022 11:03                7677
class.pool.php                                     30-Sep-2022 11:03                7217
class.pspell-config.php                            30-Sep-2022 11:03                1811
class.pspell-dictionary.php                        30-Sep-2022 11:03                1848
class.quickhashinthash.php                         30-Sep-2022 11:03               12886
class.quickhashintset.php                          30-Sep-2022 11:03               11080
class.quickhashintstringhash.php                   30-Sep-2022 11:03               13700
class.quickhashstringinthash.php                   30-Sep-2022 11:03               11815
class.rangeexception.php                           30-Sep-2022 11:03                6845
class.rararchive.php                               30-Sep-2022 11:03                6920
class.rarentry.php                                 30-Sep-2022 11:03               41806
class.rarexception.php                             30-Sep-2022 11:03                7573
class.recursivearrayiterator.php                   30-Sep-2022 11:03               13647
class.recursivecachingiterator.php                 30-Sep-2022 11:03               13183
class.recursivecallbackfilteriterator.php          30-Sep-2022 11:03               14072
class.recursivedirectoryiterator.php               30-Sep-2022 11:03               29032
class.recursivefilteriterator.php                  30-Sep-2022 11:03                8330
class.recursiveiterator.php                        30-Sep-2022 11:03                4760
class.recursiveiteratoriterator.php                30-Sep-2022 11:03               13237
class.recursiveregexiterator.php                   30-Sep-2022 11:03               13205
class.recursivetreeiterator.php                    30-Sep-2022 11:03               22567
class.reflection.php                               30-Sep-2022 11:03                3127
class.reflectionattribute.php                      30-Sep-2022 11:03                4515
class.reflectionclass.php                          30-Sep-2022 11:03               30169
class.reflectionclassconstant.php                  30-Sep-2022 11:03               13301
class.reflectionenum.php                           30-Sep-2022 11:03               25030
class.reflectionenumbackedcase.php                 30-Sep-2022 11:03                6183
class.reflectionenumunitcase.php                   30-Sep-2022 11:03               10412
class.reflectionexception.php                      30-Sep-2022 11:03                6561
class.reflectionextension.php                      30-Sep-2022 11:03                8955
class.reflectionfunction.php                       30-Sep-2022 11:03               17300
class.reflectionfunctionabstract.php               30-Sep-2022 11:03               16640
class.reflectiongenerator.php                      30-Sep-2022 11:03                5084
class.reflectionintersectiontype.php               30-Sep-2022 11:03                3291
class.reflectionmethod.php                         30-Sep-2022 11:03               25659
class.reflectionnamedtype.php                      30-Sep-2022 11:03                3557
class.reflectionobject.php                         30-Sep-2022 11:03               23683
class.reflectionparameter.php                      30-Sep-2022 11:03               13377
class.reflectionproperty.php                       30-Sep-2022 11:03               17146
class.reflectionreference.php                      30-Sep-2022 11:03                3604
class.reflectiontype.php                           30-Sep-2022 11:03                4076
class.reflectionuniontype.php                      30-Sep-2022 11:03                3172
class.reflectionzendextension.php                  30-Sep-2022 11:03                6313
class.reflector.php                                30-Sep-2022 11:03                3862
class.regexiterator.php                            30-Sep-2022 11:03               15388
class.resourcebundle.php                           30-Sep-2022 11:03                9333
class.rrdcreator.php                               30-Sep-2022 11:03                4005
class.rrdgraph.php                                 30-Sep-2022 11:03                3575
class.rrdupdater.php                               30-Sep-2022 11:03                2983
class.runtimeexception.php                         30-Sep-2022 11:03                6623
class.seaslog.php                                  30-Sep-2022 11:03               17899
class.seekableiterator.php                         30-Sep-2022 11:03               12681
class.serializable.php                             30-Sep-2022 11:03                8306
class.sessionhandler.php                           30-Sep-2022 11:03               26588
class.sessionhandlerinterface.php                  30-Sep-2022 11:03               16299
class.shmop.php                                    30-Sep-2022 11:03                1709
class.simplexmlelement.php                         30-Sep-2022 11:03               12745
class.simplexmliterator.php                        30-Sep-2022 11:03               12603
class.snmp.php                                     30-Sep-2022 11:03               23782
class.snmpexception.php                            30-Sep-2022 11:03                7539
class.soapclient.php                               30-Sep-2022 11:03               29635
class.soapfault.php                                30-Sep-2022 11:03               12688
class.soapheader.php                               30-Sep-2022 11:03                5503
class.soapparam.php                                30-Sep-2022 11:03                3681
class.soapserver.php                               30-Sep-2022 11:03                9092
class.soapvar.php                                  30-Sep-2022 11:03                6996
class.socket.php                                   30-Sep-2022 11:03                1765
class.sodiumexception.php                          30-Sep-2022 11:03                6551
class.solrclient.php                               30-Sep-2022 11:03               21097
class.solrclientexception.php                      30-Sep-2022 11:03                8459
class.solrcollapsefunction.php                     30-Sep-2022 11:03               10404
class.solrdismaxquery.php                          30-Sep-2022 11:03               94787
class.solrdocument.php                             30-Sep-2022 11:03               20042
class.solrdocumentfield.php                        30-Sep-2022 11:03                4384
class.solrexception.php                            30-Sep-2022 11:03                8905
class.solrgenericresponse.php                      30-Sep-2022 11:03               10890
class.solrillegalargumentexception.php             30-Sep-2022 11:03                8583
class.solrillegaloperationexception.php            30-Sep-2022 11:03                8621
class.solrinputdocument.php                        30-Sep-2022 11:03               16559
class.solrmissingmandatoryparameterexception.php   30-Sep-2022 11:03                7810
class.solrmodifiableparams.php                     30-Sep-2022 11:03                7903
class.solrobject.php                               30-Sep-2022 11:03                5324
class.solrparams.php                               30-Sep-2022 11:03                8054
class.solrpingresponse.php                         30-Sep-2022 11:03               10053
class.solrquery.php                                30-Sep-2022 11:03              104000
class.solrqueryresponse.php                        30-Sep-2022 11:03               10817
class.solrresponse.php                             30-Sep-2022 11:03               12732
class.solrserverexception.php                      30-Sep-2022 11:03                8465
class.solrupdateresponse.php                       30-Sep-2022 11:03               10861
class.solrutils.php                                30-Sep-2022 11:03                4404
class.spldoublylinkedlist.php                      30-Sep-2022 11:03               16247
class.splfileinfo.php                              30-Sep-2022 11:03               15398
class.splfileobject.php                            30-Sep-2022 11:03               30326
class.splfixedarray.php                            30-Sep-2022 11:03               17129
class.splheap.php                                  30-Sep-2022 11:03                7557
class.splmaxheap.php                               30-Sep-2022 11:03                6969
class.splminheap.php                               30-Sep-2022 11:03                6979
class.splobjectstorage.php                         30-Sep-2022 11:03               20060
class.splobserver.php                              30-Sep-2022 11:03                2773
class.splpriorityqueue.php                         30-Sep-2022 11:03                9363
class.splqueue.php                                 30-Sep-2022 11:03               12247
class.splstack.php                                 30-Sep-2022 11:03               11273
class.splsubject.php                               30-Sep-2022 11:03                3592
class.spltempfileobject.php                        30-Sep-2022 11:03               25340
class.spoofchecker.php                             30-Sep-2022 11:03               13148
class.sqlite3.php                                  30-Sep-2022 11:03               14760
class.sqlite3result.php                            30-Sep-2022 11:03                4919
class.sqlite3stmt.php                              30-Sep-2022 11:03                6704
class.stomp.php                                    30-Sep-2022 11:03               16956
class.stompexception.php                           30-Sep-2022 11:03                5212
class.stompframe.php                               30-Sep-2022 11:03                4023
class.streamwrapper.php                            30-Sep-2022 11:03               16929
class.stringable.php                               30-Sep-2022 11:03                8629
class.svm.php                                      30-Sep-2022 11:03               15519
class.svmmodel.php                                 30-Sep-2022 11:03                6016
class.swoole-async.php                             30-Sep-2022 11:03                7028
class.swoole-atomic.php                            30-Sep-2022 11:03                4373
class.swoole-buffer.php                            30-Sep-2022 11:03                6485
class.swoole-channel.php                           30-Sep-2022 11:03                3690
class.swoole-client.php                            30-Sep-2022 11:03               14213
class.swoole-connection-iterator.php               30-Sep-2022 11:03                7013
class.swoole-coroutine.php                         30-Sep-2022 11:03               20011
class.swoole-event.php                             30-Sep-2022 11:03                6575
class.swoole-exception.php                         30-Sep-2022 11:03                4109
class.swoole-http-client.php                       30-Sep-2022 11:03               12860
class.swoole-http-request.php                      30-Sep-2022 11:03                2831
class.swoole-http-response.php                     30-Sep-2022 11:03                9439
class.swoole-http-server.php                       30-Sep-2022 11:03               21483
class.swoole-lock.php                              30-Sep-2022 11:03                4411
class.swoole-mmap.php                              30-Sep-2022 11:03                2819
class.swoole-mysql-exception.php                   30-Sep-2022 11:03                4150
class.swoole-mysql.php                             30-Sep-2022 11:03                5096
class.swoole-process.php                           30-Sep-2022 11:03               11826
class.swoole-redis-server.php                      30-Sep-2022 11:03               26048
class.swoole-serialize.php                         30-Sep-2022 11:03                3330
class.swoole-server.php                            30-Sep-2022 11:03               24735
class.swoole-table.php                             30-Sep-2022 11:03               10928
class.swoole-timer.php                             30-Sep-2022 11:03                4456
class.swoole-websocket-frame.php                   30-Sep-2022 11:03                1842
class.swoole-websocket-server.php                  30-Sep-2022 11:03                6961
class.syncevent.php                                30-Sep-2022 11:03                4263
class.syncmutex.php                                30-Sep-2022 11:03                3749
class.syncreaderwriter.php                         30-Sep-2022 11:03                4619
class.syncsemaphore.php                            30-Sep-2022 11:03                4075
class.syncsharedmemory.php                         30-Sep-2022 11:03                4918
class.sysvmessagequeue.php                         30-Sep-2022 11:03                1819
class.sysvsemaphore.php                            30-Sep-2022 11:03                1804
class.sysvsharedmemory.php                         30-Sep-2022 11:03                1807
class.thread.php                                   30-Sep-2022 11:03                9998
class.threaded.php                                 30-Sep-2022 11:03                7863
class.throwable.php                                30-Sep-2022 11:03                6628
class.tidy.php                                     30-Sep-2022 11:03               17321
class.tidynode.php                                 30-Sep-2022 11:03               10426
class.transliterator.php                           30-Sep-2022 11:03                8410
class.traversable.php                              30-Sep-2022 11:03                3666
class.typeerror.php                                30-Sep-2022 11:03                7483
class.uconverter.php                               30-Sep-2022 11:03               32255
class.ui-area.php                                  30-Sep-2022 11:03               11068
class.ui-control.php                               30-Sep-2022 11:03                5183
class.ui-controls-box.php                          30-Sep-2022 11:04                9078
class.ui-controls-button.php                       30-Sep-2022 11:04                6202
class.ui-controls-check.php                        30-Sep-2022 11:03                6928
class.ui-controls-colorbutton.php                  30-Sep-2022 11:04                6238
class.ui-controls-combo.php                        30-Sep-2022 11:04                6174
class.ui-controls-editablecombo.php                30-Sep-2022 11:04                6282
class.ui-controls-entry.php                        30-Sep-2022 11:04                8661
class.ui-controls-form.php                         30-Sep-2022 11:04                7280
class.ui-controls-grid.php                         30-Sep-2022 11:04               11239
class.ui-controls-group.php                        30-Sep-2022 11:04                7754
class.ui-controls-label.php                        30-Sep-2022 11:04                5953
class.ui-controls-multilineentry.php               30-Sep-2022 11:04                8944
class.ui-controls-picker.php                       30-Sep-2022 11:04                6829
class.ui-controls-progress.php                     30-Sep-2022 11:04                5518
class.ui-controls-radio.php                        30-Sep-2022 11:04                6153
class.ui-controls-separator.php                    30-Sep-2022 11:04                6447
class.ui-controls-slider.php                       30-Sep-2022 11:04                6485
class.ui-controls-spin.php                         30-Sep-2022 11:04                6355
class.ui-controls-tab.php                          30-Sep-2022 11:03                8205
class.ui-draw-brush-gradient.php                   30-Sep-2022 11:04                6296
class.ui-draw-brush-lineargradient.php             30-Sep-2022 11:04                5658
class.ui-draw-brush-radialgradient.php             30-Sep-2022 11:04                5786
class.ui-draw-brush.php                            30-Sep-2022 11:04                4153
class.ui-draw-color.php                            30-Sep-2022 11:04                7670
class.ui-draw-line-cap.php                         30-Sep-2022 11:04                2385
class.ui-draw-line-join.php                        30-Sep-2022 11:04                2345
class.ui-draw-matrix.php                           30-Sep-2022 11:04                5392
class.ui-draw-path.php                             30-Sep-2022 11:04                9413
class.ui-draw-pen.php                              30-Sep-2022 11:04                7900
class.ui-draw-stroke.php                           30-Sep-2022 11:04                6071
class.ui-draw-text-font-descriptor.php             30-Sep-2022 11:04                5345
class.ui-draw-text-font-italic.php                 30-Sep-2022 11:04                2575
class.ui-draw-text-font-stretch.php                30-Sep-2022 11:04                3974
class.ui-draw-text-font-weight.php                 30-Sep-2022 11:04                3953
class.ui-draw-text-font.php                        30-Sep-2022 11:04                4468
class.ui-draw-text-layout.php                      30-Sep-2022 11:04                4702
class.ui-exception-invalidargumentexception.php    30-Sep-2022 11:04                6836
class.ui-exception-runtimeexception.php            30-Sep-2022 11:04                6759
class.ui-executor.php                              30-Sep-2022 11:03                4803
class.ui-key.php                                   30-Sep-2022 11:04                9117
class.ui-menu.php                                  30-Sep-2022 11:03                5697
class.ui-menuitem.php                              30-Sep-2022 11:03                3529
class.ui-point.php                                 30-Sep-2022 11:03                5777
class.ui-size.php                                  30-Sep-2022 11:03                5879
class.ui-window.php                                30-Sep-2022 11:03               11762
class.underflowexception.php                       30-Sep-2022 11:03                6707
class.unexpectedvalueexception.php                 30-Sep-2022 11:03                6864
class.unhandledmatcherror.php                      30-Sep-2022 11:03                6582
class.unitenum.php                                 30-Sep-2022 11:03                2610
class.v8js.php                                     30-Sep-2022 11:03                7716
class.v8jsexception.php                            30-Sep-2022 11:03               10148
class.valueerror.php                               30-Sep-2022 11:03                6602
class.variant.php                                  30-Sep-2022 11:03                5528
class.varnishadmin.php                             30-Sep-2022 11:03                9857
class.varnishlog.php                               30-Sep-2022 11:03               27982
class.varnishstat.php                              30-Sep-2022 11:03                2780
class.volatile.php                                 30-Sep-2022 11:03               11426
class.vtiful-kernel-excel.php                      30-Sep-2022 11:03               10197
class.vtiful-kernel-format.php                     30-Sep-2022 11:03               13104
class.weakmap.php                                  30-Sep-2022 11:03                9286
class.weakreference.php                            30-Sep-2022 11:03                5320
class.win32serviceexception.php                    30-Sep-2022 11:03                6885
class.wkhtmltox-image-converter.php                30-Sep-2022 11:03                3752
class.wkhtmltox-pdf-converter.php                  30-Sep-2022 11:03                4105
class.wkhtmltox-pdf-object.php                     30-Sep-2022 11:03                2768
class.worker.php                                   30-Sep-2022 11:03                7701
class.xmldiff-base.php                             30-Sep-2022 11:03                4188
class.xmldiff-dom.php                              30-Sep-2022 11:03                5207
class.xmldiff-file.php                             30-Sep-2022 11:03                4823
class.xmldiff-memory.php                           30-Sep-2022 11:03                4855
class.xmlparser.php                                30-Sep-2022 11:03                1793
class.xmlreader.php                                30-Sep-2022 11:03               32154
class.xmlwriter.php                                30-Sep-2022 11:03               25063
class.xsltprocessor.php                            30-Sep-2022 11:03                9425
class.yac.php                                      30-Sep-2022 11:03                8315
class.yaconf.php                                   30-Sep-2022 11:03                3271
class.yaf-action-abstract.php                      30-Sep-2022 11:03               12652
class.yaf-application.php                          30-Sep-2022 11:03               12274
class.yaf-bootstrap-abstract.php                   30-Sep-2022 11:03                6096
class.yaf-config-abstract.php                      30-Sep-2022 11:03                5005
class.yaf-config-ini.php                           30-Sep-2022 11:03               16228
class.yaf-config-simple.php                        30-Sep-2022 11:03               12324
class.yaf-controller-abstract.php                  30-Sep-2022 11:03               18489
class.yaf-dispatcher.php                           30-Sep-2022 11:03               19295
class.yaf-exception-dispatchfailed.php             30-Sep-2022 11:03                2728
class.yaf-exception-loadfailed-action.php          30-Sep-2022 11:03                2799
class.yaf-exception-loadfailed-controller.php      30-Sep-2022 11:03                2824
class.yaf-exception-loadfailed-module.php          30-Sep-2022 11:03                2788
class.yaf-exception-loadfailed-view.php            30-Sep-2022 11:03                2728
class.yaf-exception-loadfailed.php                 30-Sep-2022 11:03                2702
class.yaf-exception-routerfailed.php               30-Sep-2022 11:03                2713
class.yaf-exception-startuperror.php               30-Sep-2022 11:03                2711
class.yaf-exception-typeerror.php                  30-Sep-2022 11:03                2682
class.yaf-exception.php                            30-Sep-2022 11:03                6914
class.yaf-loader.php                               30-Sep-2022 11:03               17240
class.yaf-plugin-abstract.php                      30-Sep-2022 11:03               17969
class.yaf-registry.php                             30-Sep-2022 11:03                5794
class.yaf-request-abstract.php                     30-Sep-2022 11:03               20926
class.yaf-request-http.php                         30-Sep-2022 11:03               18792
class.yaf-request-simple.php                       30-Sep-2022 11:03               18635
class.yaf-response-abstract.php                    30-Sep-2022 11:03               10242
class.yaf-route-interface.php                      30-Sep-2022 11:03                3462
class.yaf-route-map.php                            30-Sep-2022 11:03                4900
class.yaf-route-regex.php                          30-Sep-2022 11:03                7219
class.yaf-route-rewrite.php                        30-Sep-2022 11:03                6555
class.yaf-route-simple.php                         30-Sep-2022 11:03                5953
class.yaf-route-static.php                         30-Sep-2022 11:03                4576
class.yaf-route-supervar.php                       30-Sep-2022 11:03                4333
class.yaf-router.php                               30-Sep-2022 11:03               10886
class.yaf-session.php                              30-Sep-2022 11:03               11424
class.yaf-view-interface.php                       30-Sep-2022 11:03                5384
class.yaf-view-simple.php                          30-Sep-2022 11:03                9895
class.yar-client-exception.php                     30-Sep-2022 11:03                5992
class.yar-client.php                               30-Sep-2022 11:03                5184
class.yar-concurrent-client.php                    30-Sep-2022 11:03                6144
class.yar-server-exception.php                     30-Sep-2022 11:03                6431
class.yar-server.php                               30-Sep-2022 11:03                3267
class.ziparchive.php                               30-Sep-2022 11:03               36508
class.zmq.php                                      30-Sep-2022 11:03               32582
class.zmqcontext.php                               30-Sep-2022 11:03                5026
class.zmqdevice.php                                30-Sep-2022 11:03                6783
class.zmqpoll.php                                  30-Sep-2022 11:03                4651
class.zmqsocket.php                                30-Sep-2022 11:03                9950
class.zookeeper.php                                30-Sep-2022 11:03               46779
class.zookeeperauthenticationexception.php         30-Sep-2022 11:03                6766
class.zookeeperconfig.php                          30-Sep-2022 11:03                5363
class.zookeeperconnectionexception.php             30-Sep-2022 11:03                6761
class.zookeeperexception.php                       30-Sep-2022 11:03                6627
class.zookeepermarshallingexception.php            30-Sep-2022 11:03                6782
class.zookeepernonodeexception.php                 30-Sep-2022 11:03                6749
class.zookeeperoperationtimeoutexception.php       30-Sep-2022 11:03                6792
class.zookeepersessionexception.php                30-Sep-2022 11:03                6703
classobj.configuration.php                         30-Sep-2022 11:03                1183
classobj.constants.php                             30-Sep-2022 11:03                1107
classobj.examples.php                              30-Sep-2022 11:03               14877
classobj.installation.php                          30-Sep-2022 11:03                1162
classobj.requirements.php                          30-Sep-2022 11:03                1120
classobj.resources.php                             30-Sep-2022 11:03                1140
classobj.setup.php                                 30-Sep-2022 11:03                1499
closure.bind.php                                   30-Sep-2022 11:03                7573
closure.bindto.php                                 30-Sep-2022 11:03                8827
closure.call.php                                   30-Sep-2022 11:03                6436
closure.construct.php                              30-Sep-2022 11:03                2338
closure.fromcallable.php                           30-Sep-2022 11:03                3726
cmark.installation.php                             30-Sep-2022 11:03                1905
cmark.requirements.php                             30-Sep-2022 11:03                1227
cmark.setup.php                                    30-Sep-2022 11:03                1340
collator.asort.php                                 30-Sep-2022 11:03                8949
collator.compare.php                               30-Sep-2022 11:03               10406
collator.construct.php                             30-Sep-2022 11:03                5523
collator.create.php                                30-Sep-2022 11:03                5317
collator.getattribute.php                          30-Sep-2022 11:03                5828
collator.geterrorcode.php                          30-Sep-2022 11:03                5114
collator.geterrormessage.php                       30-Sep-2022 11:03                5176
collator.getlocale.php                             30-Sep-2022 11:03                6493
collator.getsortkey.php                            30-Sep-2022 11:03                6466
collator.getstrength.php                           30-Sep-2022 11:03                4763
collator.setattribute.php                          30-Sep-2022 11:03                6381
collator.setstrength.php                           30-Sep-2022 11:03               12740
collator.sort.php                                  30-Sep-2022 11:03                7654
collator.sortwithsortkeys.php                      30-Sep-2022 11:03                6230
collectable.isgarbage.php                          30-Sep-2022 11:03                2622
com.configuration.php                              30-Sep-2022 11:03                7505
com.constants.php                                  30-Sep-2022 11:03                9048
com.construct.php                                  30-Sep-2022 11:03                8026
com.error-handling.php                             30-Sep-2022 11:03                1545
com.examples.arrays.php                            30-Sep-2022 11:03                2051
com.examples.foreach.php                           30-Sep-2022 11:03                2952
com.examples.php                                   30-Sep-2022 11:03                1385
com.installation.php                               30-Sep-2022 11:03                1527
com.requirements.php                               30-Sep-2022 11:03                1187
com.resources.php                                  30-Sep-2022 11:03                1105
com.setup.php                                      30-Sep-2022 11:03                1457
commonmark-cql.construct.php                       30-Sep-2022 11:03                2112
commonmark-cql.invoke.php                          30-Sep-2022 11:03                3726
commonmark-interfaces-ivisitable.accept.php        30-Sep-2022 11:03                3089
commonmark-interfaces-ivisitor.enter.php           30-Sep-2022 11:03                4084
commonmark-interfaces-ivisitor.leave.php           30-Sep-2022 11:03                4086
commonmark-node-bulletlist.construct.php           30-Sep-2022 11:03                2924
commonmark-node-codeblock.construct.php            30-Sep-2022 11:03                2650
commonmark-node-heading.construct.php              30-Sep-2022 11:03                2481
commonmark-node-image.construct.php                30-Sep-2022 11:03                3033
commonmark-node-link.construct.php                 30-Sep-2022 11:03                3030
commonmark-node-orderedlist.construct.php          30-Sep-2022 11:03                3754
commonmark-node-text.construct.php                 30-Sep-2022 11:03                2534
commonmark-node.accept.php                         30-Sep-2022 11:03                2829
commonmark-node.appendchild.php                    30-Sep-2022 11:03                2630
commonmark-node.insertafter.php                    30-Sep-2022 11:03                2655
commonmark-node.insertbefore.php                   30-Sep-2022 11:03                2653
commonmark-node.prependchild.php                   30-Sep-2022 11:03                2657
commonmark-node.replace.php                        30-Sep-2022 11:03                2601
commonmark-node.unlink.php                         30-Sep-2022 11:03                2260
commonmark-parser.construct.php                    30-Sep-2022 11:03                3186
commonmark-parser.finish.php                       30-Sep-2022 11:03                2315
commonmark-parser.parse.php                        30-Sep-2022 11:03                2475
compersisthelper.construct.php                     30-Sep-2022 11:03                3447
compersisthelper.getcurfilename.php                30-Sep-2022 11:03                2988
compersisthelper.getmaxstreamsize.php              30-Sep-2022 11:03                3022
compersisthelper.initnew.php                       30-Sep-2022 11:03                2867
compersisthelper.loadfromfile.php                  30-Sep-2022 11:03                3983
compersisthelper.loadfromstream.php                30-Sep-2022 11:03                3258
compersisthelper.savetofile.php                    30-Sep-2022 11:03                5881
compersisthelper.savetostream.php                  30-Sep-2022 11:03                3285
componere-abstract-definition.addinterface.php     30-Sep-2022 11:03                3230
componere-abstract-definition.addmethod.php        30-Sep-2022 11:03                3997
componere-abstract-definition.addtrait.php         30-Sep-2022 11:03                3182
componere-abstract-definition.getreflector.php     30-Sep-2022 11:03                2349
componere-definition.addconstant.php               30-Sep-2022 11:03                4283
componere-definition.addproperty.php               30-Sep-2022 11:03                3692
componere-definition.construct.php                 30-Sep-2022 11:03                5443
componere-definition.getclosure.php                30-Sep-2022 11:03                3357
componere-definition.getclosures.php               30-Sep-2022 11:03                2610
componere-definition.isregistered.php              30-Sep-2022 11:03                2172
componere-definition.register.php                  30-Sep-2022 11:03                2396
componere-method.construct.php                     30-Sep-2022 11:03                2168
componere-method.getreflector.php                  30-Sep-2022 11:03                2152
componere-method.setprivate.php                    30-Sep-2022 11:03                2413
componere-method.setprotected.php                  30-Sep-2022 11:03                2428
componere-method.setstatic.php                     30-Sep-2022 11:03                2010
componere-patch.apply.php                          30-Sep-2022 11:03                1817
componere-patch.construct.php                      30-Sep-2022 11:03                3406
componere-patch.derive.php                         30-Sep-2022 11:03                3141
componere-patch.getclosure.php                     30-Sep-2022 11:03                2950
componere-patch.getclosures.php                    30-Sep-2022 11:03                2094
componere-patch.isapplied.php                      30-Sep-2022 11:03                1737
componere-patch.revert.php                         30-Sep-2022 11:03                1814
componere-value.construct.php                      30-Sep-2022 11:03                2601
componere-value.hasdefault.php                     30-Sep-2022 11:03                1781
componere-value.isprivate.php                      30-Sep-2022 11:03                1802
componere-value.isprotected.php                    30-Sep-2022 11:03                1812
componere-value.isstatic.php                       30-Sep-2022 11:03                1796
componere-value.setprivate.php                     30-Sep-2022 11:03                2435
componere-value.setprotected.php                   30-Sep-2022 11:03                2449
componere-value.setstatic.php                      30-Sep-2022 11:03                2026
componere.cast.php                                 30-Sep-2022 11:03                4849
componere.cast_by_ref.php                          30-Sep-2022 11:03                5022
componere.installation.php                         30-Sep-2022 11:03                1277
componere.requirements.php                         30-Sep-2022 11:03                1117
componere.setup.php                                30-Sep-2022 11:03                1379
configuration.changes.modes.php                    30-Sep-2022 11:03                3446
configuration.changes.php                          30-Sep-2022 11:03                7719
configuration.file.per-user.php                    30-Sep-2022 11:03                2869
configuration.file.php                             30-Sep-2022 11:03                9489
configuration.php                                  30-Sep-2022 11:03                1555
configure.about.php                                30-Sep-2022 11:04               11552
configure.php                                      30-Sep-2022 11:04                1321
context.curl.php                                   30-Sep-2022 11:03                8510
context.ftp.php                                    30-Sep-2022 11:03                3867
context.http.php                                   30-Sep-2022 11:03               15332
context.params.php                                 30-Sep-2022 11:03                2450
context.phar.php                                   30-Sep-2022 11:03                2818
context.php                                        30-Sep-2022 11:03                2796
context.socket.php                                 30-Sep-2022 11:03                9609
context.ssl.php                                    30-Sep-2022 11:03               11046
context.zip.php                                    30-Sep-2022 11:03                4270
control-structures.alternative-syntax.php          30-Sep-2022 11:03                6951
control-structures.break.php                       30-Sep-2022 11:03                5323
control-structures.continue.php                    30-Sep-2022 11:03                7336
control-structures.declare.php                     30-Sep-2022 11:03                9961
control-structures.do.while.php                    30-Sep-2022 11:03                5080
control-structures.else.php                        30-Sep-2022 11:03                4605
control-structures.elseif.php                      30-Sep-2022 11:03                7596
control-structures.for.php                         30-Sep-2022 11:03               12188
control-structures.foreach.php                     30-Sep-2022 11:03               22369
control-structures.goto.php                        30-Sep-2022 11:03                6892
control-structures.if.php                          30-Sep-2022 11:03                4470
control-structures.intro.php                       30-Sep-2022 11:03                2358
control-structures.match.php                       30-Sep-2022 11:03               19167
control-structures.switch.php                      30-Sep-2022 11:03               19771
control-structures.while.php                       30-Sep-2022 11:03                4241
copyright.php                                      30-Sep-2022 11:03                1835
countable.count.php                                30-Sep-2022 11:03                5377
csprng.configuration.php                           30-Sep-2022 11:03                1169
csprng.constants.php                               30-Sep-2022 11:03                1091
csprng.installation.php                            30-Sep-2022 11:03                1148
csprng.requirements.php                            30-Sep-2022 11:03                1106
csprng.resources.php                               30-Sep-2022 11:03                1126
csprng.setup.php                                   30-Sep-2022 11:03                1471
ctype.configuration.php                            30-Sep-2022 11:03                1162
ctype.constants.php                                30-Sep-2022 11:03                1082
ctype.installation.php                             30-Sep-2022 11:03                1315
ctype.requirements.php                             30-Sep-2022 11:03                1133
ctype.resources.php                                30-Sep-2022 11:03                1119
ctype.setup.php                                    30-Sep-2022 11:03                1466
cubrid.configuration.php                           30-Sep-2022 11:03                1116
cubrid.constants.php                               30-Sep-2022 11:03               13696
cubrid.examples.php                                30-Sep-2022 11:03               21026
cubrid.installation.php                            30-Sep-2022 11:03                1895
cubrid.requirements.php                            30-Sep-2022 11:03                1164
cubrid.resources.php                               30-Sep-2022 11:03                2979
cubrid.setup.php                                   30-Sep-2022 11:03                1479
cubridmysql.cubrid.php                             30-Sep-2022 11:03                4879
curl.configuration.php                             30-Sep-2022 11:03                2244
curl.constants.php                                 30-Sep-2022 11:03              101079
curl.examples-basic.php                            30-Sep-2022 11:03                4513
curl.examples.php                                  30-Sep-2022 11:03                1306
curl.installation.php                              30-Sep-2022 11:03                2527
curl.requirements.php                              30-Sep-2022 11:03                1352
curl.resources.php                                 30-Sep-2022 11:03                1291
curl.setup.php                                     30-Sep-2022 11:03                1476
curlfile.construct.php                             30-Sep-2022 11:03               10200
curlfile.getfilename.php                           30-Sep-2022 11:03                2056
curlfile.getmimetype.php                           30-Sep-2022 11:03                2066
curlfile.getpostfilename.php                       30-Sep-2022 11:03                2106
curlfile.setmimetype.php                           30-Sep-2022 11:03                2303
curlfile.setpostfilename.php                       30-Sep-2022 11:03                2339
curlstringfile.construct.php                       30-Sep-2022 11:03                7052
dateinterval.construct.php                         30-Sep-2022 11:03               12829
dateinterval.createfromdatestring.php              30-Sep-2022 11:03               15035
dateinterval.format.php                            30-Sep-2022 11:03               14559
dateperiod.construct.php                           30-Sep-2022 11:03               18559
dateperiod.getdateinterval.php                     30-Sep-2022 11:03                4575
dateperiod.getenddate.php                          30-Sep-2022 11:03                7509
dateperiod.getrecurrences.php                      30-Sep-2022 11:03                2568
dateperiod.getstartdate.php                        30-Sep-2022 11:03                5001
datetime.add.php                                   30-Sep-2022 11:03                4826
datetime.configuration.php                         30-Sep-2022 11:03                5318
datetime.constants.php                             30-Sep-2022 11:03                2452
datetime.construct.php                             30-Sep-2022 11:03                4897
datetime.createfromformat.php                      30-Sep-2022 11:03                5191
datetime.createfromimmutable.php                   30-Sep-2022 11:03                4244
datetime.createfrominterface.php                   30-Sep-2022 11:03                4861
datetime.diff.php                                  30-Sep-2022 11:03               14645
datetime.examples-arithmetic.php                   30-Sep-2022 11:03               15934
datetime.examples.php                              30-Sep-2022 11:03                1368
datetime.format.php                                30-Sep-2022 11:03               21510
datetime.formats.compound.php                      30-Sep-2022 11:03               12012
datetime.formats.date.php                          30-Sep-2022 11:03               14346
datetime.formats.php                               30-Sep-2022 11:03                7169
datetime.formats.relative.php                      30-Sep-2022 11:03               15984
datetime.formats.time.php                          30-Sep-2022 11:03                7343
datetime.getlasterrors.php                         30-Sep-2022 11:03                3458
datetime.getoffset.php                             30-Sep-2022 11:03                8156
datetime.gettimestamp.php                          30-Sep-2022 11:03                6831
datetime.gettimezone.php                           30-Sep-2022 11:03                7601
datetime.installation.php                          30-Sep-2022 11:03                1499
datetime.modify.php                                30-Sep-2022 11:03               10257
datetime.requirements.php                          30-Sep-2022 11:03                1120
datetime.resources.php                             30-Sep-2022 11:03                1140
datetime.set-state.php                             30-Sep-2022 11:03                2741
datetime.setdate.php                               30-Sep-2022 11:03                5127
datetime.setisodate.php                            30-Sep-2022 11:03                5333
datetime.settime.php                               30-Sep-2022 11:03                6534
datetime.settimestamp.php                          30-Sep-2022 11:03                4416
datetime.settimezone.php                           30-Sep-2022 11:03                9239
datetime.setup.php                                 30-Sep-2022 11:03                1533
datetime.sub.php                                   30-Sep-2022 11:03                4744
datetime.wakeup.php                                30-Sep-2022 11:03                2885
datetimeimmutable.add.php                          30-Sep-2022 11:03               10718
datetimeimmutable.construct.php                    30-Sep-2022 11:03               18145
datetimeimmutable.createfromformat.php             30-Sep-2022 11:03               43642
datetimeimmutable.createfrominterface.php          30-Sep-2022 11:03                5125
datetimeimmutable.createfrommutable.php            30-Sep-2022 11:03                4403
datetimeimmutable.getlasterrors.php                30-Sep-2022 11:03                4868
datetimeimmutable.modify.php                       30-Sep-2022 11:03                8187
datetimeimmutable.set-state.php                    30-Sep-2022 11:03                2660
datetimeimmutable.setdate.php                      30-Sep-2022 11:03                9092
datetimeimmutable.setisodate.php                   30-Sep-2022 11:03               12792
datetimeimmutable.settime.php                      30-Sep-2022 11:03               11932
datetimeimmutable.settimestamp.php                 30-Sep-2022 11:03                5707
datetimeimmutable.settimezone.php                  30-Sep-2022 11:03                5966
datetimeimmutable.sub.php                          30-Sep-2022 11:03               10910
datetimezone.construct.php                         30-Sep-2022 11:03                9683
datetimezone.getlocation.php                       30-Sep-2022 11:03                5545
datetimezone.getname.php                           30-Sep-2022 11:03                3353
datetimezone.getoffset.php                         30-Sep-2022 11:03                7451
datetimezone.gettransitions.php                    30-Sep-2022 11:03               10862
datetimezone.listabbreviations.php                 30-Sep-2022 11:03                5726
datetimezone.listidentifiers.php                   30-Sep-2022 11:03               14018
dba.configuration.php                              30-Sep-2022 11:03                2086
dba.constants.php                                  30-Sep-2022 11:03                1791
dba.example.php                                    30-Sep-2022 11:03                6642
dba.examples.php                                   30-Sep-2022 11:03                1269
dba.installation.php                               30-Sep-2022 11:03                9362
dba.requirements.php                               30-Sep-2022 11:03                7141
dba.resources.php                                  30-Sep-2022 11:03                1393
dba.setup.php                                      30-Sep-2022 11:03                1458
dbase.configuration.php                            30-Sep-2022 11:03                1162
dbase.constants.php                                30-Sep-2022 11:03                2949
dbase.installation.php                             30-Sep-2022 11:03                1457
dbase.requirements.php                             30-Sep-2022 11:03                1099
dbase.resources.php                                30-Sep-2022 11:03                1405
dbase.setup.php                                    30-Sep-2022 11:03                1479
debugger-about.php                                 30-Sep-2022 11:04                1749
debugger.php                                       30-Sep-2022 11:04                1309
dio.configuration.php                              30-Sep-2022 11:03                1148
dio.constants.php                                  30-Sep-2022 11:03                7123
dio.installation.php                               30-Sep-2022 11:03                1829
dio.requirements.php                               30-Sep-2022 11:03                1085
dio.resources.php                                  30-Sep-2022 11:03                1251
dio.setup.php                                      30-Sep-2022 11:03                1459
dir.configuration.php                              30-Sep-2022 11:03                1148
dir.constants.php                                  30-Sep-2022 11:03                2140
dir.installation.php                               30-Sep-2022 11:03                1127
dir.requirements.php                               30-Sep-2022 11:03                1085
dir.resources.php                                  30-Sep-2022 11:03                1105
dir.setup.php                                      30-Sep-2022 11:03                1450
directory.close.php                                30-Sep-2022 11:03                2098
directory.read.php                                 30-Sep-2022 11:03                2173
directory.rewind.php                               30-Sep-2022 11:03                2108
directoryiterator.construct.php                    30-Sep-2022 11:03                5832
directoryiterator.current.php                      30-Sep-2022 11:03                6201
directoryiterator.getatime.php                     30-Sep-2022 11:03                5588
directoryiterator.getbasename.php                  30-Sep-2022 11:03                6638
directoryiterator.getctime.php                     30-Sep-2022 11:03                5675
directoryiterator.getextension.php                 30-Sep-2022 11:03                6016
directoryiterator.getfilename.php                  30-Sep-2022 11:03                5302
directoryiterator.getgroup.php                     30-Sep-2022 11:03                5716
directoryiterator.getinode.php                     30-Sep-2022 11:03                4591
directoryiterator.getmtime.php                     30-Sep-2022 11:03                5596
directoryiterator.getowner.php                     30-Sep-2022 11:03                5132
directoryiterator.getpath.php                      30-Sep-2022 11:03                4702
directoryiterator.getpathname.php                  30-Sep-2022 11:03                5097
directoryiterator.getperms.php                     30-Sep-2022 11:03                6031
directoryiterator.getsize.php                      30-Sep-2022 11:03                4849
directoryiterator.gettype.php                      30-Sep-2022 11:03                5661
directoryiterator.isdir.php                        30-Sep-2022 11:03                5505
directoryiterator.isdot.php                        30-Sep-2022 11:03                5739
directoryiterator.isexecutable.php                 30-Sep-2022 11:03                5390
directoryiterator.isfile.php                       30-Sep-2022 11:03                5660
directoryiterator.islink.php                       30-Sep-2022 11:03                7320
directoryiterator.isreadable.php                   30-Sep-2022 11:03                5242
directoryiterator.iswritable.php                   30-Sep-2022 11:03                5418
directoryiterator.key.php                          30-Sep-2022 11:03                6583
directoryiterator.next.php                         30-Sep-2022 11:03                5432
directoryiterator.rewind.php                       30-Sep-2022 11:03                5372
directoryiterator.seek.php                         30-Sep-2022 11:03                5301
directoryiterator.tostring.php                     30-Sep-2022 11:03                4542
directoryiterator.valid.php                        30-Sep-2022 11:03                5676
doc.changelog.php                                  30-Sep-2022 11:04              166889
dom.configuration.php                              30-Sep-2022 11:03                1148
dom.constants.php                                  30-Sep-2022 11:03               14165
dom.examples.php                                   30-Sep-2022 11:03                2907
dom.installation.php                               30-Sep-2022 11:03                1188
dom.requirements.php                               30-Sep-2022 11:03                1366
dom.resources.php                                  30-Sep-2022 11:03                1105
dom.setup.php                                      30-Sep-2022 11:03                1448
domattr.construct.php                              30-Sep-2022 11:03                5453
domattr.isid.php                                   30-Sep-2022 11:03                4940
domcdatasection.construct.php                      30-Sep-2022 11:03                5126
domcharacterdata.appenddata.php                    30-Sep-2022 11:03                3637
domcharacterdata.deletedata.php                    30-Sep-2022 11:03                4642
domcharacterdata.insertdata.php                    30-Sep-2022 11:03                4362
domcharacterdata.replacedata.php                   30-Sep-2022 11:03                4982
domcharacterdata.substringdata.php                 30-Sep-2022 11:03                4652
domchildnode.after.php                             30-Sep-2022 11:03                3452
domchildnode.before.php                            30-Sep-2022 11:03                3267
domchildnode.remove.php                            30-Sep-2022 11:03                3046
domchildnode.replacewith.php                       30-Sep-2022 11:03                3673
domcomment.construct.php                           30-Sep-2022 11:03                4983
domdocument.construct.php                          30-Sep-2022 11:03                4266
domdocument.createattribute.php                    30-Sep-2022 11:03                5735
domdocument.createattributens.php                  30-Sep-2022 11:03                6580
domdocument.createcdatasection.php                 30-Sep-2022 11:03                5410
domdocument.createcomment.php                      30-Sep-2022 11:03                5807
domdocument.createdocumentfragment.php             30-Sep-2022 11:03                5682
domdocument.createelement.php                      30-Sep-2022 11:03               11256
domdocument.createelementns.php                    30-Sep-2022 11:03               13974
domdocument.createentityreference.php              30-Sep-2022 11:03                6052
domdocument.createprocessinginstruction.php        30-Sep-2022 11:03                6316
domdocument.createtextnode.php                     30-Sep-2022 11:03                5795
domdocument.getelementbyid.php                     30-Sep-2022 11:03                7548
domdocument.getelementsbytagname.php               30-Sep-2022 11:03                6097
domdocument.getelementsbytagnamens.php             30-Sep-2022 11:03                7566
domdocument.importnode.php                         30-Sep-2022 11:03                8908
domdocument.load.php                               30-Sep-2022 11:03                6065
domdocument.loadhtml.php                           30-Sep-2022 11:03                6644
domdocument.loadhtmlfile.php                       30-Sep-2022 11:03                6391
domdocument.loadxml.php                            30-Sep-2022 11:03                6815
domdocument.normalizedocument.php                  30-Sep-2022 11:03                2897
domdocument.registernodeclass.php                  30-Sep-2022 11:03               21036
domdocument.relaxngvalidate.php                    30-Sep-2022 11:03                3795
domdocument.relaxngvalidatesource.php              30-Sep-2022 11:03                3828
domdocument.save.php                               30-Sep-2022 11:03                7521
domdocument.savehtml.php                           30-Sep-2022 11:03                7410
domdocument.savehtmlfile.php                       30-Sep-2022 11:03                7959
domdocument.savexml.php                            30-Sep-2022 11:03                8826
domdocument.schemavalidate.php                     30-Sep-2022 11:03                4127
domdocument.schemavalidatesource.php               30-Sep-2022 11:03                4189
domdocument.validate.php                           30-Sep-2022 11:03                5914
domdocument.xinclude.php                           30-Sep-2022 11:03                7054
domdocumentfragment.appendxml.php                  30-Sep-2022 11:03                5271
domdocumentfragment.construct.php                  30-Sep-2022 11:03                2051
domelement.construct.php                           30-Sep-2022 11:03                6477
domelement.getattribute.php                        30-Sep-2022 11:03                3394
domelement.getattributenode.php                    30-Sep-2022 11:03                3917
domelement.getattributenodens.php                  30-Sep-2022 11:03                4301
domelement.getattributens.php                      30-Sep-2022 11:03                3852
domelement.getelementsbytagname.php                30-Sep-2022 11:03                3533
domelement.getelementsbytagnamens.php              30-Sep-2022 11:03                4246
domelement.hasattribute.php                        30-Sep-2022 11:03                3599
domelement.hasattributens.php                      30-Sep-2022 11:03                3973
domelement.removeattribute.php                     30-Sep-2022 11:03                3746
domelement.removeattributenode.php                 30-Sep-2022 11:03                4181
domelement.removeattributens.php                   30-Sep-2022 11:03                4151
domelement.setattribute.php                        30-Sep-2022 11:03                5943
domelement.setattributenode.php                    30-Sep-2022 11:03                3930
domelement.setattributenodens.php                  30-Sep-2022 11:03                3928
domelement.setattributens.php                      30-Sep-2022 11:03                4817
domelement.setidattribute.php                      30-Sep-2022 11:03                4445
domelement.setidattributenode.php                  30-Sep-2022 11:03                4499
domelement.setidattributens.php                    30-Sep-2022 11:03                4812
domentityreference.construct.php                   30-Sep-2022 11:03                4815
domimplementation.construct.php                    30-Sep-2022 11:03                2080
domimplementation.createdocument.php               30-Sep-2022 11:03                6694
domimplementation.createdocumenttype.php           30-Sep-2022 11:03                9187
domimplementation.hasfeature.php                   30-Sep-2022 11:03                9586
domnamednodemap.count.php                          30-Sep-2022 11:03                2294
domnamednodemap.getnameditem.php                   30-Sep-2022 11:03                3235
domnamednodemap.getnameditemns.php                 30-Sep-2022 11:03                3613
domnamednodemap.item.php                           30-Sep-2022 11:03                2823
domnode.appendchild.php                            30-Sep-2022 11:03                8484
domnode.c14n.php                                   30-Sep-2022 11:03                4239
domnode.c14nfile.php                               30-Sep-2022 11:03                4519
domnode.clonenode.php                              30-Sep-2022 11:03                2592
domnode.getlineno.php                              30-Sep-2022 11:03                4815
domnode.getnodepath.php                            30-Sep-2022 11:03                5093
domnode.hasattributes.php                          30-Sep-2022 11:03                2672
domnode.haschildnodes.php                          30-Sep-2022 11:03                2594
domnode.insertbefore.php                           30-Sep-2022 11:03                4971
domnode.isdefaultnamespace.php                     30-Sep-2022 11:03                2643
domnode.issamenode.php                             30-Sep-2022 11:03                2593
domnode.issupported.php                            30-Sep-2022 11:03                3482
domnode.lookupnamespaceuri.php                     30-Sep-2022 11:03                2919
domnode.lookupprefix.php                           30-Sep-2022 11:03                2895
domnode.normalize.php                              30-Sep-2022 11:03                2723
domnode.removechild.php                            30-Sep-2022 11:03                6827
domnode.replacechild.php                           30-Sep-2022 11:03                5371
domnodelist.count.php                              30-Sep-2022 11:03                2207
domnodelist.item.php                               30-Sep-2022 11:03                6744
domparentnode.append.php                           30-Sep-2022 11:03                2958
domparentnode.prepend.php                          30-Sep-2022 11:03                2991
domprocessinginstruction.construct.php             30-Sep-2022 11:03                6586
domtext.construct.php                              30-Sep-2022 11:03                4781
domtext.iselementcontentwhitespace.php             30-Sep-2022 11:03                2400
domtext.iswhitespaceinelementcontent.php           30-Sep-2022 11:03                2603
domtext.splittext.php                              30-Sep-2022 11:03                3091
domxpath.construct.php                             30-Sep-2022 11:03                2722
domxpath.evaluate.php                              30-Sep-2022 11:03                7365
domxpath.query.php                                 30-Sep-2022 11:03               12178
domxpath.registernamespace.php                     30-Sep-2022 11:03                2964
domxpath.registerphpfunctions.php                  30-Sep-2022 11:03               13920
dotnet.construct.php                               30-Sep-2022 11:03                2845
ds-collection.clear.php                            30-Sep-2022 11:03                3897
ds-collection.copy.php                             30-Sep-2022 11:03                4349
ds-collection.isempty.php                          30-Sep-2022 11:03                4192
ds-collection.toarray.php                          30-Sep-2022 11:03                3964
ds-deque.allocate.php                              30-Sep-2022 11:03                4562
ds-deque.apply.php                                 30-Sep-2022 11:03                5042
ds-deque.capacity.php                              30-Sep-2022 11:03                3864
ds-deque.clear.php                                 30-Sep-2022 11:03                3779
ds-deque.construct.php                             30-Sep-2022 11:03                4330
ds-deque.contains.php                              30-Sep-2022 11:03                7480
ds-deque.copy.php                                  30-Sep-2022 11:03                4176
ds-deque.count.php                                 30-Sep-2022 11:03                1529
ds-deque.filter.php                                30-Sep-2022 11:03                7469
ds-deque.find.php                                  30-Sep-2022 11:03                5448
ds-deque.first.php                                 30-Sep-2022 11:03                3775
ds-deque.get.php                                   30-Sep-2022 11:03                6629
ds-deque.insert.php                                30-Sep-2022 11:03                6979
ds-deque.isempty.php                               30-Sep-2022 11:03                4039
ds-deque.join.php                                  30-Sep-2022 11:03                5708
ds-deque.jsonserialize.php                         30-Sep-2022 11:03                1811
ds-deque.last.php                                  30-Sep-2022 11:03                3763
ds-deque.map.php                                   30-Sep-2022 11:03                5428
ds-deque.merge.php                                 30-Sep-2022 11:03                4859
ds-deque.pop.php                                   30-Sep-2022 11:03                4260
ds-deque.push.php                                  30-Sep-2022 11:03                4675
ds-deque.reduce.php                                30-Sep-2022 11:03                8636
ds-deque.remove.php                                30-Sep-2022 11:03                4843
ds-deque.reverse.php                               30-Sep-2022 11:03                3615
ds-deque.reversed.php                              30-Sep-2022 11:03                3993
ds-deque.rotate.php                                30-Sep-2022 11:03                5052
ds-deque.set.php                                   30-Sep-2022 11:03                6090
ds-deque.shift.php                                 30-Sep-2022 11:03                4361
ds-deque.slice.php                                 30-Sep-2022 11:03                7206
ds-deque.sort.php                                  30-Sep-2022 11:03                7358
ds-deque.sorted.php                                30-Sep-2022 11:03                7420
ds-deque.sum.php                                   30-Sep-2022 11:03                5073
ds-deque.toarray.php                               30-Sep-2022 11:03                3815
ds-deque.unshift.php                               30-Sep-2022 11:03                4757
ds-hashable.equals.php                             30-Sep-2022 11:03                3376
ds-hashable.hash.php                               30-Sep-2022 11:03                8503
ds-map.allocate.php                                30-Sep-2022 11:03                4428
ds-map.apply.php                                   30-Sep-2022 11:03                5814
ds-map.capacity.php                                30-Sep-2022 11:03                3149
ds-map.clear.php                                   30-Sep-2022 11:03                4335
ds-map.construct.php                               30-Sep-2022 11:03                4862
ds-map.copy.php                                    30-Sep-2022 11:03                4106
ds-map.count.php                                   30-Sep-2022 11:03                1490
ds-map.diff.php                                    30-Sep-2022 11:03                5612
ds-map.filter.php                                  30-Sep-2022 11:03                8334
ds-map.first.php                                   30-Sep-2022 11:03                4063
ds-map.get.php                                     30-Sep-2022 11:03                8644
ds-map.haskey.php                                  30-Sep-2022 11:03                4606
ds-map.hasvalue.php                                30-Sep-2022 11:03                4650
ds-map.intersect.php                               30-Sep-2022 11:03                6135
ds-map.isempty.php                                 30-Sep-2022 11:03                4291
ds-map.jsonserialize.php                           30-Sep-2022 11:03                1789
ds-map.keys.php                                    30-Sep-2022 11:03                3943
ds-map.ksort.php                                   30-Sep-2022 11:03                8090
ds-map.ksorted.php                                 30-Sep-2022 11:03                8214
ds-map.last.php                                    30-Sep-2022 11:03                4048
ds-map.map.php                                     30-Sep-2022 11:03                6468
ds-map.merge.php                                   30-Sep-2022 11:03                5770
ds-map.pairs.php                                   30-Sep-2022 11:03                4334
ds-map.put.php                                     30-Sep-2022 11:03               14812
ds-map.putall.php                                  30-Sep-2022 11:03                5408
ds-map.reduce.php                                  30-Sep-2022 11:03                9686
ds-map.remove.php                                  30-Sep-2022 11:03                7088
ds-map.reverse.php                                 30-Sep-2022 11:03                4097
ds-map.reversed.php                                30-Sep-2022 11:03                4233
ds-map.skip.php                                    30-Sep-2022 11:03                4567
ds-map.slice.php                                   30-Sep-2022 11:03                8107
ds-map.sort.php                                    30-Sep-2022 11:03                8008
ds-map.sorted.php                                  30-Sep-2022 11:03                8193
ds-map.sum.php                                     30-Sep-2022 11:03                5600
ds-map.toarray.php                                 30-Sep-2022 11:03                4774
ds-map.union.php                                   30-Sep-2022 11:03                6119
ds-map.values.php                                  30-Sep-2022 11:03                3937
ds-map.xor.php                                     30-Sep-2022 11:03                5674
ds-pair.clear.php                                  30-Sep-2022 11:03                3675
ds-pair.construct.php                              30-Sep-2022 11:03                2621
ds-pair.copy.php                                   30-Sep-2022 11:03                4095
ds-pair.isempty.php                                30-Sep-2022 11:03                3984
ds-pair.jsonserialize.php                          30-Sep-2022 11:03                1809
ds-pair.toarray.php                                30-Sep-2022 11:03                3740
ds-priorityqueue.allocate.php                      30-Sep-2022 11:03                4728
ds-priorityqueue.capacity.php                      30-Sep-2022 11:03                3358
ds-priorityqueue.clear.php                         30-Sep-2022 11:03                4446
ds-priorityqueue.construct.php                     30-Sep-2022 11:03                2915
ds-priorityqueue.copy.php                          30-Sep-2022 11:03                4479
ds-priorityqueue.count.php                         30-Sep-2022 11:03                1638
ds-priorityqueue.isempty.php                       30-Sep-2022 11:03                4959
ds-priorityqueue.jsonserialize.php                 30-Sep-2022 11:03                1929
ds-priorityqueue.peek.php                          30-Sep-2022 11:03                4763
ds-priorityqueue.pop.php                           30-Sep-2022 11:03                5535
ds-priorityqueue.push.php                          30-Sep-2022 11:03                5557
ds-priorityqueue.toarray.php                       30-Sep-2022 11:03                4926
ds-queue.allocate.php                              30-Sep-2022 11:03                4757
ds-queue.capacity.php                              30-Sep-2022 11:03                3870
ds-queue.clear.php                                 30-Sep-2022 11:03                3764
ds-queue.construct.php                             30-Sep-2022 11:03                4328
ds-queue.copy.php                                  30-Sep-2022 11:03                4313
ds-queue.count.php                                 30-Sep-2022 11:03                1526
ds-queue.isempty.php                               30-Sep-2022 11:03                4055
ds-queue.jsonserialize.php                         30-Sep-2022 11:03                1817
ds-queue.peek.php                                  30-Sep-2022 11:03                4347
ds-queue.pop.php                                   30-Sep-2022 11:03                4881
ds-queue.push.php                                  30-Sep-2022 11:03                4710
ds-queue.toarray.php                               30-Sep-2022 11:03                3977
ds-sequence.allocate.php                           30-Sep-2022 11:03                4464
ds-sequence.apply.php                              30-Sep-2022 11:03                5157
ds-sequence.capacity.php                           30-Sep-2022 11:03                4429
ds-sequence.contains.php                           30-Sep-2022 11:03                7607
ds-sequence.filter.php                             30-Sep-2022 11:03                7608
ds-sequence.find.php                               30-Sep-2022 11:03                5560
ds-sequence.first.php                              30-Sep-2022 11:03                3890
ds-sequence.get.php                                30-Sep-2022 11:03                6757
ds-sequence.insert.php                             30-Sep-2022 11:03                7098
ds-sequence.join.php                               30-Sep-2022 11:03                5804
ds-sequence.last.php                               30-Sep-2022 11:03                3857
ds-sequence.map.php                                30-Sep-2022 11:03                5557
ds-sequence.merge.php                              30-Sep-2022 11:03                4985
ds-sequence.pop.php                                30-Sep-2022 11:03                4372
ds-sequence.push.php                               30-Sep-2022 11:03                4797
ds-sequence.reduce.php                             30-Sep-2022 11:03                8755
ds-sequence.remove.php                             30-Sep-2022 11:03                4955
ds-sequence.reverse.php                            30-Sep-2022 11:03                3728
ds-sequence.reversed.php                           30-Sep-2022 11:03                4116
ds-sequence.rotate.php                             30-Sep-2022 11:03                5189
ds-sequence.set.php                                30-Sep-2022 11:03                6214
ds-sequence.shift.php                              30-Sep-2022 11:03                4473
ds-sequence.slice.php                              30-Sep-2022 11:03                7371
ds-sequence.sort.php                               30-Sep-2022 11:03                7485
ds-sequence.sorted.php                             30-Sep-2022 11:03                7547
ds-sequence.sum.php                                30-Sep-2022 11:03                5198
ds-sequence.unshift.php                            30-Sep-2022 11:03                4868
ds-set.add.php                                     30-Sep-2022 11:03               12994
ds-set.allocate.php                                30-Sep-2022 11:03                4441
ds-set.capacity.php                                30-Sep-2022 11:03                3823
ds-set.clear.php                                   30-Sep-2022 11:03                3710
ds-set.construct.php                               30-Sep-2022 11:03                4282
ds-set.contains.php                                30-Sep-2022 11:03                7436
ds-set.copy.php                                    30-Sep-2022 11:03                4252
ds-set.count.php                                   30-Sep-2022 11:03                1490
ds-set.diff.php                                    30-Sep-2022 11:03                4842
ds-set.filter.php                                  30-Sep-2022 11:03                7417
ds-set.first.php                                   30-Sep-2022 11:03                3728
ds-set.get.php                                     30-Sep-2022 11:03                6573
ds-set.intersect.php                               30-Sep-2022 11:03                5073
ds-set.isempty.php                                 30-Sep-2022 11:03                3997
ds-set.join.php                                    30-Sep-2022 11:03                5654
ds-set.jsonserialize.php                           30-Sep-2022 11:03                1783
ds-set.last.php                                    30-Sep-2022 11:03                3729
ds-set.merge.php                                   30-Sep-2022 11:03                4785
ds-set.reduce.php                                  30-Sep-2022 11:03                8582
ds-set.remove.php                                  30-Sep-2022 11:03                5186
ds-set.reverse.php                                 30-Sep-2022 11:03                3563
ds-set.reversed.php                                30-Sep-2022 11:03                3931
ds-set.slice.php                                   30-Sep-2022 11:03                7120
ds-set.sort.php                                    30-Sep-2022 11:03                7294
ds-set.sorted.php                                  30-Sep-2022 11:03                7356
ds-set.sum.php                                     30-Sep-2022 11:03                5013
ds-set.toarray.php                                 30-Sep-2022 11:03                3761
ds-set.union.php                                   30-Sep-2022 11:03                5036
ds-set.xor.php                                     30-Sep-2022 11:03                5008
ds-stack.allocate.php                              30-Sep-2022 11:03                2694
ds-stack.capacity.php                              30-Sep-2022 11:03                2046
ds-stack.clear.php                                 30-Sep-2022 11:03                3760
ds-stack.construct.php                             30-Sep-2022 11:03                4294
ds-stack.copy.php                                  30-Sep-2022 11:03                4313
ds-stack.count.php                                 30-Sep-2022 11:03                1526
ds-stack.isempty.php                               30-Sep-2022 11:03                4055
ds-stack.jsonserialize.php                         30-Sep-2022 11:03                1817
ds-stack.peek.php                                  30-Sep-2022 11:03                4341
ds-stack.pop.php                                   30-Sep-2022 11:03                4875
ds-stack.push.php                                  30-Sep-2022 11:03                4710
ds-stack.toarray.php                               30-Sep-2022 11:03                3802
ds-vector.allocate.php                             30-Sep-2022 11:03                4381
ds-vector.apply.php                                30-Sep-2022 11:03                5068
ds-vector.capacity.php                             30-Sep-2022 11:03                4334
ds-vector.clear.php                                30-Sep-2022 11:03                3791
ds-vector.construct.php                            30-Sep-2022 11:03                4362
ds-vector.contains.php                             30-Sep-2022 11:03                7510
ds-vector.copy.php                                 30-Sep-2022 11:03                4337
ds-vector.count.php                                30-Sep-2022 11:03                1543
ds-vector.filter.php                               30-Sep-2022 11:03                7503
ds-vector.find.php                                 30-Sep-2022 11:03                5473
ds-vector.first.php                                30-Sep-2022 11:03                3801
ds-vector.get.php                                  30-Sep-2022 11:03                6660
ds-vector.insert.php                               30-Sep-2022 11:03                7009
ds-vector.isempty.php                              30-Sep-2022 11:03                4063
ds-vector.join.php                                 30-Sep-2022 11:03                5735
ds-vector.jsonserialize.php                        30-Sep-2022 11:03                1825
ds-vector.last.php                                 30-Sep-2022 11:03                3788
ds-vector.map.php                                  30-Sep-2022 11:03                5460
ds-vector.merge.php                                30-Sep-2022 11:03                4890
ds-vector.pop.php                                  30-Sep-2022 11:03                4285
ds-vector.push.php                                 30-Sep-2022 11:03                4704
ds-vector.reduce.php                               30-Sep-2022 11:03                8664
ds-vector.remove.php                               30-Sep-2022 11:03                4868
ds-vector.reverse.php                              30-Sep-2022 11:03                3641
ds-vector.reversed.php                             30-Sep-2022 11:03                4023
ds-vector.rotate.php                               30-Sep-2022 11:03                5086
ds-vector.set.php                                  30-Sep-2022 11:03                6121
ds-vector.shift.php                                30-Sep-2022 11:03                4386
ds-vector.slice.php                                30-Sep-2022 11:03                7252
ds-vector.sort.php                                 30-Sep-2022 11:03                7390
ds-vector.sorted.php                               30-Sep-2022 11:03                7452
ds-vector.sum.php                                  30-Sep-2022 11:03                5103
ds-vector.toarray.php                              30-Sep-2022 11:03                3840
ds-vector.unshift.php                              30-Sep-2022 11:03                4787
ds.constants.php                                   30-Sep-2022 11:03                1067
ds.examples.php                                    30-Sep-2022 11:03                4840
ds.installation.php                                30-Sep-2022 11:03                2431
ds.requirements.php                                30-Sep-2022 11:03                1118
ds.setup.php                                       30-Sep-2022 11:03                1316
eio.configuration.php                              30-Sep-2022 11:03                1146
eio.constants.php                                  30-Sep-2022 11:03               15985
eio.examples.php                                   30-Sep-2022 11:03               29333
eio.installation.php                               30-Sep-2022 11:03                1591
eio.requirements.php                               30-Sep-2022 11:03                1238
eio.resources.php                                  30-Sep-2022 11:03                1159
eio.setup.php                                      30-Sep-2022 11:03                1460
emptyiterator.current.php                          30-Sep-2022 11:03                2590
emptyiterator.key.php                              30-Sep-2022 11:03                2554
emptyiterator.next.php                             30-Sep-2022 11:03                2255
emptyiterator.rewind.php                           30-Sep-2022 11:03                2277
emptyiterator.valid.php                            30-Sep-2022 11:03                2264
enchant.configuration.php                          30-Sep-2022 11:03                1176
enchant.constants.php                              30-Sep-2022 11:03                2509
enchant.examples.php                               30-Sep-2022 11:03                5831
enchant.installation.php                           30-Sep-2022 11:03                2988
enchant.requirements.php                           30-Sep-2022 11:03                1721
enchant.resources.php                              30-Sep-2022 11:03                1266
enchant.setup.php                                  30-Sep-2022 11:03                1505
error.clone.php                                    30-Sep-2022 11:03                2708
error.construct.php                                30-Sep-2022 11:03                3175
error.getcode.php                                  30-Sep-2022 11:03                3913
error.getfile.php                                  30-Sep-2022 11:03                3621
error.getline.php                                  30-Sep-2022 11:03                3882
error.getmessage.php                               30-Sep-2022 11:03                3732
error.getprevious.php                              30-Sep-2022 11:03                6791
error.gettrace.php                                 30-Sep-2022 11:03                4156
error.gettraceasstring.php                         30-Sep-2022 11:03                4053
error.tostring.php                                 30-Sep-2022 11:03                3764
errorexception.construct.php                       30-Sep-2022 11:03                5304
errorexception.getseverity.php                     30-Sep-2022 11:03                4278
errorfunc.configuration.php                        30-Sep-2022 11:03               21568
errorfunc.constants.php                            30-Sep-2022 11:03                9172
errorfunc.examples.php                             30-Sep-2022 11:03               23530
errorfunc.installation.php                         30-Sep-2022 11:03                1169
errorfunc.requirements.php                         30-Sep-2022 11:03                1127
errorfunc.resources.php                            30-Sep-2022 11:03                1147
errorfunc.setup.php                                30-Sep-2022 11:03                1520
ev.backend.php                                     30-Sep-2022 11:03                3362
ev.configuration.php                               30-Sep-2022 11:03                1141
ev.depth.php                                       30-Sep-2022 11:03                3140
ev.embeddablebackends.php                          30-Sep-2022 11:03                6896
ev.examples.php                                    30-Sep-2022 11:03               47715
ev.feedsignal.php                                  30-Sep-2022 11:03                3246
ev.feedsignalevent.php                             30-Sep-2022 11:03                3033
ev.global.constants.php                            30-Sep-2022 11:03                1225
ev.installation.php                                30-Sep-2022 11:03                1568
ev.iteration.php                                   30-Sep-2022 11:03                2514
ev.now.php                                         30-Sep-2022 11:03                2985
ev.nowupdate.php                                   30-Sep-2022 11:03                3109
ev.periodic-modes.php                              30-Sep-2022 11:03                7865
ev.recommendedbackends.php                         30-Sep-2022 11:03                7638
ev.requirements.php                                30-Sep-2022 11:03                1173
ev.resources.php                                   30-Sep-2022 11:03                1105
ev.resume.php                                      30-Sep-2022 11:03                3699
ev.run.php                                         30-Sep-2022 11:03                4740
ev.setup.php                                       30-Sep-2022 11:03                1415
ev.sleep.php                                       30-Sep-2022 11:03                2296
ev.stop.php                                        30-Sep-2022 11:03                2762
ev.supportedbackends.php                           30-Sep-2022 11:03                6878
ev.suspend.php                                     30-Sep-2022 11:03                3432
ev.time.php                                        30-Sep-2022 11:03                2559
ev.verify.php                                      30-Sep-2022 11:03                2180
ev.watcher-callbacks.php                           30-Sep-2022 11:03                4117
ev.watchers.php                                    30-Sep-2022 11:03                3456
evcheck.construct.php                              30-Sep-2022 11:03                3623
evcheck.createstopped.php                          30-Sep-2022 11:03                3487
evchild.construct.php                              30-Sep-2022 11:03                6407
evchild.createstopped.php                          30-Sep-2022 11:03                4927
evchild.set.php                                    30-Sep-2022 11:03                3027
evembed.construct.php                              30-Sep-2022 11:03                8459
evembed.createstopped.php                          30-Sep-2022 11:03                4657
evembed.set.php                                    30-Sep-2022 11:03                2418
evembed.sweep.php                                  30-Sep-2022 11:03                2980
event.add.php                                      30-Sep-2022 11:03               11013
event.addsignal.php                                30-Sep-2022 11:03                1628
event.addtimer.php                                 30-Sep-2022 11:03                1637
event.callbacks.php                                30-Sep-2022 11:03                5402
event.configuration.php                            30-Sep-2022 11:03                1162
event.construct.php                                30-Sep-2022 11:03                4725
event.constructing.signal.events.php               30-Sep-2022 11:03                6852
event.del.php                                      30-Sep-2022 11:03                2415
event.delsignal.php                                30-Sep-2022 11:03                1628
event.deltimer.php                                 30-Sep-2022 11:03                1625
event.examples.php                                 30-Sep-2022 11:03              198870
event.flags.php                                    30-Sep-2022 11:03                2317
event.free.php                                     30-Sep-2022 11:03                2884
event.getsupportedmethods.php                      30-Sep-2022 11:03                2556
event.installation.php                             30-Sep-2022 11:03                1595
event.pending.php                                  30-Sep-2022 11:03                2642
event.persistence.php                              30-Sep-2022 11:03                2752
event.requirements.php                             30-Sep-2022 11:03                1391
event.resources.php                                30-Sep-2022 11:03                1109
event.set.php                                      30-Sep-2022 11:03                4476
event.setpriority.php                              30-Sep-2022 11:03                2344
event.settimer.php                                 30-Sep-2022 11:03                3988
event.setup.php                                    30-Sep-2022 11:03                1454
event.signal.php                                   30-Sep-2022 11:03                4215
event.timer.php                                    30-Sep-2022 11:03                3550
eventbase.construct.php                            30-Sep-2022 11:03                2770
eventbase.dispatch.php                             30-Sep-2022 11:03                3159
eventbase.exit.php                                 30-Sep-2022 11:03                2852
eventbase.free.php                                 30-Sep-2022 11:03                3235
eventbase.getfeatures.php                          30-Sep-2022 11:03                5945
eventbase.getmethod.php                            30-Sep-2022 11:03                4546
eventbase.gettimeofdaycached.php                   30-Sep-2022 11:03                2601
eventbase.gotexit.php                              30-Sep-2022 11:03                3173
eventbase.gotstop.php                              30-Sep-2022 11:03                3145
eventbase.loop.php                                 30-Sep-2022 11:03                3411
eventbase.priorityinit.php                         30-Sep-2022 11:03                2829
eventbase.reinit.php                               30-Sep-2022 11:03                2190
eventbase.stop.php                                 30-Sep-2022 11:03                2683
eventbuffer.add.php                                30-Sep-2022 11:03                2828
eventbuffer.addbuffer.php                          30-Sep-2022 11:03                3240
eventbuffer.appendfrom.php                         30-Sep-2022 11:03                4840
eventbuffer.construct.php                          30-Sep-2022 11:03                2106
eventbuffer.copyout.php                            30-Sep-2022 11:03                3789
eventbuffer.drain.php                              30-Sep-2022 11:03                3320
eventbuffer.enablelocking.php                      30-Sep-2022 11:03                2818
eventbuffer.expand.php                             30-Sep-2022 11:03                2617
eventbuffer.freeze.php                             30-Sep-2022 11:03                2877
eventbuffer.lock.php                               30-Sep-2022 11:03                2960
eventbuffer.prepend.php                            30-Sep-2022 11:03                3333
eventbuffer.prependbuffer.php                      30-Sep-2022 11:03                3555
eventbuffer.pullup.php                             30-Sep-2022 11:03                4544
eventbuffer.read.php                               30-Sep-2022 11:03                4807
eventbuffer.readfrom.php                           30-Sep-2022 11:03                4296
eventbuffer.readline.php                           30-Sep-2022 11:03                4120
eventbuffer.search.php                             30-Sep-2022 11:03                8547
eventbuffer.searcheol.php                          30-Sep-2022 11:03                4507
eventbuffer.substr.php                             30-Sep-2022 11:03                3282
eventbuffer.unfreeze.php                           30-Sep-2022 11:03                2891
eventbuffer.unlock.php                             30-Sep-2022 11:03                2643
eventbuffer.write.php                              30-Sep-2022 11:03                3349
eventbufferevent.about.callbacks.php               30-Sep-2022 11:03                5612
eventbufferevent.close.php                         30-Sep-2022 11:03                2412
eventbufferevent.connect.php                       30-Sep-2022 11:03               26954
eventbufferevent.connecthost.php                   30-Sep-2022 11:03               18448
eventbufferevent.construct.php                     30-Sep-2022 11:03                6869
eventbufferevent.createpair.php                    30-Sep-2022 11:03                4013
eventbufferevent.disable.php                       30-Sep-2022 11:03                3127
eventbufferevent.enable.php                        30-Sep-2022 11:03                3391
eventbufferevent.free.php                          30-Sep-2022 11:03                2719
eventbufferevent.getdnserrorstring.php             30-Sep-2022 11:03                3024
eventbufferevent.getenabled.php                    30-Sep-2022 11:03                2990
eventbufferevent.getinput.php                      30-Sep-2022 11:03                5157
eventbufferevent.getoutput.php                     30-Sep-2022 11:03                8313
eventbufferevent.read.php                          30-Sep-2022 11:03                2950
eventbufferevent.readbuffer.php                    30-Sep-2022 11:03                3077
eventbufferevent.setcallbacks.php                  30-Sep-2022 11:03                4580
eventbufferevent.setpriority.php                   30-Sep-2022 11:03                2726
eventbufferevent.settimeouts.php                   30-Sep-2022 11:03                2897
eventbufferevent.setwatermark.php                  30-Sep-2022 11:03                3799
eventbufferevent.sslerror.php                      30-Sep-2022 11:03                6299
eventbufferevent.sslfilter.php                     30-Sep-2022 11:03               41003
eventbufferevent.sslgetcipherinfo.php              30-Sep-2022 11:03                2793
eventbufferevent.sslgetciphername.php              30-Sep-2022 11:03                2679
eventbufferevent.sslgetcipherversion.php           30-Sep-2022 11:03                2708
eventbufferevent.sslgetprotocol.php                30-Sep-2022 11:03                2637
eventbufferevent.sslrenegotiate.php                30-Sep-2022 11:03                2754
eventbufferevent.sslsocket.php                     30-Sep-2022 11:03                5488
eventbufferevent.write.php                         30-Sep-2022 11:03                3013
eventbufferevent.writebuffer.php                   30-Sep-2022 11:03                3195
eventconfig.avoidmethod.php                        30-Sep-2022 11:03                4238
eventconfig.construct.php                          30-Sep-2022 11:03                4388
eventconfig.requirefeatures.php                    30-Sep-2022 11:03                5934
eventconfig.setflags.php                           30-Sep-2022 11:03                3074
eventconfig.setmaxdispatchinterval.php             30-Sep-2022 11:03                4084
eventdnsbase.addnameserverip.php                   30-Sep-2022 11:03                2751
eventdnsbase.addsearch.php                         30-Sep-2022 11:03                2448
eventdnsbase.clearsearch.php                       30-Sep-2022 11:03                2749
eventdnsbase.construct.php                         30-Sep-2022 11:03                3205
eventdnsbase.countnameservers.php                  30-Sep-2022 11:03                2444
eventdnsbase.loadhosts.php                         30-Sep-2022 11:03                2624
eventdnsbase.parseresolvconf.php                   30-Sep-2022 11:03                4042
eventdnsbase.setoption.php                         30-Sep-2022 11:03                3142
eventdnsbase.setsearchndots.php                    30-Sep-2022 11:03                2688
eventhttp.accept.php                               30-Sep-2022 11:03               13213
eventhttp.addserveralias.php                       30-Sep-2022 11:03                6444
eventhttp.bind.php                                 30-Sep-2022 11:03                7813
eventhttp.construct.php                            30-Sep-2022 11:03               19891
eventhttp.removeserveralias.php                    30-Sep-2022 11:03                3023
eventhttp.setallowedmethods.php                    30-Sep-2022 11:03                3289
eventhttp.setcallback.php                          30-Sep-2022 11:03               19719
eventhttp.setdefaultcallback.php                   30-Sep-2022 11:03                7810
eventhttp.setmaxbodysize.php                       30-Sep-2022 11:03                2813
eventhttp.setmaxheaderssize.php                    30-Sep-2022 11:03                2725
eventhttp.settimeout.php                           30-Sep-2022 11:03                2403
eventhttpconnection.construct.php                  30-Sep-2022 11:03                5191
eventhttpconnection.getbase.php                    30-Sep-2022 11:03                2525
eventhttpconnection.getpeer.php                    30-Sep-2022 11:03                2863
eventhttpconnection.makerequest.php                30-Sep-2022 11:03               12515
eventhttpconnection.setclosecallback.php           30-Sep-2022 11:03               11781
eventhttpconnection.setlocaladdress.php            30-Sep-2022 11:03                3110
eventhttpconnection.setlocalport.php               30-Sep-2022 11:03                3006
eventhttpconnection.setmaxbodysize.php             30-Sep-2022 11:03                3035
eventhttpconnection.setmaxheaderssize.php          30-Sep-2022 11:03                3056
eventhttpconnection.setretries.php                 30-Sep-2022 11:03                2633
eventhttpconnection.settimeout.php                 30-Sep-2022 11:03                2530
eventhttprequest.addheader.php                     30-Sep-2022 11:03                3635
eventhttprequest.cancel.php                        30-Sep-2022 11:03                2773
eventhttprequest.clearheaders.php                  30-Sep-2022 11:03                2734
eventhttprequest.closeconnection.php               30-Sep-2022 11:03                2328
eventhttprequest.construct.php                     30-Sep-2022 11:03               12688
eventhttprequest.findheader.php                    30-Sep-2022 11:03                3339
eventhttprequest.free.php                          30-Sep-2022 11:03                2236
eventhttprequest.getbufferevent.php                30-Sep-2022 11:03                3645
eventhttprequest.getcommand.php                    30-Sep-2022 11:03                2616
eventhttprequest.getconnection.php                 30-Sep-2022 11:03                4414
eventhttprequest.gethost.php                       30-Sep-2022 11:03                2782
eventhttprequest.getinputbuffer.php                30-Sep-2022 11:03                2729
eventhttprequest.getinputheaders.php               30-Sep-2022 11:03                2762
eventhttprequest.getoutputbuffer.php               30-Sep-2022 11:03                2788
eventhttprequest.getoutputheaders.php              30-Sep-2022 11:03                2746
eventhttprequest.getresponsecode.php               30-Sep-2022 11:03                3079
eventhttprequest.geturi.php                        30-Sep-2022 11:03                2990
eventhttprequest.removeheader.php                  30-Sep-2022 11:03                3350
eventhttprequest.senderror.php                     30-Sep-2022 11:03                5664
eventhttprequest.sendreply.php                     30-Sep-2022 11:03                3911
eventhttprequest.sendreplychunk.php                30-Sep-2022 11:03                3393
eventhttprequest.sendreplyend.php                  30-Sep-2022 11:03                2982
eventhttprequest.sendreplystart.php                30-Sep-2022 11:03                4166
eventlistener.construct.php                        30-Sep-2022 11:03               27630
eventlistener.disable.php                          30-Sep-2022 11:03                2619
eventlistener.enable.php                           30-Sep-2022 11:03                2605
eventlistener.getbase.php                          30-Sep-2022 11:03                2255
eventlistener.getsocketname.php                    30-Sep-2022 11:03                3164
eventlistener.setcallback.php                      30-Sep-2022 11:03                5690
eventlistener.seterrorcallback.php                 30-Sep-2022 11:03                4218
eventsslcontext.construct.php                      30-Sep-2022 11:03                5800
eventutil.construct.php                            30-Sep-2022 11:03                2289
eventutil.getlastsocketerrno.php                   30-Sep-2022 11:03                3212
eventutil.getlastsocketerror.php                   30-Sep-2022 11:03                3077
eventutil.getsocketfd.php                          30-Sep-2022 11:03                3120
eventutil.getsocketname.php                        30-Sep-2022 11:03                3612
eventutil.setsocketoption.php                      30-Sep-2022 11:03                5449
eventutil.sslrandpoll.php                          30-Sep-2022 11:03                2278
evfork.construct.php                               30-Sep-2022 11:03                3598
evfork.createstopped.php                           30-Sep-2022 11:03                3689
evidle.construct.php                               30-Sep-2022 11:03                3653
evidle.createstopped.php                           30-Sep-2022 11:03                4005
evio.construct.php                                 30-Sep-2022 11:03                4701
evio.createstopped.php                             30-Sep-2022 11:03                5071
evio.set.php                                       30-Sep-2022 11:03                2760
evloop.backend.php                                 30-Sep-2022 11:03                2615
evloop.check.php                                   30-Sep-2022 11:03                3091
evloop.child.php                                   30-Sep-2022 11:03                3453
evloop.construct.php                               30-Sep-2022 11:03                3893
evloop.defaultloop.php                             30-Sep-2022 11:03                4484
evloop.embed.php                                   30-Sep-2022 11:03                3556
evloop.fork.php                                    30-Sep-2022 11:03                3285
evloop.idle.php                                    30-Sep-2022 11:03                3305
evloop.invokepending.php                           30-Sep-2022 11:03                2143
evloop.io.php                                      30-Sep-2022 11:03                3724
evloop.loopfork.php                                30-Sep-2022 11:03                2443
evloop.now.php                                     30-Sep-2022 11:03                2729
evloop.nowupdate.php                               30-Sep-2022 11:03                3086
evloop.periodic.php                                30-Sep-2022 11:03                3763
evloop.prepare.php                                 30-Sep-2022 11:03                3303
evloop.resume.php                                  30-Sep-2022 11:03                2746
evloop.run.php                                     30-Sep-2022 11:03                4706
evloop.signal.php                                  30-Sep-2022 11:03                3550
evloop.stat.php                                    30-Sep-2022 11:03                3671
evloop.stop.php                                    30-Sep-2022 11:03                2889
evloop.suspend.php                                 30-Sep-2022 11:03                2738
evloop.timer.php                                   30-Sep-2022 11:03                3690
evloop.verify.php                                  30-Sep-2022 11:03                2513
evperiodic.again.php                               30-Sep-2022 11:03                2486
evperiodic.at.php                                  30-Sep-2022 11:03                2523
evperiodic.construct.php                           30-Sep-2022 11:03               10143
evperiodic.createstopped.php                       30-Sep-2022 11:03                5627
evperiodic.set.php                                 30-Sep-2022 11:03                3018
evprepare.construct.php                            30-Sep-2022 11:03                3378
evprepare.createstopped.php                        30-Sep-2022 11:03                4237
evsignal.construct.php                             30-Sep-2022 11:03                5467
evsignal.createstopped.php                         30-Sep-2022 11:03                4725
evsignal.set.php                                   30-Sep-2022 11:03                2372
evstat.attr.php                                    30-Sep-2022 11:03                8625
evstat.construct.php                               30-Sep-2022 11:03                7395
evstat.createstopped.php                           30-Sep-2022 11:03                5021
evstat.prev.php                                    30-Sep-2022 11:03                2875
evstat.set.php                                     30-Sep-2022 11:03                2693
evstat.stat.php                                    30-Sep-2022 11:03                2795
evtimer.again.php                                  30-Sep-2022 11:03                2981
evtimer.construct.php                              30-Sep-2022 11:03               13470
evtimer.createstopped.php                          30-Sep-2022 11:03                8478
evtimer.set.php                                    30-Sep-2022 11:03                2835
evwatcher.clear.php                                30-Sep-2022 11:03                2712
evwatcher.construct.php                            30-Sep-2022 11:03                2054
evwatcher.feed.php                                 30-Sep-2022 11:03                2485
evwatcher.getloop.php                              30-Sep-2022 11:03                2254
evwatcher.invoke.php                               30-Sep-2022 11:03                2492
evwatcher.keepalive.php                            30-Sep-2022 11:03                5099
evwatcher.setcallback.php                          30-Sep-2022 11:03                2505
evwatcher.start.php                                30-Sep-2022 11:03                2428
evwatcher.stop.php                                 30-Sep-2022 11:03                2397
example.xml-external-entity.php                    30-Sep-2022 11:03               25728
example.xml-map-tags.php                           30-Sep-2022 11:03                9042
example.xml-structure.php                          30-Sep-2022 11:03                6878
example.xmlwriter-namespace.php                    30-Sep-2022 11:03                5444
example.xmlwriter-oop.php                          30-Sep-2022 11:03                3372
example.xmlwriter-simple.php                       30-Sep-2022 11:03                8892
exception.clone.php                                30-Sep-2022 11:03                2772
exception.construct.php                            30-Sep-2022 11:03                3509
exception.getcode.php                              30-Sep-2022 11:03                4320
exception.getfile.php                              30-Sep-2022 11:03                3731
exception.getline.php                              30-Sep-2022 11:03                4033
exception.getmessage.php                           30-Sep-2022 11:03                3853
exception.getprevious.php                          30-Sep-2022 11:03                7034
exception.gettrace.php                             30-Sep-2022 11:03                4271
exception.gettraceasstring.php                     30-Sep-2022 11:03                4151
exception.tostring.php                             30-Sep-2022 11:03                3952
exec.configuration.php                             30-Sep-2022 11:03                1155
exec.constants.php                                 30-Sep-2022 11:03                1088
exec.installation.php                              30-Sep-2022 11:03                1134
exec.requirements.php                              30-Sep-2022 11:03                1092
exec.resources.php                                 30-Sep-2022 11:03                1276
exec.setup.php                                     30-Sep-2022 11:03                1469
exif.configuration.php                             30-Sep-2022 11:03                6373
exif.constants.php                                 30-Sep-2022 11:03                1766
exif.installation.php                              30-Sep-2022 11:03                1597
exif.requirements.php                              30-Sep-2022 11:03                1709
exif.resources.php                                 30-Sep-2022 11:03                1112
exif.setup.php                                     30-Sep-2022 11:03                1476
expect.configuration.php                           30-Sep-2022 11:03                4935
expect.constants.php                               30-Sep-2022 11:03                3135
expect.examples-usage.php                          30-Sep-2022 11:03               17158
expect.examples.php                                30-Sep-2022 11:03                1333
expect.installation.php                            30-Sep-2022 11:03                2181
expect.requirements.php                            30-Sep-2022 11:03                1244
expect.resources.php                               30-Sep-2022 11:03                1343
expect.setup.php                                   30-Sep-2022 11:03                1498
ext-weakmap.construct.php                          30-Sep-2022 11:03                1833
extensions.alphabetical.php                        30-Sep-2022 11:04               20538
extensions.membership.php                          30-Sep-2022 11:04               20222
extensions.php                                     30-Sep-2022 11:04                1570
extensions.state.php                               30-Sep-2022 11:04                2531
fann.configuration.php                             30-Sep-2022 11:03                1155
fann.constants.php                                 30-Sep-2022 11:03               17057
fann.examples-1.php                                30-Sep-2022 11:03                9100
fann.examples.php                                  30-Sep-2022 11:03                1299
fann.installation.php                              30-Sep-2022 11:03                4848
fann.requirements.php                              30-Sep-2022 11:03                1099
fann.resources.php                                 30-Sep-2022 11:03                1080
fann.setup.php                                     30-Sep-2022 11:03                1445
fannconnection.construct.php                       30-Sep-2022 11:03                2752
fannconnection.getfromneuron.php                   30-Sep-2022 11:03                2231
fannconnection.gettoneuron.php                     30-Sep-2022 11:03                2209
fannconnection.getweight.php                       30-Sep-2022 11:03                2181
fannconnection.setweight.php                       30-Sep-2022 11:03                2842
faq.build.php                                      30-Sep-2022 11:04               23087
faq.com.php                                        30-Sep-2022 11:04               10651
faq.databases.php                                  30-Sep-2022 11:04               11333
faq.general.php                                    30-Sep-2022 11:04                4546
faq.html.php                                       30-Sep-2022 11:04               19038
faq.installation.php                               30-Sep-2022 11:04               23897
faq.mailinglist.php                                30-Sep-2022 11:04                9675
faq.misc.php                                       30-Sep-2022 11:04                4006
faq.obtaining.php                                  30-Sep-2022 11:04                9625
faq.passwords.php                                  30-Sep-2022 11:04                9682
faq.php                                            30-Sep-2022 11:04                1928
faq.using.php                                      30-Sep-2022 11:04               22845
fdf.configuration.php                              30-Sep-2022 11:03                1148
fdf.constants.php                                  30-Sep-2022 11:03                6249
fdf.examples.php                                   30-Sep-2022 11:03                6578
fdf.installation.php                               30-Sep-2022 11:03                3161
fdf.requirements.php                               30-Sep-2022 11:03                1436
fdf.resources.php                                  30-Sep-2022 11:03                1640
fdf.setup.php                                      30-Sep-2022 11:03                1453
features.commandline.differences.php               30-Sep-2022 11:03               11070
features.commandline.ini.php                       30-Sep-2022 11:03                2075
features.commandline.interactive.php               30-Sep-2022 11:03                8149
features.commandline.introduction.php              30-Sep-2022 11:03                6194
features.commandline.io-streams.php                30-Sep-2022 11:03                5697
features.commandline.options.php                   30-Sep-2022 11:03               24271
features.commandline.php                           30-Sep-2022 11:03                2001
features.commandline.usage.php                     30-Sep-2022 11:03               13409
features.commandline.webserver.php                 30-Sep-2022 11:03               10007
features.connection-handling.php                   30-Sep-2022 11:03                4459
features.cookies.php                               30-Sep-2022 11:03                2778
features.dtrace.dtrace.php                         30-Sep-2022 11:03               13612
features.dtrace.introduction.php                   30-Sep-2022 11:03                3086
features.dtrace.php                                30-Sep-2022 11:03                1569
features.dtrace.systemtap.php                      30-Sep-2022 11:03                7943
features.file-upload.common-pitfalls.php           30-Sep-2022 11:03                4651
features.file-upload.errors.php                    30-Sep-2022 11:03                3508
features.file-upload.errors.seealso.php            30-Sep-2022 11:03                1296
features.file-upload.multiple.php                  30-Sep-2022 11:03                4365
features.file-upload.php                           30-Sep-2022 11:03                1764
features.file-upload.post-method.php               30-Sep-2022 11:03               15306
features.file-upload.put-method.php                30-Sep-2022 11:03                5749
features.gc.collecting-cycles.php                  30-Sep-2022 11:03                7142
features.gc.performance-considerations.php         30-Sep-2022 11:03               12995
features.gc.php                                    30-Sep-2022 11:03                1659
features.gc.refcounting-basics.php                 30-Sep-2022 11:03               19966
features.http-auth.php                             30-Sep-2022 11:03               23992
features.persistent-connections.php                30-Sep-2022 11:03                7997
features.php                                       30-Sep-2022 11:03                3887
features.remote-files.php                          30-Sep-2022 11:03                9137
features.session.security.management.php           30-Sep-2022 11:03               24359
features.sessions.php                              30-Sep-2022 11:03                1312
features.xforms.php                                30-Sep-2022 11:03                4772
ffi-ctype.getalignment.php                         30-Sep-2022 11:03                2190
ffi-ctype.getarrayelementtype.php                  30-Sep-2022 11:03                2334
ffi-ctype.getarraylength.php                       30-Sep-2022 11:03                2233
ffi-ctype.getattributes.php                        30-Sep-2022 11:03                2209
ffi-ctype.getenumkind.php                          30-Sep-2022 11:03                2185
ffi-ctype.getfuncabi.php                           30-Sep-2022 11:03                2193
ffi-ctype.getfuncparametercount.php                30-Sep-2022 11:03                2299
ffi-ctype.getfuncparametertype.php                 30-Sep-2022 11:03                2557
ffi-ctype.getfuncreturntype.php                    30-Sep-2022 11:03                2316
ffi-ctype.getkind.php                              30-Sep-2022 11:03                2147
ffi-ctype.getname.php                              30-Sep-2022 11:03                2151
ffi-ctype.getpointertype.php                       30-Sep-2022 11:03                2260
ffi-ctype.getsize.php                              30-Sep-2022 11:03                2165
ffi-ctype.getstructfieldnames.php                  30-Sep-2022 11:03                2275
ffi-ctype.getstructfieldoffset.php                 30-Sep-2022 11:03                2493
ffi-ctype.getstructfieldtype.php                   30-Sep-2022 11:03                2513
ffi.addr.php                                       30-Sep-2022 11:03                2735
ffi.alignof.php                                    30-Sep-2022 11:03                2807
ffi.arraytype.php                                  30-Sep-2022 11:03                4426
ffi.cast.php                                       30-Sep-2022 11:03                4872
ffi.cdef.php                                       30-Sep-2022 11:03                4106
ffi.configuration.php                              30-Sep-2022 11:03                3936
ffi.constants.php                                  30-Sep-2022 11:03                1065
ffi.examples-basic.php                             30-Sep-2022 11:03               17113
ffi.examples-callback.php                          30-Sep-2022 11:03                5039
ffi.examples-complete.php                          30-Sep-2022 11:03                5819
ffi.examples.php                                   30-Sep-2022 11:03                1444
ffi.free.php                                       30-Sep-2022 11:03                2344
ffi.installation.php                               30-Sep-2022 11:03                1347
ffi.isnull.php                                     30-Sep-2022 11:03                2336
ffi.load.php                                       30-Sep-2022 11:03                4124
ffi.memcmp.php                                     30-Sep-2022 11:03                3726
ffi.memcpy.php                                     30-Sep-2022 11:03                3086
ffi.memset.php                                     30-Sep-2022 11:03                2928
ffi.new.php                                        30-Sep-2022 11:03                5257
ffi.requirements.php                               30-Sep-2022 11:03                1195
ffi.resources.php                                  30-Sep-2022 11:03                1105
ffi.scope.php                                      30-Sep-2022 11:03                3036
ffi.setup.php                                      30-Sep-2022 11:03                1443
ffi.sizeof.php                                     30-Sep-2022 11:03                2648
ffi.string.php                                     30-Sep-2022 11:03                3615
ffi.type.php                                       30-Sep-2022 11:03                3500
ffi.typeof.php                                     30-Sep-2022 11:03                2799
fiber.construct.php                                30-Sep-2022 11:03                2277
fiber.getcurrent.php                               30-Sep-2022 11:03                2328
fiber.getreturn.php                                30-Sep-2022 11:03                2520
fiber.isrunning.php                                30-Sep-2022 11:03                2479
fiber.isstarted.php                                30-Sep-2022 11:03                2085
fiber.issuspended.php                              30-Sep-2022 11:03                2102
fiber.isterminated.php                             30-Sep-2022 11:03                2155
fiber.resume.php                                   30-Sep-2022 11:03                3210
fiber.start.php                                    30-Sep-2022 11:03                2920
fiber.suspend.php                                  30-Sep-2022 11:03                3960
fiber.throw.php                                    30-Sep-2022 11:03                3088
fibererror.construct.php                           30-Sep-2022 11:03                2091
fileinfo.configuration.php                         30-Sep-2022 11:03                1183
fileinfo.constants.php                             30-Sep-2022 11:03                4710
fileinfo.installation.php                          30-Sep-2022 11:03                2403
fileinfo.requirements.php                          30-Sep-2022 11:03                1193
fileinfo.resources.php                             30-Sep-2022 11:03                1305
fileinfo.setup.php                                 30-Sep-2022 11:03                1520
filesystem.configuration.php                       30-Sep-2022 11:03                6558
filesystem.constants.php                           30-Sep-2022 11:03                8600
filesystem.installation.php                        30-Sep-2022 11:03                1176
filesystem.requirements.php                        30-Sep-2022 11:03                1134
filesystem.resources.php                           30-Sep-2022 11:03                1297
filesystem.setup.php                               30-Sep-2022 11:03                1548
filesystemiterator.construct.php                   30-Sep-2022 11:03                6916
filesystemiterator.current.php                     30-Sep-2022 11:03                5296
filesystemiterator.getflags.php                    30-Sep-2022 11:03                3099
filesystemiterator.key.php                         30-Sep-2022 11:03                5188
filesystemiterator.next.php                        30-Sep-2022 11:03                4458
filesystemiterator.rewind.php                      30-Sep-2022 11:03                5077
filesystemiterator.setflags.php                    30-Sep-2022 11:03                6645
filter.configuration.php                           30-Sep-2022 11:03                4716
filter.constants.php                               30-Sep-2022 11:03               15374
filter.examples.php                                30-Sep-2022 11:03                1394
filter.examples.sanitization.php                   30-Sep-2022 11:03                6041
filter.examples.validation.php                     30-Sep-2022 11:03               11074
filter.filters.flags.php                           30-Sep-2022 11:03               12162
filter.filters.misc.php                            30-Sep-2022 11:03                1827
filter.filters.php                                 30-Sep-2022 11:03                1553
filter.filters.sanitize.php                        30-Sep-2022 11:03               10294
filter.filters.validate.php                        30-Sep-2022 11:03               10802
filter.installation.php                            30-Sep-2022 11:03                1225
filter.requirements.php                            30-Sep-2022 11:03                1106
filter.resources.php                               30-Sep-2022 11:03                1125
filter.setup.php                                   30-Sep-2022 11:03                1482
filteriterator.accept.php                          30-Sep-2022 11:03                5416
filteriterator.construct.php                       30-Sep-2022 11:03                3007
filteriterator.current.php                         30-Sep-2022 11:03                2954
filteriterator.getinneriterator.php                30-Sep-2022 11:03                2411
filteriterator.key.php                             30-Sep-2022 11:03                2886
filteriterator.next.php                            30-Sep-2022 11:03                2812
filteriterator.rewind.php                          30-Sep-2022 11:03                3005
filteriterator.valid.php                           30-Sep-2022 11:03                2368
filters.compression.php                            30-Sep-2022 11:04               15797
filters.convert.php                                30-Sep-2022 11:04               11650
filters.encryption.php                             30-Sep-2022 11:04               46146
filters.php                                        30-Sep-2022 11:04                3017
filters.string.php                                 30-Sep-2022 11:04               10312
finfo.buffer.php                                   30-Sep-2022 11:03                2432
finfo.construct.php                                30-Sep-2022 11:03                2749
finfo.file.php                                     30-Sep-2022 11:03                2423
finfo.set-flags.php                                30-Sep-2022 11:03                1930
fpm.observability.php                              30-Sep-2022 11:03                1326
fpm.setup.php                                      30-Sep-2022 11:03                1198
fpm.status.php                                     30-Sep-2022 11:03                9920
ftp.configuration.php                              30-Sep-2022 11:03                1148
ftp.constants.php                                  30-Sep-2022 11:03                3892
ftp.examples-basic.php                             30-Sep-2022 11:03                5191
ftp.examples.php                                   30-Sep-2022 11:03                1285
ftp.installation.php                               30-Sep-2022 11:03                1515
ftp.requirements.php                               30-Sep-2022 11:03                1085
ftp.resources.php                                  30-Sep-2022 11:03                1373
ftp.setup.php                                      30-Sep-2022 11:03                1455
funchand.configuration.php                         30-Sep-2022 11:03                1183
funchand.constants.php                             30-Sep-2022 11:03                1117
funchand.installation.php                          30-Sep-2022 11:03                1162
funchand.requirements.php                          30-Sep-2022 11:03                1120
funchand.resources.php                             30-Sep-2022 11:03                1140
funchand.setup.php                                 30-Sep-2022 11:03                1501
funcref.php                                        30-Sep-2022 11:04               13489
function.abs.php                                   30-Sep-2022 11:03                4645
function.acos.php                                  30-Sep-2022 11:03                3298
function.acosh.php                                 30-Sep-2022 11:03                3578
function.addcslashes.php                           30-Sep-2022 11:03                7890
function.addslashes.php                            30-Sep-2022 11:03                6772
function.apache-child-terminate.php                30-Sep-2022 11:03                3216
function.apache-get-modules.php                    30-Sep-2022 11:03                3222
function.apache-get-version.php                    30-Sep-2022 11:03                3695
function.apache-getenv.php                         30-Sep-2022 11:03                4731
function.apache-lookup-uri.php                     30-Sep-2022 11:03                5745
function.apache-note.php                           30-Sep-2022 11:03                6781
function.apache-request-headers.php                30-Sep-2022 11:03                5471
function.apache-response-headers.php               30-Sep-2022 11:03                4161
function.apache-setenv.php                         30-Sep-2022 11:03                5221
function.apcu-add.php                              30-Sep-2022 11:03                8012
function.apcu-cache-info.php                       30-Sep-2022 11:03                6304
function.apcu-cas.php                              30-Sep-2022 11:03                8802
function.apcu-clear-cache.php                      30-Sep-2022 11:03                2422
function.apcu-dec.php                              30-Sep-2022 11:03                7946
function.apcu-delete.php                           30-Sep-2022 11:03                5894
function.apcu-enabled.php                          30-Sep-2022 11:03                2165
function.apcu-entry.php                            30-Sep-2022 11:03                8738
function.apcu-exists.php                           30-Sep-2022 11:03                6948
function.apcu-fetch.php                            30-Sep-2022 11:03                5615
function.apcu-inc.php                              30-Sep-2022 11:03                7930
function.apcu-key-info.php                         30-Sep-2022 11:03                4702
function.apcu-sma-info.php                         30-Sep-2022 11:03                4240
function.apcu-store.php                            30-Sep-2022 11:03                6884
function.array-change-key-case.php                 30-Sep-2022 11:03                5530
function.array-chunk.php                           30-Sep-2022 11:03                7332
function.array-column.php                          30-Sep-2022 11:03               17386
function.array-combine.php                         30-Sep-2022 11:03                6846
function.array-count-values.php                    30-Sep-2022 11:03                5464
function.array-diff-assoc.php                      30-Sep-2022 11:03               10677
function.array-diff-key.php                        30-Sep-2022 11:03               12463
function.array-diff-uassoc.php                     30-Sep-2022 11:03               11159
function.array-diff-ukey.php                       30-Sep-2022 11:03               11472
function.array-diff.php                            30-Sep-2022 11:03               12140
function.array-fill-keys.php                       30-Sep-2022 11:03                5194
function.array-fill.php                            30-Sep-2022 11:03                8674
function.array-filter.php                          30-Sep-2022 11:03               16724
function.array-flip.php                            30-Sep-2022 11:03                6861
function.array-intersect-assoc.php                 30-Sep-2022 11:03                8494
function.array-intersect-key.php                   30-Sep-2022 11:03                9720
function.array-intersect-uassoc.php                30-Sep-2022 11:03                8137
function.array-intersect-ukey.php                  30-Sep-2022 11:03               11223
function.array-intersect.php                       30-Sep-2022 11:03                6705
function.array-is-list.php                         30-Sep-2022 11:03                6871
function.array-key-exists.php                      30-Sep-2022 11:03                8448
function.array-key-first.php                       30-Sep-2022 11:03                7037
function.array-key-last.php                        30-Sep-2022 11:03                3086
function.array-keys.php                            30-Sep-2022 11:03                8291
function.array-map.php                             30-Sep-2022 11:03               27670
function.array-merge-recursive.php                 30-Sep-2022 11:03                6705
function.array-merge.php                           30-Sep-2022 11:03               12381
function.array-multisort.php                       30-Sep-2022 11:03               22928
function.array-pad.php                             30-Sep-2022 11:03                6976
function.array-pop.php                             30-Sep-2022 11:03                5563
function.array-product.php                         30-Sep-2022 11:03                4268
function.array-push.php                            30-Sep-2022 11:03                7156
function.array-rand.php                            30-Sep-2022 11:03                6402
function.array-reduce.php                          30-Sep-2022 11:03               10087
function.array-replace-recursive.php               30-Sep-2022 11:03               11130
function.array-replace.php                         30-Sep-2022 11:03                6612
function.array-reverse.php                         30-Sep-2022 11:03                5931
function.array-search.php                          30-Sep-2022 11:03                7983
function.array-shift.php                           30-Sep-2022 11:03                5629
function.array-slice.php                           30-Sep-2022 11:03               13555
function.array-splice.php                          30-Sep-2022 11:03               17522
function.array-sum.php                             30-Sep-2022 11:03                4978
function.array-udiff-assoc.php                     30-Sep-2022 11:03               14052
function.array-udiff-uassoc.php                    30-Sep-2022 11:03               15709
function.array-udiff.php                           30-Sep-2022 11:03               28586
function.array-uintersect-assoc.php                30-Sep-2022 11:03                7807
function.array-uintersect-uassoc.php               30-Sep-2022 11:03                8069
function.array-uintersect.php                      30-Sep-2022 11:03                7725
function.array-unique.php                          30-Sep-2022 11:03                9114
function.array-unshift.php                         30-Sep-2022 11:03                6015
function.array-values.php                          30-Sep-2022 11:03                4458
function.array-walk-recursive.php                  30-Sep-2022 11:03                7279
function.array-walk.php                            30-Sep-2022 11:03               13542
function.array.php                                 30-Sep-2022 11:03               11657
function.arsort.php                                30-Sep-2022 11:03                7833
function.asin.php                                  30-Sep-2022 11:03                3302
function.asinh.php                                 30-Sep-2022 11:03                3567
function.asort.php                                 30-Sep-2022 11:03                7809
function.assert-options.php                        30-Sep-2022 11:03                7896
function.assert.php                                30-Sep-2022 11:03               23862
function.atan.php                                  30-Sep-2022 11:03                3301
function.atan2.php                                 30-Sep-2022 11:03                3190
function.atanh.php                                 30-Sep-2022 11:03                3595
function.autoload.php                              30-Sep-2022 11:03                3009
function.base-convert.php                          30-Sep-2022 11:03                5323
function.base64-decode.php                         30-Sep-2022 11:03                4990
function.base64-encode.php                         30-Sep-2022 11:03                4616
function.basename.php                              30-Sep-2022 11:03                7220
function.bcadd.php                                 30-Sep-2022 11:03                5537
function.bccomp.php                                30-Sep-2022 11:03                5442
function.bcdiv.php                                 30-Sep-2022 11:03                4993
function.bcmod.php                                 30-Sep-2022 11:03                7182
function.bcmul.php                                 30-Sep-2022 11:03                6929
function.bcpow.php                                 30-Sep-2022 11:03                6876
function.bcpowmod.php                              30-Sep-2022 11:03                6925
function.bcscale.php                               30-Sep-2022 11:03                5228
function.bcsqrt.php                                30-Sep-2022 11:03                4604
function.bcsub.php                                 30-Sep-2022 11:03                5510
function.bin2hex.php                               30-Sep-2022 11:03                2931
function.bind-textdomain-codeset.php               30-Sep-2022 11:03                4192
function.bindec.php                                30-Sep-2022 11:03               14879
function.bindtextdomain.php                        30-Sep-2022 11:03                5144
function.boolval.php                               30-Sep-2022 11:03               10519
function.bzclose.php                               30-Sep-2022 11:03                2783
function.bzcompress.php                            30-Sep-2022 11:03                4816
function.bzdecompress.php                          30-Sep-2022 11:03                6069
function.bzerrno.php                               30-Sep-2022 11:03                2953
function.bzerror.php                               30-Sep-2022 11:03                4183
function.bzerrstr.php                              30-Sep-2022 11:03                2968
function.bzflush.php                               30-Sep-2022 11:03                3096
function.bzopen.php                                30-Sep-2022 11:03                4870
function.bzread.php                                30-Sep-2022 11:03                6344
function.bzwrite.php                               30-Sep-2022 11:03                5968
function.cal-days-in-month.php                     30-Sep-2022 11:03                4253
function.cal-from-jd.php                           30-Sep-2022 11:03                6460
function.cal-info.php                              30-Sep-2022 11:03                6088
function.cal-to-jd.php                             30-Sep-2022 11:03                5245
function.call-user-func-array.php                  30-Sep-2022 11:03               14097
function.call-user-func.php                        30-Sep-2022 11:03               14866
function.ceil.php                                  30-Sep-2022 11:03                4362
function.chdir.php                                 30-Sep-2022 11:03                5186
function.checkdate.php                             30-Sep-2022 11:03                5151
function.checkdnsrr.php                            30-Sep-2022 11:03                5531
function.chgrp.php                                 30-Sep-2022 11:03                6409
function.chmod.php                                 30-Sep-2022 11:03                8320
function.chop.php                                  30-Sep-2022 11:03                1988
function.chown.php                                 30-Sep-2022 11:03                6450
function.chr.php                                   30-Sep-2022 11:03                8598
function.chroot.php                                30-Sep-2022 11:03                4172
function.chunk-split.php                           30-Sep-2022 11:03                5013
function.class-alias.php                           30-Sep-2022 11:03                7098
function.class-exists.php                          30-Sep-2022 11:03                6939
function.class-implements.php                      30-Sep-2022 11:03                6981
function.class-parents.php                         30-Sep-2022 11:03                6670
function.class-uses.php                            30-Sep-2022 11:03                5953
function.clearstatcache.php                        30-Sep-2022 11:03               10449
function.cli-get-process-title.php                 30-Sep-2022 11:03                4244
function.cli-set-process-title.php                 30-Sep-2022 11:03                5627
function.closedir.php                              30-Sep-2022 11:03                4720
function.closelog.php                              30-Sep-2022 11:03                2585
function.com-create-guid.php                       30-Sep-2022 11:03                2672
function.com-event-sink.php                        30-Sep-2022 11:03               10407
function.com-get-active-object.php                 30-Sep-2022 11:03                5380
function.com-load-typelib.php                      30-Sep-2022 11:03                4778
function.com-message-pump.php                      30-Sep-2022 11:03                3753
function.com-print-typeinfo.php                    30-Sep-2022 11:03                4620
function.commonmark-parse.php                      30-Sep-2022 11:03                3494
function.commonmark-render-html.php                30-Sep-2022 11:03                3883
function.commonmark-render-latex.php               30-Sep-2022 11:03                4159
function.commonmark-render-man.php                 30-Sep-2022 11:03                4141
function.commonmark-render-xml.php                 30-Sep-2022 11:03                3840
function.commonmark-render.php                     30-Sep-2022 11:03                4087
function.compact.php                               30-Sep-2022 11:03                7401
function.connection-aborted.php                    30-Sep-2022 11:03                2688
function.connection-status.php                     30-Sep-2022 11:03                2762
function.constant.php                              30-Sep-2022 11:03                7461
function.convert-cyr-string.php                    30-Sep-2022 11:03                3949
function.convert-uudecode.php                      30-Sep-2022 11:03                3737
function.convert-uuencode.php                      30-Sep-2022 11:03                4211
function.copy.php                                  30-Sep-2022 11:03                5632
function.cos.php                                   30-Sep-2022 11:03                3841
function.cosh.php                                  30-Sep-2022 11:03                2990
function.count-chars.php                           30-Sep-2022 11:03                6685
function.count.php                                 30-Sep-2022 11:03               15923
function.crc32.php                                 30-Sep-2022 11:03                6688
function.create-function.php                       30-Sep-2022 11:03               18049
function.crypt.php                                 30-Sep-2022 11:03               17667
function.ctype-alnum.php                           30-Sep-2022 11:03                5870
function.ctype-alpha.php                           30-Sep-2022 11:03                6270
function.ctype-cntrl.php                           30-Sep-2022 11:03                5911
function.ctype-digit.php                           30-Sep-2022 11:03                9335
function.ctype-graph.php                           30-Sep-2022 11:03                6588
function.ctype-lower.php                           30-Sep-2022 11:03                6049
function.ctype-print.php                           30-Sep-2022 11:03                6672
function.ctype-punct.php                           30-Sep-2022 11:03                5947
function.ctype-space.php                           30-Sep-2022 11:03                6640
function.ctype-upper.php                           30-Sep-2022 11:03                6001
function.ctype-xdigit.php                          30-Sep-2022 11:03                5798
function.cubrid-affected-rows.php                  30-Sep-2022 11:03                9256
function.cubrid-bind.php                           30-Sep-2022 11:03               21396
function.cubrid-client-encoding.php                30-Sep-2022 11:03                5110
function.cubrid-close-prepare.php                  30-Sep-2022 11:03                6647
function.cubrid-close-request.php                  30-Sep-2022 11:03                6658
function.cubrid-close.php                          30-Sep-2022 11:03                6473
function.cubrid-col-get.php                        30-Sep-2022 11:03                8438
function.cubrid-col-size.php                       30-Sep-2022 11:03                8537
function.cubrid-column-names.php                   30-Sep-2022 11:03                8592
function.cubrid-column-types.php                   30-Sep-2022 11:03                8572
function.cubrid-commit.php                         30-Sep-2022 11:03               16132
function.cubrid-connect-with-url.php               30-Sep-2022 11:03               15497
function.cubrid-connect.php                        30-Sep-2022 11:03               12082
function.cubrid-current-oid.php                    30-Sep-2022 11:03                5833
function.cubrid-data-seek.php                      30-Sep-2022 11:03                7201
function.cubrid-db-name.php                        30-Sep-2022 11:03                6347
function.cubrid-disconnect.php                     30-Sep-2022 11:03                7424
function.cubrid-drop.php                           30-Sep-2022 11:03               11499
function.cubrid-errno.php                          30-Sep-2022 11:03                6893
function.cubrid-error-code-facility.php            30-Sep-2022 11:03                5900
function.cubrid-error-code.php                     30-Sep-2022 11:03                5835
function.cubrid-error-msg.php                      30-Sep-2022 11:03                5233
function.cubrid-error.php                          30-Sep-2022 11:03                6451
function.cubrid-execute.php                        30-Sep-2022 11:03               14230
function.cubrid-fetch-array.php                    30-Sep-2022 11:03                9887
function.cubrid-fetch-assoc.php                    30-Sep-2022 11:03                9097
function.cubrid-fetch-field.php                    30-Sep-2022 11:03               14146
function.cubrid-fetch-lengths.php                  30-Sep-2022 11:03                5976
function.cubrid-fetch-object.php                   30-Sep-2022 11:03               12216
function.cubrid-fetch-row.php                      30-Sep-2022 11:03                8981
function.cubrid-fetch.php                          30-Sep-2022 11:03               10163
function.cubrid-field-flags.php                    30-Sep-2022 11:03                7641
function.cubrid-field-len.php                      30-Sep-2022 11:03                8222
function.cubrid-field-name.php                     30-Sep-2022 11:03                7056
function.cubrid-field-seek.php                     30-Sep-2022 11:03               10796
function.cubrid-field-table.php                    30-Sep-2022 11:03                7279
function.cubrid-field-type.php                     30-Sep-2022 11:03                7341
function.cubrid-free-result.php                    30-Sep-2022 11:03                5621
function.cubrid-get-autocommit.php                 30-Sep-2022 11:03                3510
function.cubrid-get-charset.php                    30-Sep-2022 11:03                4835
function.cubrid-get-class-name.php                 30-Sep-2022 11:03                6134
function.cubrid-get-client-info.php                30-Sep-2022 11:03                8209
function.cubrid-get-db-parameter.php               30-Sep-2022 11:03               14328
function.cubrid-get-query-timeout.php              30-Sep-2022 11:03                6568
function.cubrid-get-server-info.php                30-Sep-2022 11:03                8441
function.cubrid-get.php                            30-Sep-2022 11:03                9982
function.cubrid-insert-id.php                      30-Sep-2022 11:03                7049
function.cubrid-is-instance.php                    30-Sep-2022 11:03                7299
function.cubrid-list-dbs.php                       30-Sep-2022 11:03                4324
function.cubrid-load-from-glo.php                  30-Sep-2022 11:03                6742
function.cubrid-lob-close.php                      30-Sep-2022 11:03                7214
function.cubrid-lob-export.php                     30-Sep-2022 11:03                7671
function.cubrid-lob-get.php                        30-Sep-2022 11:03                7586
function.cubrid-lob-send.php                       30-Sep-2022 11:03                6877
function.cubrid-lob-size.php                       30-Sep-2022 11:03                5719
function.cubrid-lob2-bind.php                      30-Sep-2022 11:03                9622
function.cubrid-lob2-close.php                     30-Sep-2022 11:03                3148
function.cubrid-lob2-export.php                    30-Sep-2022 11:03                8639
function.cubrid-lob2-import.php                    30-Sep-2022 11:03                8503
function.cubrid-lob2-new.php                       30-Sep-2022 11:03                3662
function.cubrid-lob2-read.php                      30-Sep-2022 11:03               14372
function.cubrid-lob2-seek.php                      30-Sep-2022 11:03               11193
function.cubrid-lob2-seek64.php                    30-Sep-2022 11:03               12733
function.cubrid-lob2-size.php                      30-Sep-2022 11:03                4195
function.cubrid-lob2-size64.php                    30-Sep-2022 11:03                4373
function.cubrid-lob2-tell.php                      30-Sep-2022 11:03                4214
function.cubrid-lob2-tell64.php                    30-Sep-2022 11:03                4410
function.cubrid-lob2-write.php                     30-Sep-2022 11:03               14289
function.cubrid-lock-read.php                      30-Sep-2022 11:03                9085
function.cubrid-lock-write.php                     30-Sep-2022 11:03                9503
function.cubrid-move-cursor.php                    30-Sep-2022 11:03                9230
function.cubrid-new-glo.php                        30-Sep-2022 11:03                6903
function.cubrid-next-result.php                    30-Sep-2022 11:03               17165
function.cubrid-num-cols.php                       30-Sep-2022 11:03                5855
function.cubrid-num-fields.php                     30-Sep-2022 11:03                5541
function.cubrid-num-rows.php                       30-Sep-2022 11:03                7054
function.cubrid-pconnect-with-url.php              30-Sep-2022 11:03               14936
function.cubrid-pconnect.php                       30-Sep-2022 11:03               11970
function.cubrid-ping.php                           30-Sep-2022 11:03                6216
function.cubrid-prepare.php                        30-Sep-2022 11:03               10268
function.cubrid-put.php                            30-Sep-2022 11:03               11395
function.cubrid-query.php                          30-Sep-2022 11:03               15200
function.cubrid-real-escape-string.php             30-Sep-2022 11:03                8066
function.cubrid-result.php                         30-Sep-2022 11:03                7266
function.cubrid-rollback.php                       30-Sep-2022 11:03               15412
function.cubrid-save-to-glo.php                    30-Sep-2022 11:03                6661
function.cubrid-schema.php                         30-Sep-2022 11:03               20170
function.cubrid-send-glo.php                       30-Sep-2022 11:03                6094
function.cubrid-seq-drop.php                       30-Sep-2022 11:03                9604
function.cubrid-seq-insert.php                     30-Sep-2022 11:03               10059
function.cubrid-seq-put.php                        30-Sep-2022 11:03                9986
function.cubrid-set-add.php                        30-Sep-2022 11:03                9359
function.cubrid-set-autocommit.php                 30-Sep-2022 11:03                3901
function.cubrid-set-db-parameter.php               30-Sep-2022 11:03                7886
function.cubrid-set-drop.php                       30-Sep-2022 11:03                9336
function.cubrid-set-query-timeout.php              30-Sep-2022 11:03                3245
function.cubrid-unbuffered-query.php               30-Sep-2022 11:03                7075
function.cubrid-version.php                        30-Sep-2022 11:03                8817
function.curl-close.php                            30-Sep-2022 11:03                4993
function.curl-copy-handle.php                      30-Sep-2022 11:03                4970
function.curl-errno.php                            30-Sep-2022 11:03                5247
function.curl-error.php                            30-Sep-2022 11:03                5207
function.curl-escape.php                           30-Sep-2022 11:03                6598
function.curl-exec.php                             30-Sep-2022 11:03                6148
function.curl-getinfo.php                          30-Sep-2022 11:03               12790
function.curl-init.php                             30-Sep-2022 11:03                5856
function.curl-multi-add-handle.php                 30-Sep-2022 11:03                8683
function.curl-multi-close.php                      30-Sep-2022 11:03                7962
function.curl-multi-errno.php                      30-Sep-2022 11:03                2857
function.curl-multi-exec.php                       30-Sep-2022 11:03               10401
function.curl-multi-getcontent.php                 30-Sep-2022 11:03                3143
function.curl-multi-info-read.php                  30-Sep-2022 11:03               11393
function.curl-multi-init.php                       30-Sep-2022 11:03                7891
function.curl-multi-remove-handle.php              30-Sep-2022 11:03                4032
function.curl-multi-select.php                     30-Sep-2022 11:03                3277
function.curl-multi-setopt.php                     30-Sep-2022 11:03                4635
function.curl-multi-strerror.php                   30-Sep-2022 11:03                6888
function.curl-pause.php                            30-Sep-2022 11:03                2767
function.curl-reset.php                            30-Sep-2022 11:03                5617
function.curl-setopt-array.php                     30-Sep-2022 11:03                9027
function.curl-setopt.php                           30-Sep-2022 11:03               90582
function.curl-share-close.php                      30-Sep-2022 11:03                7274
function.curl-share-errno.php                      30-Sep-2022 11:03                2914
function.curl-share-init.php                       30-Sep-2022 11:03                6915
function.curl-share-setopt.php                     30-Sep-2022 11:03                9348
function.curl-share-strerror.php                   30-Sep-2022 11:03                3065
function.curl-strerror.php                         30-Sep-2022 11:03                5964
function.curl-unescape.php                         30-Sep-2022 11:03                7029
function.curl-version.php                          30-Sep-2022 11:03                6470
function.curl_upkeep.php                           30-Sep-2022 11:03                6787
function.current.php                               30-Sep-2022 11:03               10237
function.date-add.php                              30-Sep-2022 11:03                1680
function.date-create-from-format.php               30-Sep-2022 11:03                1855
function.date-create-immutable-from-format.php     30-Sep-2022 11:03                1967
function.date-create-immutable.php                 30-Sep-2022 11:03                1859
function.date-create.php                           30-Sep-2022 11:03                4140
function.date-date-set.php                         30-Sep-2022 11:03                1739
function.date-default-timezone-get.php             30-Sep-2022 11:03                6814
function.date-default-timezone-set.php             30-Sep-2022 11:03                5361
function.date-diff.php                             30-Sep-2022 11:03                1699
function.date-format.php                           30-Sep-2022 11:03                1707
function.date-get-last-errors.php                  30-Sep-2022 11:03                1836
function.date-interval-create-from-date-string.php 30-Sep-2022 11:03                1983
function.date-interval-format.php                  30-Sep-2022 11:03                1834
function.date-isodate-set.php                      30-Sep-2022 11:03                1762
function.date-modify.php                           30-Sep-2022 11:03                1711
function.date-offset-get.php                       30-Sep-2022 11:03                1755
function.date-parse-from-format.php                30-Sep-2022 11:03               13143
function.date-parse.php                            30-Sep-2022 11:03               18232
function.date-sub.php                              30-Sep-2022 11:03                2297
function.date-sun-info.php                         30-Sep-2022 11:03               16088
function.date-sunrise.php                          30-Sep-2022 11:03               12912
function.date-sunset.php                           30-Sep-2022 11:03               12926
function.date-time-set.php                         30-Sep-2022 11:03                1725
function.date-timestamp-get.php                    30-Sep-2022 11:03                1784
function.date-timestamp-set.php                    30-Sep-2022 11:03                1792
function.date-timezone-get.php                     30-Sep-2022 11:03                1781
function.date-timezone-set.php                     30-Sep-2022 11:03                1753
function.date.php                                  30-Sep-2022 11:03               22161
function.db2-autocommit.php                        30-Sep-2022 11:03               10878
function.db2-bind-param.php                        30-Sep-2022 11:03               22637
function.db2-client-info.php                       30-Sep-2022 11:03               12106
function.db2-close.php                             30-Sep-2022 11:03                5460
function.db2-column-privileges.php                 30-Sep-2022 11:03                7900
function.db2-columns.php                           30-Sep-2022 11:03                9796
function.db2-commit.php                            30-Sep-2022 11:03                3470
function.db2-conn-error.php                        30-Sep-2022 11:03                6609
function.db2-conn-errormsg.php                     30-Sep-2022 11:03                6381
function.db2-connect.php                           30-Sep-2022 11:03               40470
function.db2-cursor-type.php                       30-Sep-2022 11:03                3032
function.db2-escape-string.php                     30-Sep-2022 11:03                7930
function.db2-exec.php                              30-Sep-2022 11:03               28679
function.db2-execute.php                           30-Sep-2022 11:03               27590
function.db2-fetch-array.php                       30-Sep-2022 11:03               11339
function.db2-fetch-assoc.php                       30-Sep-2022 11:03               11355
function.db2-fetch-both.php                        30-Sep-2022 11:03               11888
function.db2-fetch-object.php                      30-Sep-2022 11:03                8980
function.db2-fetch-row.php                         30-Sep-2022 11:03               16635
function.db2-field-display-size.php                30-Sep-2022 11:03                4785
function.db2-field-name.php                        30-Sep-2022 11:03                4671
function.db2-field-num.php                         30-Sep-2022 11:03                4681
function.db2-field-precision.php                   30-Sep-2022 11:03                4713
function.db2-field-scale.php                       30-Sep-2022 11:03                4675
function.db2-field-type.php                        30-Sep-2022 11:03                4676
function.db2-field-width.php                       30-Sep-2022 11:03                4883
function.db2-foreign-keys.php                      30-Sep-2022 11:03                8517
function.db2-free-result.php                       30-Sep-2022 11:03                3113
function.db2-free-stmt.php                         30-Sep-2022 11:03                3101
function.db2-get-option.php                        30-Sep-2022 11:03               24898
function.db2-last-insert-id.php                    30-Sep-2022 11:03                8533
function.db2-lob-read.php                          30-Sep-2022 11:03               17702
function.db2-next-result.php                       30-Sep-2022 11:03                8939
function.db2-num-fields.php                        30-Sep-2022 11:03                7119
function.db2-num-rows.php                          30-Sep-2022 11:03                4225
function.db2-pclose.php                            30-Sep-2022 11:03                5650
function.db2-pconnect.php                          30-Sep-2022 11:03               32451
function.db2-prepare.php                           30-Sep-2022 11:03               10552
function.db2-primary-keys.php                      30-Sep-2022 11:03                7151
function.db2-procedure-columns.php                 30-Sep-2022 11:03               11206
function.db2-procedures.php                        30-Sep-2022 11:03                7589
function.db2-result.php                            30-Sep-2022 11:03                7847
function.db2-rollback.php                          30-Sep-2022 11:03                9762
function.db2-server-info.php                       30-Sep-2022 11:03               24236
function.db2-set-option.php                        30-Sep-2022 11:03               70445
function.db2-special-columns.php                   30-Sep-2022 11:03                9736
function.db2-statistics.php                        30-Sep-2022 11:03               11872
function.db2-stmt-error.php                        30-Sep-2022 11:03                4290
function.db2-stmt-errormsg.php                     30-Sep-2022 11:03                3921
function.db2-table-privileges.php                  30-Sep-2022 11:03                7680
function.db2-tables.php                            30-Sep-2022 11:03                7710
function.dba-close.php                             30-Sep-2022 11:03                3059
function.dba-delete.php                            30-Sep-2022 11:03                3790
function.dba-exists.php                            30-Sep-2022 11:03                3822
function.dba-fetch.php                             30-Sep-2022 11:03                5194
function.dba-firstkey.php                          30-Sep-2022 11:03                3435
function.dba-handlers.php                          30-Sep-2022 11:03                5337
function.dba-insert.php                            30-Sep-2022 11:03                4372
function.dba-key-split.php                         30-Sep-2022 11:03                3555
function.dba-list.php                              30-Sep-2022 11:03                2103
function.dba-nextkey.php                           30-Sep-2022 11:03                3357
function.dba-open.php                              30-Sep-2022 11:03               11271
function.dba-optimize.php                          30-Sep-2022 11:03                2943
function.dba-popen.php                             30-Sep-2022 11:03                6272
function.dba-replace.php                           30-Sep-2022 11:03                4200
function.dba-sync.php                              30-Sep-2022 11:03                2963
function.dbase-add-record.php                      30-Sep-2022 11:03                6731
function.dbase-close.php                           30-Sep-2022 11:03                4965
function.dbase-create.php                          30-Sep-2022 11:03                7932
function.dbase-delete-record.php                   30-Sep-2022 11:03                4557
function.dbase-get-header-info.php                 30-Sep-2022 11:03                6815
function.dbase-get-record-with-names.php           30-Sep-2022 11:03                8635
function.dbase-get-record.php                      30-Sep-2022 11:03                5247
function.dbase-numfields.php                       30-Sep-2022 11:03                5713
function.dbase-numrecords.php                      30-Sep-2022 11:03                7021
function.dbase-open.php                            30-Sep-2022 11:03                6141
function.dbase-pack.php                            30-Sep-2022 11:03                6142
function.dbase-replace-record.php                  30-Sep-2022 11:03                9288
function.dcgettext.php                             30-Sep-2022 11:03                3185
function.dcngettext.php                            30-Sep-2022 11:03                3727
function.debug-backtrace.php                       30-Sep-2022 11:03                8990
function.debug-print-backtrace.php                 30-Sep-2022 11:03                6329
function.debug-zval-dump.php                       30-Sep-2022 11:03                9721
function.decbin.php                                30-Sep-2022 11:03                8747
function.dechex.php                                30-Sep-2022 11:03                6980
function.decoct.php                                30-Sep-2022 11:03                4447
function.define.php                                30-Sep-2022 11:03               10470
function.defined.php                               30-Sep-2022 11:03                5028
function.deflate-add.php                           30-Sep-2022 11:03                5027
function.deflate-init.php                          30-Sep-2022 11:03                7086
function.deg2rad.php                               30-Sep-2022 11:03                3844
function.delete.php                                30-Sep-2022 11:03                2375
function.dgettext.php                              30-Sep-2022 11:03                2991
function.die.php                                   30-Sep-2022 11:03                1554
function.dio-close.php                             30-Sep-2022 11:03                3863
function.dio-fcntl.php                             30-Sep-2022 11:03                8838
function.dio-open.php                              30-Sep-2022 11:03                7450
function.dio-read.php                              30-Sep-2022 11:03                3292
function.dio-seek.php                              30-Sep-2022 11:03                7354
function.dio-stat.php                              30-Sep-2022 11:03                4056
function.dio-tcsetattr.php                         30-Sep-2022 11:03                6887
function.dio-truncate.php                          30-Sep-2022 11:03                3400
function.dio-write.php                             30-Sep-2022 11:03                3557
function.dir.php                                   30-Sep-2022 11:03                6693
function.dirname.php                               30-Sep-2022 11:03                9339
function.disk-free-space.php                       30-Sep-2022 11:03                5149
function.disk-total-space.php                      30-Sep-2022 11:03                5249
function.diskfreespace.php                         30-Sep-2022 11:03                1725
function.dl.php                                    30-Sep-2022 11:03                9066
function.dngettext.php                             30-Sep-2022 11:03                3545
function.dns-check-record.php                      30-Sep-2022 11:03                1697
function.dns-get-mx.php                            30-Sep-2022 11:03                1667
function.dns-get-record.php                        30-Sep-2022 11:03               27122
function.dom-import-simplexml.php                  30-Sep-2022 11:03                7081
function.doubleval.php                             30-Sep-2022 11:03                2152
function.each.php                                  30-Sep-2022 11:03               11183
function.easter-date.php                           30-Sep-2022 11:03                6191
function.easter-days.php                           30-Sep-2022 11:03                6481
function.echo.php                                  30-Sep-2022 11:03               11737
function.eio-busy.php                              30-Sep-2022 11:03                4363
function.eio-cancel.php                            30-Sep-2022 11:03                7186
function.eio-chmod.php                             30-Sep-2022 11:03                5550
function.eio-chown.php                             30-Sep-2022 11:03                5697
function.eio-close.php                             30-Sep-2022 11:03                5136
function.eio-custom.php                            30-Sep-2022 11:03               10178
function.eio-dup2.php                              30-Sep-2022 11:03                5222
function.eio-event-loop.php                        30-Sep-2022 11:03                5755
function.eio-fallocate.php                         30-Sep-2022 11:03                6665
function.eio-fchmod.php                            30-Sep-2022 11:03                5609
function.eio-fchown.php                            30-Sep-2022 11:03                5857
function.eio-fdatasync.php                         30-Sep-2022 11:03                5041
function.eio-fstat.php                             30-Sep-2022 11:03               11454
function.eio-fstatvfs.php                          30-Sep-2022 11:03                5178
function.eio-fsync.php                             30-Sep-2022 11:03                5152
function.eio-ftruncate.php                         30-Sep-2022 11:03                5627
function.eio-futime.php                            30-Sep-2022 11:03                5879
function.eio-get-event-stream.php                  30-Sep-2022 11:03                8434
function.eio-get-last-error.php                    30-Sep-2022 11:03                2926
function.eio-grp-add.php                           30-Sep-2022 11:03               12042
function.eio-grp-cancel.php                        30-Sep-2022 11:03                2999
function.eio-grp-limit.php                         30-Sep-2022 11:03                2844
function.eio-grp.php                               30-Sep-2022 11:03               12046
function.eio-init.php                              30-Sep-2022 11:03                2484
function.eio-link.php                              30-Sep-2022 11:03               12413
function.eio-lstat.php                             30-Sep-2022 11:03                9480
function.eio-mkdir.php                             30-Sep-2022 11:03                8810
function.eio-mknod.php                             30-Sep-2022 11:03               10673
function.eio-nop.php                               30-Sep-2022 11:03                4764
function.eio-npending.php                          30-Sep-2022 11:03                2910
function.eio-nready.php                            30-Sep-2022 11:03                2658
function.eio-nreqs.php                             30-Sep-2022 11:03                5507
function.eio-nthreads.php                          30-Sep-2022 11:03                3377
function.eio-open.php                              30-Sep-2022 11:03               11391
function.eio-poll.php                              30-Sep-2022 11:03                5668
function.eio-read.php                              30-Sep-2022 11:03               12707
function.eio-readahead.php                         30-Sep-2022 11:03                5602
function.eio-readdir.php                           30-Sep-2022 11:03               15512
function.eio-readlink.php                          30-Sep-2022 11:03               12105
function.eio-realpath.php                          30-Sep-2022 11:03                5063
function.eio-rename.php                            30-Sep-2022 11:03                8924
function.eio-rmdir.php                             30-Sep-2022 11:03                7850
function.eio-seek.php                              30-Sep-2022 11:03                6295
function.eio-sendfile.php                          30-Sep-2022 11:03                5871
function.eio-set-max-idle.php                      30-Sep-2022 11:03                3023
function.eio-set-max-parallel.php                  30-Sep-2022 11:03                3072
function.eio-set-max-poll-reqs.php                 30-Sep-2022 11:03                2351
function.eio-set-max-poll-time.php                 30-Sep-2022 11:03                2421
function.eio-set-min-parallel.php                  30-Sep-2022 11:03                3061
function.eio-stat.php                              30-Sep-2022 11:03                9452
function.eio-statvfs.php                           30-Sep-2022 11:03                7819
function.eio-symlink.php                           30-Sep-2022 11:03               10538
function.eio-sync-file-range.php                   30-Sep-2022 11:03                6458
function.eio-sync.php                              30-Sep-2022 11:03                2685
function.eio-syncfs.php                            30-Sep-2022 11:03                4724
function.eio-truncate.php                          30-Sep-2022 11:03                5503
function.eio-unlink.php                            30-Sep-2022 11:03                4729
function.eio-utime.php                             30-Sep-2022 11:03                5487
function.eio-write.php                             30-Sep-2022 11:03                6250
function.empty.php                                 30-Sep-2022 11:03               11652
function.enchant-broker-describe.php               30-Sep-2022 11:03                5853
function.enchant-broker-dict-exists.php            30-Sep-2022 11:03                5563
function.enchant-broker-free-dict.php              30-Sep-2022 11:03                4610
function.enchant-broker-free.php                   30-Sep-2022 11:03                4147
function.enchant-broker-get-dict-path.php          30-Sep-2022 11:03                4962
function.enchant-broker-get-error.php              30-Sep-2022 11:03                3497
function.enchant-broker-init.php                   30-Sep-2022 11:03                3373
function.enchant-broker-list-dicts.php             30-Sep-2022 11:03                6713
function.enchant-broker-request-dict.php           30-Sep-2022 11:03                6997
function.enchant-broker-request-pwl-dict.php       30-Sep-2022 11:03                5243
function.enchant-broker-set-dict-path.php          30-Sep-2022 11:03                5165
function.enchant-broker-set-ordering.php           30-Sep-2022 11:03                4491
function.enchant-dict-add-to-personal.php          30-Sep-2022 11:03                2149
function.enchant-dict-add-to-session.php           30-Sep-2022 11:03                4320
function.enchant-dict-add.php                      30-Sep-2022 11:03                6215
function.enchant-dict-check.php                    30-Sep-2022 11:03                3895
function.enchant-dict-describe.php                 30-Sep-2022 11:03                6362
function.enchant-dict-get-error.php                30-Sep-2022 11:03                3700
function.enchant-dict-is-added.php                 30-Sep-2022 11:03                4238
function.enchant-dict-is-in-session.php            30-Sep-2022 11:03                2135
function.enchant-dict-quick-check.php              30-Sep-2022 11:03                7937
function.enchant-dict-store-replacement.php        30-Sep-2022 11:03                4436
function.enchant-dict-suggest.php                  30-Sep-2022 11:03                7649
function.end.php                                   30-Sep-2022 11:03                5868
function.enum-exists.php                           30-Sep-2022 11:03                4928
function.error-clear-last.php                      30-Sep-2022 11:03                4471
function.error-get-last.php                        30-Sep-2022 11:03                4649
function.error-log.php                             30-Sep-2022 11:03               10117
function.error-reporting.php                       30-Sep-2022 11:03                8437
function.escapeshellarg.php                        30-Sep-2022 11:03                5046
function.escapeshellcmd.php                        30-Sep-2022 11:03                7331
function.eval.php                                  30-Sep-2022 11:03                8180
function.exec.php                                  30-Sep-2022 11:03                8628
function.exif-imagetype.php                        30-Sep-2022 11:03                7642
function.exif-read-data.php                        30-Sep-2022 11:03               21282
function.exif-tagname.php                          30-Sep-2022 11:03                4427
function.exif-thumbnail.php                        30-Sep-2022 11:03                8799
function.exit.php                                  30-Sep-2022 11:03                9239
function.exp.php                                   30-Sep-2022 11:03                4123
function.expect-expectl.php                        30-Sep-2022 11:03               11415
function.expect-popen.php                          30-Sep-2022 11:03                4488
function.explode.php                               30-Sep-2022 11:03               15024
function.expm1.php                                 30-Sep-2022 11:03                3646
function.extension-loaded.php                      30-Sep-2022 11:03                5264
function.extract.php                               30-Sep-2022 11:03               12373
function.ezmlm-hash.php                            30-Sep-2022 11:03                4420
function.fann-cascadetrain-on-data.php             30-Sep-2022 11:03                5928
function.fann-cascadetrain-on-file.php             30-Sep-2022 11:03                5182
function.fann-clear-scaling-params.php             30-Sep-2022 11:03                2477
function.fann-copy.php                             30-Sep-2022 11:03                2754
function.fann-create-from-file.php                 30-Sep-2022 11:03                3042
function.fann-create-shortcut-array.php            30-Sep-2022 11:03                3798
function.fann-create-shortcut.php                  30-Sep-2022 11:03                4681
function.fann-create-sparse-array.php              30-Sep-2022 11:03                4483
function.fann-create-sparse.php                    30-Sep-2022 11:03                5088
function.fann-create-standard-array.php            30-Sep-2022 11:03                4131
function.fann-create-standard.php                  30-Sep-2022 11:03                4800
function.fann-create-train-from-callback.php       30-Sep-2022 11:03                8702
function.fann-create-train.php                     30-Sep-2022 11:03                4000
function.fann-descale-input.php                    30-Sep-2022 11:03                3465
function.fann-descale-output.php                   30-Sep-2022 11:03                3478
function.fann-descale-train.php                    30-Sep-2022 11:03                3464
function.fann-destroy-train.php                    30-Sep-2022 11:03                2431
function.fann-destroy.php                          30-Sep-2022 11:03                2456
function.fann-duplicate-train-data.php             30-Sep-2022 11:03                2631
function.fann-get-activation-function.php          30-Sep-2022 11:03                4858
function.fann-get-activation-steepness.php         30-Sep-2022 11:03                5094
function.fann-get-bias-array.php                   30-Sep-2022 11:03                2424
function.fann-get-bit-fail-limit.php               30-Sep-2022 11:03                3461
function.fann-get-bit-fail.php                     30-Sep-2022 11:03                4710
function.fann-get-cascade-activation-functions-..> 30-Sep-2022 11:03                3620
function.fann-get-cascade-activation-functions.php 30-Sep-2022 11:03                4034
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:03                3663
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:03                3771
function.fann-get-cascade-candidate-change-frac..> 30-Sep-2022 11:03                4809
function.fann-get-cascade-candidate-limit.php      30-Sep-2022 11:03                3347
function.fann-get-cascade-candidate-stagnation-..> 30-Sep-2022 11:03                3990
function.fann-get-cascade-max-cand-epochs.php      30-Sep-2022 11:03                3203
function.fann-get-cascade-max-out-epochs.php       30-Sep-2022 11:03                3169
function.fann-get-cascade-min-cand-epochs.php      30-Sep-2022 11:03                3182
function.fann-get-cascade-min-out-epochs.php       30-Sep-2022 11:03                3158
function.fann-get-cascade-num-candidate-groups.php 30-Sep-2022 11:03                3543
function.fann-get-cascade-num-candidates.php       30-Sep-2022 11:03                5616
function.fann-get-cascade-output-change-fractio..> 30-Sep-2022 11:03                4724
function.fann-get-cascade-output-stagnation-epo..> 30-Sep-2022 11:03                3933
function.fann-get-cascade-weight-multiplier.php    30-Sep-2022 11:03                3249
function.fann-get-connection-array.php             30-Sep-2022 11:03                2478
function.fann-get-connection-rate.php              30-Sep-2022 11:03                2536
function.fann-get-errno.php                        30-Sep-2022 11:03                2998
function.fann-get-errstr.php                       30-Sep-2022 11:03                3020
function.fann-get-layer-array.php                  30-Sep-2022 11:03                2541
function.fann-get-learning-momentum.php            30-Sep-2022 11:03                3465
function.fann-get-learning-rate.php                30-Sep-2022 11:03                3388
function.fann-get-mse.php                          30-Sep-2022 11:03                2958
function.fann-get-network-type.php                 30-Sep-2022 11:03                2530
function.fann-get-num-input.php                    30-Sep-2022 11:03                2439
function.fann-get-num-layers.php                   30-Sep-2022 11:03                2436
function.fann-get-num-output.php                   30-Sep-2022 11:03                2456
function.fann-get-quickprop-decay.php              30-Sep-2022 11:03                3074
function.fann-get-quickprop-mu.php                 30-Sep-2022 11:03                3039
function.fann-get-rprop-decrease-factor.php        30-Sep-2022 11:03                3106
function.fann-get-rprop-delta-max.php              30-Sep-2022 11:03                3164
function.fann-get-rprop-delta-min.php              30-Sep-2022 11:03                2976
function.fann-get-rprop-delta-zero.php             30-Sep-2022 11:03                3401
function.fann-get-rprop-increase-factor.php        30-Sep-2022 11:03                3122
function.fann-get-sarprop-step-error-shift.php     30-Sep-2022 11:03                3174
function.fann-get-sarprop-step-error-threshold-..> 30-Sep-2022 11:03                3313
function.fann-get-sarprop-temperature.php          30-Sep-2022 11:03                3062
function.fann-get-sarprop-weight-decay-shift.php   30-Sep-2022 11:03                3169
function.fann-get-total-connections.php            30-Sep-2022 11:03                2581
function.fann-get-total-neurons.php                30-Sep-2022 11:03                2648
function.fann-get-train-error-function.php         30-Sep-2022 11:03                3365
function.fann-get-train-stop-function.php          30-Sep-2022 11:03                3336
function.fann-get-training-algorithm.php           30-Sep-2022 11:03                3511
function.fann-init-weights.php                     30-Sep-2022 11:03                4029
function.fann-length-train-data.php                30-Sep-2022 11:03                2587
function.fann-merge-train-data.php                 30-Sep-2022 11:03                2890
function.fann-num-input-train-data.php             30-Sep-2022 11:03                3255
function.fann-num-output-train-data.php            30-Sep-2022 11:03                3250
function.fann-print-error.php                      30-Sep-2022 11:03                2786
function.fann-randomize-weights.php                30-Sep-2022 11:03                3624
function.fann-read-train-from-file.php             30-Sep-2022 11:03                4908
function.fann-reset-errno.php                      30-Sep-2022 11:03                2980
function.fann-reset-errstr.php                     30-Sep-2022 11:03                2970
function.fann-reset-mse.php                        30-Sep-2022 11:03                3213
function.fann-run.php                              30-Sep-2022 11:03                2628
function.fann-save-train.php                       30-Sep-2022 11:03                3223
function.fann-save.php                             30-Sep-2022 11:03                3983
function.fann-scale-input-train-data.php           30-Sep-2022 11:03                3766
function.fann-scale-input.php                      30-Sep-2022 11:03                3496
function.fann-scale-output-train-data.php          30-Sep-2022 11:03                3791
function.fann-scale-output.php                     30-Sep-2022 11:03                3494
function.fann-scale-train-data.php                 30-Sep-2022 11:03                3764
function.fann-scale-train.php                      30-Sep-2022 11:03                3490
function.fann-set-activation-function-hidden.php   30-Sep-2022 11:03                4149
function.fann-set-activation-function-layer.php    30-Sep-2022 11:03                4572
function.fann-set-activation-function-output.php   30-Sep-2022 11:03                4166
function.fann-set-activation-function.php          30-Sep-2022 11:03                5771
function.fann-set-activation-steepness-hidden.php  30-Sep-2022 11:03                4391
function.fann-set-activation-steepness-layer.php   30-Sep-2022 11:03                4764
function.fann-set-activation-steepness-output.php  30-Sep-2022 11:03                4369
function.fann-set-activation-steepness.php         30-Sep-2022 11:03                5503
function.fann-set-bit-fail-limit.php               30-Sep-2022 11:03                3169
function.fann-set-callback.php                     30-Sep-2022 11:03                5134
function.fann-set-cascade-activation-functions.php 30-Sep-2022 11:03                3790
function.fann-set-cascade-activation-steepnesse..> 30-Sep-2022 11:03                3986
function.fann-set-cascade-candidate-change-frac..> 30-Sep-2022 11:03                3508
function.fann-set-cascade-candidate-limit.php      30-Sep-2022 11:03                3340
function.fann-set-cascade-candidate-stagnation-..> 30-Sep-2022 11:03                3540
function.fann-set-cascade-max-cand-epochs.php      30-Sep-2022 11:03                3361
function.fann-set-cascade-max-out-epochs.php       30-Sep-2022 11:03                3309
function.fann-set-cascade-min-cand-epochs.php      30-Sep-2022 11:03                3323
function.fann-set-cascade-min-out-epochs.php       30-Sep-2022 11:03                3313
function.fann-set-cascade-num-candidate-groups.php 30-Sep-2022 11:03                3396
function.fann-set-cascade-output-change-fractio..> 30-Sep-2022 11:03                3477
function.fann-set-cascade-output-stagnation-epo..> 30-Sep-2022 11:03                3519
function.fann-set-cascade-weight-multiplier.php    30-Sep-2022 11:03                3316
function.fann-set-error-log.php                    30-Sep-2022 11:03                2740
function.fann-set-input-scaling-params.php         30-Sep-2022 11:03                4079
function.fann-set-learning-momentum.php            30-Sep-2022 11:03                3568
function.fann-set-learning-rate.php                30-Sep-2022 11:03                3510
function.fann-set-output-scaling-params.php        30-Sep-2022 11:03                4091
function.fann-set-quickprop-decay.php              30-Sep-2022 11:03                3242
function.fann-set-quickprop-mu.php                 30-Sep-2022 11:03                3145
function.fann-set-rprop-decrease-factor.php        30-Sep-2022 11:03                3312
function.fann-set-rprop-delta-max.php              30-Sep-2022 11:03                3395
function.fann-set-rprop-delta-min.php              30-Sep-2022 11:03                3197
function.fann-set-rprop-delta-zero.php             30-Sep-2022 11:03                3583
function.fann-set-rprop-increase-factor.php        30-Sep-2022 11:03                3332
function.fann-set-sarprop-step-error-shift.php     30-Sep-2022 11:03                3418
function.fann-set-sarprop-step-error-threshold-..> 30-Sep-2022 11:03                3580
function.fann-set-sarprop-temperature.php          30-Sep-2022 11:03                3310
function.fann-set-sarprop-weight-decay-shift.php   30-Sep-2022 11:03                3419
function.fann-set-scaling-params.php               30-Sep-2022 11:03                4966
function.fann-set-train-error-function.php         30-Sep-2022 11:03                3517
function.fann-set-train-stop-function.php          30-Sep-2022 11:03                3507
function.fann-set-training-algorithm.php           30-Sep-2022 11:03                3453
function.fann-set-weight-array.php                 30-Sep-2022 11:03                2977
function.fann-set-weight.php                       30-Sep-2022 11:03                3306
function.fann-shuffle-train-data.php               30-Sep-2022 11:03                2613
function.fann-subset-train-data.php                30-Sep-2022 11:03                3892
function.fann-test-data.php                        30-Sep-2022 11:03                3935
function.fann-test.php                             30-Sep-2022 11:03                4262
function.fann-train-epoch.php                      30-Sep-2022 11:03                4251
function.fann-train-on-data.php                    30-Sep-2022 11:03                6016
function.fann-train-on-file.php                    30-Sep-2022 11:03                5985
function.fann-train.php                            30-Sep-2022 11:03                4310
function.fastcgi-finish-request.php                30-Sep-2022 11:03                2169
function.fbird-add-user.php                        30-Sep-2022 11:03                2292
function.fbird-affected-rows.php                   30-Sep-2022 11:03                2310
function.fbird-backup.php                          30-Sep-2022 11:03                1717
function.fbird-blob-add.php                        30-Sep-2022 11:03                2651
function.fbird-blob-cancel.php                     30-Sep-2022 11:03                3446
function.fbird-blob-close.php                      30-Sep-2022 11:03                2682
function.fbird-blob-create.php                     30-Sep-2022 11:03                2682
function.fbird-blob-echo.php                       30-Sep-2022 11:03                2470
function.fbird-blob-get.php                        30-Sep-2022 11:03                2463
function.fbird-blob-import.php                     30-Sep-2022 11:03                2678
function.fbird-blob-info.php                       30-Sep-2022 11:03                1749
function.fbird-blob-open.php                       30-Sep-2022 11:03                2460
function.fbird-close.php                           30-Sep-2022 11:03                2233
function.fbird-commit-ret.php                      30-Sep-2022 11:03                1742
function.fbird-commit.php                          30-Sep-2022 11:03                1710
function.fbird-connect.php                         30-Sep-2022 11:03                2239
function.fbird-db-info.php                         30-Sep-2022 11:03                1723
function.fbird-delete-user.php                     30-Sep-2022 11:03                2307
function.fbird-drop-db.php                         30-Sep-2022 11:03                2255
function.fbird-errcode.php                         30-Sep-2022 11:03                2065
function.fbird-errmsg.php                          30-Sep-2022 11:03                2058
function.fbird-execute.php                         30-Sep-2022 11:03                2070
function.fbird-fetch-assoc.php                     30-Sep-2022 11:03                2323
function.fbird-fetch-object.php                    30-Sep-2022 11:03                2334
function.fbird-fetch-row.php                       30-Sep-2022 11:03                2311
function.fbird-field-info.php                      30-Sep-2022 11:03                2140
function.fbird-free-event-handler.php              30-Sep-2022 11:03                2244
function.fbird-free-query.php                      30-Sep-2022 11:03                1778
function.fbird-free-result.php                     30-Sep-2022 11:03                1763
function.fbird-gen-id.php                          30-Sep-2022 11:03                1720
function.fbird-maintain-db.php                     30-Sep-2022 11:03                1765
function.fbird-modify-user.php                     30-Sep-2022 11:03                2323
function.fbird-name-result.php                     30-Sep-2022 11:03                2306
function.fbird-num-fields.php                      30-Sep-2022 11:03                2129
function.fbird-num-params.php                      30-Sep-2022 11:03                2301
function.fbird-param-info.php                      30-Sep-2022 11:03                2306
function.fbird-pconnect.php                        30-Sep-2022 11:03                2256
function.fbird-prepare.php                         30-Sep-2022 11:03                1713
function.fbird-query.php                           30-Sep-2022 11:03                2598
function.fbird-restore.php                         30-Sep-2022 11:03                1720
function.fbird-rollback-ret.php                    30-Sep-2022 11:03                1772
function.fbird-rollback.php                        30-Sep-2022 11:03                1744
function.fbird-server-info.php                     30-Sep-2022 11:03                1775
function.fbird-service-attach.php                  30-Sep-2022 11:03                1814
function.fbird-service-detach.php                  30-Sep-2022 11:03                1826
function.fbird-set-event-handler.php               30-Sep-2022 11:03                2416
function.fbird-trans.php                           30-Sep-2022 11:03                1719
function.fbird-wait-event.php                      30-Sep-2022 11:03                2341
function.fclose.php                                30-Sep-2022 11:03                4152
function.fdatasync.php                             30-Sep-2022 11:03                5766
function.fdf-add-doc-javascript.php                30-Sep-2022 11:03                5160
function.fdf-add-template.php                      30-Sep-2022 11:03                2466
function.fdf-close.php                             30-Sep-2022 11:03                2939
function.fdf-create.php                            30-Sep-2022 11:03                5501
function.fdf-enum-values.php                       30-Sep-2022 11:03                2316
function.fdf-errno.php                             30-Sep-2022 11:03                2640
function.fdf-error.php                             30-Sep-2022 11:03                3039
function.fdf-get-ap.php                            30-Sep-2022 11:03                3814
function.fdf-get-attachment.php                    30-Sep-2022 11:03                5901
function.fdf-get-encoding.php                      30-Sep-2022 11:03                3215
function.fdf-get-file.php                          30-Sep-2022 11:03                3035
function.fdf-get-flags.php                         30-Sep-2022 11:03                2078
function.fdf-get-opt.php                           30-Sep-2022 11:03                2216
function.fdf-get-status.php                        30-Sep-2022 11:03                3054
function.fdf-get-value.php                         30-Sep-2022 11:03                4339
function.fdf-get-version.php                       30-Sep-2022 11:03                3414
function.fdf-header.php                            30-Sep-2022 11:03                2227
function.fdf-next-field-name.php                   30-Sep-2022 11:03                5289
function.fdf-open-string.php                       30-Sep-2022 11:03                4689
function.fdf-open.php                              30-Sep-2022 11:03                5795
function.fdf-remove-item.php                       30-Sep-2022 11:03                2090
function.fdf-save-string.php                       30-Sep-2022 11:03                5443
function.fdf-save.php                              30-Sep-2022 11:03                3794
function.fdf-set-ap.php                            30-Sep-2022 11:03                3987
function.fdf-set-encoding.php                      30-Sep-2022 11:03                3438
function.fdf-set-file.php                          30-Sep-2022 11:03                6664
function.fdf-set-flags.php                         30-Sep-2022 11:03                3962
function.fdf-set-javascript-action.php             30-Sep-2022 11:03                4157
function.fdf-set-on-import-javascript.php          30-Sep-2022 11:03                2890
function.fdf-set-opt.php                           30-Sep-2022 11:03                4187
function.fdf-set-status.php                        30-Sep-2022 11:03                3483
function.fdf-set-submit-form-action.php            30-Sep-2022 11:03                4402
function.fdf-set-target-frame.php                  30-Sep-2022 11:03                3483
function.fdf-set-value.php                         30-Sep-2022 11:03                4928
function.fdf-set-version.php                       30-Sep-2022 11:03                3707
function.fdiv.php                                  30-Sep-2022 11:03                5932
function.feof.php                                  30-Sep-2022 11:03                7536
function.fflush.php                                30-Sep-2022 11:03                5884
function.fgetc.php                                 30-Sep-2022 11:03                6244
function.fgetcsv.php                               30-Sep-2022 11:03               12317
function.fgets.php                                 30-Sep-2022 11:03                8317
function.fgetss.php                                30-Sep-2022 11:03                9223
function.file-exists.php                           30-Sep-2022 11:03                6194
function.file-get-contents.php                     30-Sep-2022 11:03               17054
function.file-put-contents.php                     30-Sep-2022 11:03               12147
function.file.php                                  30-Sep-2022 11:03               10753
function.fileatime.php                             30-Sep-2022 11:03                6518
function.filectime.php                             30-Sep-2022 11:03                6641
function.filegroup.php                             30-Sep-2022 11:03                5312
function.fileinode.php                             30-Sep-2022 11:03                5045
function.filemtime.php                             30-Sep-2022 11:03                6384
function.fileowner.php                             30-Sep-2022 11:03                5234
function.fileperms.php                             30-Sep-2022 11:03               17573
function.filesize.php                              30-Sep-2022 11:03                5383
function.filetype.php                              30-Sep-2022 11:03                6213
function.filter-has-var.php                        30-Sep-2022 11:03                2814
function.filter-id.php                             30-Sep-2022 11:03                2679
function.filter-input-array.php                    30-Sep-2022 11:03               13824
function.filter-input.php                          30-Sep-2022 11:03                7667
function.filter-list.php                           30-Sep-2022 11:03                3356
function.filter-var-array.php                      30-Sep-2022 11:03               13918
function.filter-var.php                            30-Sep-2022 11:03               13295
function.finfo-buffer.php                          30-Sep-2022 11:03                6504
function.finfo-close.php                           30-Sep-2022 11:03                2609
function.finfo-file.php                            30-Sep-2022 11:03                7109
function.finfo-open.php                            30-Sep-2022 11:03                8975
function.finfo-set-flags.php                       30-Sep-2022 11:03                3689
function.floatval.php                              30-Sep-2022 11:03                3405
function.flock.php                                 30-Sep-2022 11:03               12244
function.floor.php                                 30-Sep-2022 11:03                4431
function.flush.php                                 30-Sep-2022 11:03                3129
function.fmod.php                                  30-Sep-2022 11:03                4189
function.fnmatch.php                               30-Sep-2022 11:03                7250
function.fopen.php                                 30-Sep-2022 11:03               21350
function.forward-static-call-array.php             30-Sep-2022 11:03                9942
function.forward-static-call.php                   30-Sep-2022 11:03                9698
function.fpassthru.php                             30-Sep-2022 11:03                6941
function.fpm-get-status.php                        30-Sep-2022 11:03                2426
function.fprintf.php                               30-Sep-2022 11:03               17685
function.fputcsv.php                               30-Sep-2022 11:03                9707
function.fputs.php                                 30-Sep-2022 11:03                1612
function.fread.php                                 30-Sep-2022 11:03               14542
function.frenchtojd.php                            30-Sep-2022 11:03                3584
function.fscanf.php                                30-Sep-2022 11:03                8988
function.fseek.php                                 30-Sep-2022 11:03                7242
function.fsockopen.php                             30-Sep-2022 11:03               16457
function.fstat.php                                 30-Sep-2022 11:03                5677
function.fsync.php                                 30-Sep-2022 11:03                5528
function.ftell.php                                 30-Sep-2022 11:03                5909
function.ftok.php                                  30-Sep-2022 11:03                3441
function.ftp-alloc.php                             30-Sep-2022 11:03                7300
function.ftp-append.php                            30-Sep-2022 11:03                3294
function.ftp-cdup.php                              30-Sep-2022 11:03                6014
function.ftp-chdir.php                             30-Sep-2022 11:03                6801
function.ftp-chmod.php                             30-Sep-2022 11:03                6102
function.ftp-close.php                             30-Sep-2022 11:03                5103
function.ftp-connect.php                           30-Sep-2022 11:03                5416
function.ftp-delete.php                            30-Sep-2022 11:03                5466
function.ftp-exec.php                              30-Sep-2022 11:03                5928
function.ftp-fget.php                              30-Sep-2022 11:03                9389
function.ftp-fput.php                              30-Sep-2022 11:03                8719
function.ftp-get-option.php                        30-Sep-2022 11:03                5019
function.ftp-get.php                               30-Sep-2022 11:03                8633
function.ftp-login.php                             30-Sep-2022 11:03                6018
function.ftp-mdtm.php                              30-Sep-2022 11:03                6462
function.ftp-mkdir.php                             30-Sep-2022 11:03                5681
function.ftp-mlsd.php                              30-Sep-2022 11:03                8153
function.ftp-nb-continue.php                       30-Sep-2022 11:03                4711
function.ftp-nb-fget.php                           30-Sep-2022 11:03                9807
function.ftp-nb-fput.php                           30-Sep-2022 11:03                9576
function.ftp-nb-get.php                            30-Sep-2022 11:03               13730
function.ftp-nb-put.php                            30-Sep-2022 11:03               11225
function.ftp-nlist.php                             30-Sep-2022 11:03                6213
function.ftp-pasv.php                              30-Sep-2022 11:03                6441
function.ftp-put.php                               30-Sep-2022 11:03                8404
function.ftp-pwd.php                               30-Sep-2022 11:03                5205
function.ftp-quit.php                              30-Sep-2022 11:03                1647
function.ftp-raw.php                               30-Sep-2022 11:03                4418
function.ftp-rawlist.php                           30-Sep-2022 11:03                7142
function.ftp-rename.php                            30-Sep-2022 11:03                6355
function.ftp-rmdir.php                             30-Sep-2022 11:03                5659
function.ftp-set-option.php                        30-Sep-2022 11:03                5929
function.ftp-site.php                              30-Sep-2022 11:03                5899
function.ftp-size.php                              30-Sep-2022 11:03                6036
function.ftp-ssl-connect.php                       30-Sep-2022 11:03                8408
function.ftp-systype.php                           30-Sep-2022 11:03                4688
function.ftruncate.php                             30-Sep-2022 11:03                6230
function.func-get-arg.php                          30-Sep-2022 11:03               14136
function.func-get-args.php                         30-Sep-2022 11:03               14967
function.func-num-args.php                         30-Sep-2022 11:03                8387
function.function-exists.php                       30-Sep-2022 11:03                5806
function.fwrite.php                                30-Sep-2022 11:03               15007
function.gc-collect-cycles.php                     30-Sep-2022 11:03                2411
function.gc-disable.php                            30-Sep-2022 11:03                2449
function.gc-enable.php                             30-Sep-2022 11:03                2427
function.gc-enabled.php                            30-Sep-2022 11:03                3158
function.gc-mem-caches.php                         30-Sep-2022 11:03                2360
function.gc-status.php                             30-Sep-2022 11:03                5869
function.gd-info.php                               30-Sep-2022 11:03                7884
function.geoip-asnum-by-name.php                   30-Sep-2022 11:03                3988
function.geoip-continent-code-by-name.php          30-Sep-2022 11:03                5540
function.geoip-country-code-by-name.php            30-Sep-2022 11:03                5233
function.geoip-country-code3-by-name.php           30-Sep-2022 11:03                4857
function.geoip-country-name-by-name.php            30-Sep-2022 11:03                4801
function.geoip-database-info.php                   30-Sep-2022 11:03                3982
function.geoip-db-avail.php                        30-Sep-2022 11:03                4178
function.geoip-db-filename.php                     30-Sep-2022 11:03                3893
function.geoip-db-get-all-info.php                 30-Sep-2022 11:03                6410
function.geoip-domain-by-name.php                  30-Sep-2022 11:03                4221
function.geoip-id-by-name.php                      30-Sep-2022 11:03                5745
function.geoip-isp-by-name.php                     30-Sep-2022 11:03                4217
function.geoip-netspeedcell-by-name.php            30-Sep-2022 11:03                4877
function.geoip-org-by-name.php                     30-Sep-2022 11:03                4217
function.geoip-record-by-name.php                  30-Sep-2022 11:03                7317
function.geoip-region-by-name.php                  30-Sep-2022 11:03                4788
function.geoip-region-name-by-code.php             30-Sep-2022 11:03                7008
function.geoip-setup-custom-directory.php          30-Sep-2022 11:03                4080
function.geoip-time-zone-by-country-and-region.php 30-Sep-2022 11:03                7154
function.get-browser.php                           30-Sep-2022 11:03                7029
function.get-called-class.php                      30-Sep-2022 11:03                4812
function.get-cfg-var.php                           30-Sep-2022 11:03                3970
function.get-class-methods.php                     30-Sep-2022 11:03                7042
function.get-class-vars.php                        30-Sep-2022 11:03               10150
function.get-class.php                             30-Sep-2022 11:03               12240
function.get-current-user.php                      30-Sep-2022 11:03                4011
function.get-debug-type.php                        30-Sep-2022 11:03                9595
function.get-declared-classes.php                  30-Sep-2022 11:03                5018
function.get-declared-interfaces.php               30-Sep-2022 11:03                4144
function.get-declared-traits.php                   30-Sep-2022 11:03                2814
function.get-defined-constants.php                 30-Sep-2022 11:03                7088
function.get-defined-functions.php                 30-Sep-2022 11:03                6488
function.get-defined-vars.php                      30-Sep-2022 11:03                4913
function.get-extension-funcs.php                   30-Sep-2022 11:03                5249
function.get-headers.php                           30-Sep-2022 11:03                7887
function.get-html-translation-table.php            30-Sep-2022 11:03               12454
function.get-include-path.php                      30-Sep-2022 11:03                3891
function.get-included-files.php                    30-Sep-2022 11:03                6037
function.get-loaded-extensions.php                 30-Sep-2022 11:03                5167
function.get-magic-quotes-gpc.php                  30-Sep-2022 11:03                3729
function.get-magic-quotes-runtime.php              30-Sep-2022 11:03                4413
function.get-mangled-object-vars.php               30-Sep-2022 11:03                8159
function.get-meta-tags.php                         30-Sep-2022 11:03                7624
function.get-object-vars.php                       30-Sep-2022 11:03                6134
function.get-parent-class.php                      30-Sep-2022 11:03                7571
function.get-required-files.php                    30-Sep-2022 11:03                1787
function.get-resource-id.php                       30-Sep-2022 11:03                4530
function.get-resource-type.php                     30-Sep-2022 11:03                4120
function.get-resources.php                         30-Sep-2022 11:03                7437
function.getallheaders.php                         30-Sep-2022 11:03                4490
function.getcwd.php                                30-Sep-2022 11:03                4931
function.getdate.php                               30-Sep-2022 11:03                8852
function.getenv.php                                30-Sep-2022 11:03                7304
function.gethostbyaddr.php                         30-Sep-2022 11:03                4049
function.gethostbyname.php                         30-Sep-2022 11:03                4334
function.gethostbynamel.php                        30-Sep-2022 11:03                4687
function.gethostname.php                           30-Sep-2022 11:03                3893
function.getimagesize.php                          30-Sep-2022 11:03               26316
function.getimagesizefromstring.php                30-Sep-2022 11:03                5394
function.getlastmod.php                            30-Sep-2022 11:03                4776
function.getmxrr.php                               30-Sep-2022 11:03                5775
function.getmygid.php                              30-Sep-2022 11:03                3022
function.getmyinode.php                            30-Sep-2022 11:03                3031
function.getmypid.php                              30-Sep-2022 11:03                3325
function.getmyuid.php                              30-Sep-2022 11:03                2964
function.getopt.php                                30-Sep-2022 11:03               15651
function.getprotobyname.php                        30-Sep-2022 11:03                4579
function.getprotobynumber.php                      30-Sep-2022 11:03                3085
function.getrandmax.php                            30-Sep-2022 11:03                2712
function.getrusage.php                             30-Sep-2022 11:03               11588
function.getservbyname.php                         30-Sep-2022 11:03                6241
function.getservbyport.php                         30-Sep-2022 11:03                3517
function.gettext.php                               30-Sep-2022 11:03                5815
function.gettimeofday.php                          30-Sep-2022 11:03                4403
function.gettype.php                               30-Sep-2022 11:03                8759
function.glob.php                                  30-Sep-2022 11:03                9024
function.gmdate.php                                30-Sep-2022 11:03                7302
function.gmmktime.php                              30-Sep-2022 11:03                9665
function.gmp-abs.php                               30-Sep-2022 11:03                4285
function.gmp-add.php                               30-Sep-2022 11:03                4448
function.gmp-and.php                               30-Sep-2022 11:03                4929
function.gmp-binomial.php                          30-Sep-2022 11:03                3657
function.gmp-clrbit.php                            30-Sep-2022 11:03                5485
function.gmp-cmp.php                               30-Sep-2022 11:03                5328
function.gmp-com.php                               30-Sep-2022 11:03                3756
function.gmp-div-q.php                             30-Sep-2022 11:03                9639
function.gmp-div-qr.php                            30-Sep-2022 11:03                6348
function.gmp-div-r.php                             30-Sep-2022 11:03                5747
function.gmp-div.php                               30-Sep-2022 11:03                1639
function.gmp-divexact.php                          30-Sep-2022 11:03                5580
function.gmp-export.php                            30-Sep-2022 11:03                5195
function.gmp-fact.php                              30-Sep-2022 11:03                4740
function.gmp-gcd.php                               30-Sep-2022 11:03                4840
function.gmp-gcdext.php                            30-Sep-2022 11:03                9337
function.gmp-hamdist.php                           30-Sep-2022 11:03                6155
function.gmp-import.php                            30-Sep-2022 11:03                5657
function.gmp-init.php                              30-Sep-2022 11:03                5137
function.gmp-intval.php                            30-Sep-2022 11:03                5030
function.gmp-invert.php                            30-Sep-2022 11:03                5005
function.gmp-jacobi.php                            30-Sep-2022 11:03                5318
function.gmp-kronecker.php                         30-Sep-2022 11:03                3637
function.gmp-lcm.php                               30-Sep-2022 11:03                3448
function.gmp-legendre.php                          30-Sep-2022 11:03                5337
function.gmp-mod.php                               30-Sep-2022 11:03                4570
function.gmp-mul.php                               30-Sep-2022 11:03                4652
function.gmp-neg.php                               30-Sep-2022 11:03                4237
function.gmp-nextprime.php                         30-Sep-2022 11:03                4960
function.gmp-or.php                                30-Sep-2022 11:03                5151
function.gmp-perfect-power.php                     30-Sep-2022 11:03                3025
function.gmp-perfect-square.php                    30-Sep-2022 11:03                5341
function.gmp-popcount.php                          30-Sep-2022 11:03                4656
function.gmp-pow.php                               30-Sep-2022 11:03                5601
function.gmp-powm.php                              30-Sep-2022 11:03                5375
function.gmp-prob-prime.php                        30-Sep-2022 11:03                5517
function.gmp-random-bits.php                       30-Sep-2022 11:03                4509
function.gmp-random-range.php                      30-Sep-2022 11:03                5428
function.gmp-random-seed.php                       30-Sep-2022 11:03                6636
function.gmp-random.php                            30-Sep-2022 11:03                5313
function.gmp-root.php                              30-Sep-2022 11:03                2963
function.gmp-rootrem.php                           30-Sep-2022 11:03                3071
function.gmp-scan0.php                             30-Sep-2022 11:03                5357
function.gmp-scan1.php                             30-Sep-2022 11:03                5369
function.gmp-setbit.php                            30-Sep-2022 11:03               11799
function.gmp-sign.php                              30-Sep-2022 11:03                4923
function.gmp-sqrt.php                              30-Sep-2022 11:03                4834
function.gmp-sqrtrem.php                           30-Sep-2022 11:03                6246
function.gmp-strval.php                            30-Sep-2022 11:03                4419
function.gmp-sub.php                               30-Sep-2022 11:03                4744
function.gmp-testbit.php                           30-Sep-2022 11:03                5522
function.gmp-xor.php                               30-Sep-2022 11:03                5152
function.gmstrftime.php                            30-Sep-2022 11:03                8568
function.gnupg-adddecryptkey.php                   30-Sep-2022 11:03                5014
function.gnupg-addencryptkey.php                   30-Sep-2022 11:03                4619
function.gnupg-addsignkey.php                      30-Sep-2022 11:03                5036
function.gnupg-cleardecryptkeys.php                30-Sep-2022 11:03                4224
function.gnupg-clearencryptkeys.php                30-Sep-2022 11:03                4229
function.gnupg-clearsignkeys.php                   30-Sep-2022 11:03                4171
function.gnupg-decrypt.php                         30-Sep-2022 11:03                5799
function.gnupg-decryptverify.php                   30-Sep-2022 11:03                6907
function.gnupg-deletekey.php                       30-Sep-2022 11:03                4861
function.gnupg-encrypt.php                         30-Sep-2022 11:03                5727
function.gnupg-encryptsign.php                     30-Sep-2022 11:03                6627
function.gnupg-export.php                          30-Sep-2022 11:03                4890
function.gnupg-getengineinfo.php                   30-Sep-2022 11:03                5418
function.gnupg-geterror.php                        30-Sep-2022 11:03                4089
function.gnupg-geterrorinfo.php                    30-Sep-2022 11:03                5561
function.gnupg-getprotocol.php                     30-Sep-2022 11:03                4219
function.gnupg-gettrustlist.php                    30-Sep-2022 11:03                4963
function.gnupg-import.php                          30-Sep-2022 11:03                5152
function.gnupg-init.php                            30-Sep-2022 11:03                6981
function.gnupg-keyinfo.php                         30-Sep-2022 11:03                5084
function.gnupg-listsignatures.php                  30-Sep-2022 11:03                5192
function.gnupg-setarmor.php                        30-Sep-2022 11:03                5466
function.gnupg-seterrormode.php                    30-Sep-2022 11:03                5411
function.gnupg-setsignmode.php                     30-Sep-2022 11:03                5313
function.gnupg-sign.php                            30-Sep-2022 11:03                5969
function.gnupg-verify.php                          30-Sep-2022 11:03                8090
function.grapheme-extract.php                      30-Sep-2022 11:03                8659
function.grapheme-stripos.php                      30-Sep-2022 11:03                8175
function.grapheme-stristr.php                      30-Sep-2022 11:03                7735
function.grapheme-strlen.php                       30-Sep-2022 11:03                5479
function.grapheme-strpos.php                       30-Sep-2022 11:03                7782
function.grapheme-strripos.php                     30-Sep-2022 11:03                7633
function.grapheme-strrpos.php                      30-Sep-2022 11:03                7232
function.grapheme-strstr.php                       30-Sep-2022 11:03                7277
function.grapheme-substr.php                       30-Sep-2022 11:03                7807
function.gregoriantojd.php                         30-Sep-2022 11:03                5349
function.gzclose.php                               30-Sep-2022 11:03                4067
function.gzcompress.php                            30-Sep-2022 11:03                5733
function.gzdecode.php                              30-Sep-2022 11:03                3439
function.gzdeflate.php                             30-Sep-2022 11:03                5365
function.gzencode.php                              30-Sep-2022 11:03                6541
function.gzeof.php                                 30-Sep-2022 11:03                3930
function.gzfile.php                                30-Sep-2022 11:03                4594
function.gzgetc.php                                30-Sep-2022 11:03                4533
function.gzgets.php                                30-Sep-2022 11:03                5887
function.gzgetss.php                               30-Sep-2022 11:03                5945
function.gzinflate.php                             30-Sep-2022 11:03                5224
function.gzopen.php                                30-Sep-2022 11:03                5407
function.gzpassthru.php                            30-Sep-2022 11:03                4664
function.gzputs.php                                30-Sep-2022 11:03                1606
function.gzread.php                                30-Sep-2022 11:03                6465
function.gzrewind.php                              30-Sep-2022 11:03                3064
function.gzseek.php                                30-Sep-2022 11:03                5945
function.gztell.php                                30-Sep-2022 11:03                3265
function.gzuncompress.php                          30-Sep-2022 11:03                5184
function.gzwrite.php                               30-Sep-2022 11:03                6235
function.halt-compiler.php                         30-Sep-2022 11:03                4786
function.hash-algos.php                            30-Sep-2022 11:03                5128
function.hash-copy.php                             30-Sep-2022 11:03                5378
function.hash-equals.php                           30-Sep-2022 11:03                6470
function.hash-file.php                             30-Sep-2022 11:03                6060
function.hash-final.php                            30-Sep-2022 11:03                6084
function.hash-hkdf.php                             30-Sep-2022 11:03                8842
function.hash-hmac-algos.php                       30-Sep-2022 11:03                5168
function.hash-hmac-file.php                        30-Sep-2022 11:03                7066
function.hash-hmac.php                             30-Sep-2022 11:03                6641
function.hash-init.php                             30-Sep-2022 11:03                7512
function.hash-pbkdf2.php                           30-Sep-2022 11:03               10707
function.hash-update-file.php                      30-Sep-2022 11:03                5234
function.hash-update-stream.php                    30-Sep-2022 11:03                6975
function.hash-update.php                           30-Sep-2022 11:03                4242
function.hash.php                                  30-Sep-2022 11:03               10285
function.header-register-callback.php              30-Sep-2022 11:03                6623
function.header-remove.php                         30-Sep-2022 11:03                5780
function.header.php                                30-Sep-2022 11:03               17553
function.headers-list.php                          30-Sep-2022 11:03                5842
function.headers-sent.php                          30-Sep-2022 11:03                7565
function.hebrev.php                                30-Sep-2022 11:03                3269
function.hebrevc.php                               30-Sep-2022 11:03                3335
function.hex2bin.php                               30-Sep-2022 11:03                5357
function.hexdec.php                                30-Sep-2022 11:03                5888
function.highlight-file.php                        30-Sep-2022 11:03                4923
function.highlight-string.php                      30-Sep-2022 11:03                5317
function.hrtime.php                                30-Sep-2022 11:03                4474
function.html-entity-decode.php                    30-Sep-2022 11:03               13571
function.htmlentities.php                          30-Sep-2022 11:03               16411
function.htmlspecialchars-decode.php               30-Sep-2022 11:03                8023
function.htmlspecialchars.php                      30-Sep-2022 11:03               19768
function.http-build-query.php                      30-Sep-2022 11:03               21282
function.http-response-code.php                    30-Sep-2022 11:03                6618
function.hypot.php                                 30-Sep-2022 11:03                2827
function.ibase-add-user.php                        30-Sep-2022 11:03                4642
function.ibase-affected-rows.php                   30-Sep-2022 11:03                3297
function.ibase-backup.php                          30-Sep-2022 11:03                9956
function.ibase-blob-add.php                        30-Sep-2022 11:03                3839
function.ibase-blob-cancel.php                     30-Sep-2022 11:03                3460
function.ibase-blob-close.php                      30-Sep-2022 11:03                3815
function.ibase-blob-create.php                     30-Sep-2022 11:03                3792
function.ibase-blob-echo.php                       30-Sep-2022 11:03                3812
function.ibase-blob-get.php                        30-Sep-2022 11:03                6472
function.ibase-blob-import.php                     30-Sep-2022 11:03                8237
function.ibase-blob-info.php                       30-Sep-2022 11:03                3164
function.ibase-blob-open.php                       30-Sep-2022 11:03                4017
function.ibase-close.php                           30-Sep-2022 11:03                3496
function.ibase-commit-ret.php                      30-Sep-2022 11:03                2991
function.ibase-commit.php                          30-Sep-2022 11:03                2792
function.ibase-connect.php                         30-Sep-2022 11:03               10043
function.ibase-db-info.php                         30-Sep-2022 11:03                2349
function.ibase-delete-user.php                     30-Sep-2022 11:03                3282
function.ibase-drop-db.php                         30-Sep-2022 11:03                3394
function.ibase-errcode.php                         30-Sep-2022 11:03                2515
function.ibase-errmsg.php                          30-Sep-2022 11:03                2506
function.ibase-execute.php                         30-Sep-2022 11:03                6914
function.ibase-fetch-assoc.php                     30-Sep-2022 11:03                4466
function.ibase-fetch-object.php                    30-Sep-2022 11:03                6507
function.ibase-fetch-row.php                       30-Sep-2022 11:03                4231
function.ibase-field-info.php                      30-Sep-2022 11:03                7037
function.ibase-free-event-handler.php              30-Sep-2022 11:03                3268
function.ibase-free-query.php                      30-Sep-2022 11:03                2558
function.ibase-free-result.php                     30-Sep-2022 11:03                2650
function.ibase-gen-id.php                          30-Sep-2022 11:03                2568
function.ibase-maintain-db.php                     30-Sep-2022 11:03                2676
function.ibase-modify-user.php                     30-Sep-2022 11:03                4647
function.ibase-name-result.php                     30-Sep-2022 11:03                5631
function.ibase-num-fields.php                      30-Sep-2022 11:03                6602
function.ibase-num-params.php                      30-Sep-2022 11:03                3287
function.ibase-param-info.php                      30-Sep-2022 11:03                3485
function.ibase-pconnect.php                        30-Sep-2022 11:03                7326
function.ibase-prepare.php                         30-Sep-2022 11:03                4005
function.ibase-query.php                           30-Sep-2022 11:03                6911
function.ibase-restore.php                         30-Sep-2022 11:03               10035
function.ibase-rollback-ret.php                    30-Sep-2022 11:03                3032
function.ibase-rollback.php                        30-Sep-2022 11:03                2837
function.ibase-server-info.php                     30-Sep-2022 11:03               10765
function.ibase-service-attach.php                  30-Sep-2022 11:03               12683
function.ibase-service-detach.php                  30-Sep-2022 11:03                6969
function.ibase-set-event-handler.php               30-Sep-2022 11:03                7713
function.ibase-trans.php                           30-Sep-2022 11:03                5415
function.ibase-wait-event.php                      30-Sep-2022 11:03                3890
function.iconv-get-encoding.php                    30-Sep-2022 11:03                5337
function.iconv-mime-decode-headers.php             30-Sep-2022 11:03                9203
function.iconv-mime-decode.php                     30-Sep-2022 11:03                7339
function.iconv-mime-encode.php                     30-Sep-2022 11:03               11591
function.iconv-set-encoding.php                    30-Sep-2022 11:03                4691
function.iconv-strlen.php                          30-Sep-2022 11:03                3853
function.iconv-strpos.php                          30-Sep-2022 11:03                6831
function.iconv-strrpos.php                         30-Sep-2022 11:03                6127
function.iconv-substr.php                          30-Sep-2022 11:03                6991
function.iconv.php                                 30-Sep-2022 11:03                7772
function.idate.php                                 30-Sep-2022 11:03               10527
function.idn-to-ascii.php                          30-Sep-2022 11:03                6606
function.idn-to-utf8.php                           30-Sep-2022 11:03                6614
function.igbinary-serialize.php                    30-Sep-2022 11:03                9512
function.igbinary-unserialize.php                  30-Sep-2022 11:03                9008
function.ignore-user-abort.php                     30-Sep-2022 11:03                6868
function.image-type-to-extension.php               30-Sep-2022 11:03                4883
function.image-type-to-mime-type.php               30-Sep-2022 11:03                6286
function.image2wbmp.php                            30-Sep-2022 11:03                4696
function.imageaffine.php                           30-Sep-2022 11:03                3306
function.imageaffinematrixconcat.php               30-Sep-2022 11:03                6415
function.imageaffinematrixget.php                  30-Sep-2022 11:03                5874
function.imagealphablending.php                    30-Sep-2022 11:03                6989
function.imageantialias.php                        30-Sep-2022 11:03                9985
function.imagearc.php                              30-Sep-2022 11:03                6907
function.imageavif.php                             30-Sep-2022 11:03                5466
function.imagebmp.php                              30-Sep-2022 11:03                7463
function.imagechar.php                             30-Sep-2022 11:03                6129
function.imagecharup.php                           30-Sep-2022 11:03                6171
function.imagecolorallocate.php                    30-Sep-2022 11:03                7185
function.imagecolorallocatealpha.php               30-Sep-2022 11:03               25918
function.imagecolorat.php                          30-Sep-2022 11:03                4592
function.imagecolorclosest.php                     30-Sep-2022 11:03                2885
function.imagecolorclosestalpha.php                30-Sep-2022 11:03               12891
function.imagecolorclosesthwb.php                  30-Sep-2022 11:03                6101
function.imagecolordeallocate.php                  30-Sep-2022 11:03                3582
function.imagecolorexact.php                       30-Sep-2022 11:03                2693
function.imagecolorexactalpha.php                  30-Sep-2022 11:03                8664
function.imagecolormatch.php                       30-Sep-2022 11:03                7843
function.imagecolorresolve.php                     30-Sep-2022 11:03                2726
function.imagecolorresolvealpha.php                30-Sep-2022 11:03                7620
function.imagecolorset.php                         30-Sep-2022 11:03                2713
function.imagecolorsforindex.php                   30-Sep-2022 11:03                5160
function.imagecolorstotal.php                      30-Sep-2022 11:03                2212
function.imagecolortransparent.php                 30-Sep-2022 11:03                3456
function.imageconvolution.php                      30-Sep-2022 11:03               11231
function.imagecopy.php                             30-Sep-2022 11:03                3130
function.imagecopymerge.php                        30-Sep-2022 11:03                3866
function.imagecopymergegray.php                    30-Sep-2022 11:03                4152
function.imagecopyresampled.php                    30-Sep-2022 11:03               17487
function.imagecopyresized.php                      30-Sep-2022 11:03               12273
function.imagecreate.php                           30-Sep-2022 11:03                5565
function.imagecreatefromavif.php                   30-Sep-2022 11:03                2722
function.imagecreatefrombmp.php                    30-Sep-2022 11:03                5332
function.imagecreatefromgd.php                     30-Sep-2022 11:03                5057
function.imagecreatefromgd2.php                    30-Sep-2022 11:03                5187
function.imagecreatefromgd2part.php                30-Sep-2022 11:03                7767
function.imagecreatefromgif.php                    30-Sep-2022 11:03                9359
function.imagecreatefromjpeg.php                   30-Sep-2022 11:03                9061
function.imagecreatefrompng.php                    30-Sep-2022 11:03                9031
function.imagecreatefromstring.php                 30-Sep-2022 11:03                6924
function.imagecreatefromtga.php                    30-Sep-2022 11:03                3368
function.imagecreatefromwbmp.php                   30-Sep-2022 11:03                8763
function.imagecreatefromwebp.php                   30-Sep-2022 11:03                4632
function.imagecreatefromxbm.php                    30-Sep-2022 11:03                4702
function.imagecreatefromxpm.php                    30-Sep-2022 11:03                5825
function.imagecreatetruecolor.php                  30-Sep-2022 11:03                6938
function.imagecrop.php                             30-Sep-2022 11:03                7659
function.imagecropauto.php                         30-Sep-2022 11:03               10586
function.imagedashedline.php                       30-Sep-2022 11:03                2726
function.imagedestroy.php                          30-Sep-2022 11:03                2116
function.imageellipse.php                          30-Sep-2022 11:03                8445
function.imagefill.php                             30-Sep-2022 11:03                4873
function.imagefilledarc.php                        30-Sep-2022 11:03               17576
function.imagefilledellipse.php                    30-Sep-2022 11:03                8557
function.imagefilledpolygon.php                    30-Sep-2022 11:03                7979
function.imagefilledrectangle.php                  30-Sep-2022 11:03                2981
function.imagefilltoborder.php                     30-Sep-2022 11:03                2954
function.imagefilter.php                           30-Sep-2022 11:03               38655
function.imageflip.php                             30-Sep-2022 11:03                9331
function.imagefontheight.php                       30-Sep-2022 11:03                2104
function.imagefontwidth.php                        30-Sep-2022 11:03                2120
function.imageftbbox.php                           30-Sep-2022 11:03               13329
function.imagefttext.php                           30-Sep-2022 11:03               14597
function.imagegammacorrect.php                     30-Sep-2022 11:03                2331
function.imagegd.php                               30-Sep-2022 11:03                2723
function.imagegd2.php                              30-Sep-2022 11:03               10491
function.imagegetclip.php                          30-Sep-2022 11:03                5940
function.imagegetinterpolation.php                 30-Sep-2022 11:03                3572
function.imagegif.php                              30-Sep-2022 11:03               16316
function.imagegrabscreen.php                       30-Sep-2022 11:03                4649
function.imagegrabwindow.php                       30-Sep-2022 11:03                9638
function.imageinterlace.php                        30-Sep-2022 11:03                4934
function.imageistruecolor.php                      30-Sep-2022 11:03                6571
function.imagejpeg.php                             30-Sep-2022 11:03               14028
function.imagelayereffect.php                      30-Sep-2022 11:03               10566
function.imageline.php                             30-Sep-2022 11:03               13772
function.imageloadfont.php                         30-Sep-2022 11:03                6952
function.imageopenpolygon.php                      30-Sep-2022 11:03               10269
function.imagepalettecopy.php                      30-Sep-2022 11:03                2216
function.imagepalettetotruecolor.php               30-Sep-2022 11:03               10214
function.imagepng.php                              30-Sep-2022 11:03                3293
function.imagepolygon.php                          30-Sep-2022 11:03                6931
function.imagerectangle.php                        30-Sep-2022 11:03                2777
function.imageresolution.php                       30-Sep-2022 11:03                7215
function.imagerotate.php                           30-Sep-2022 11:03                7355
function.imagesavealpha.php                        30-Sep-2022 11:03                6189
function.imagescale.php                            30-Sep-2022 11:03                6095
function.imagesetbrush.php                         30-Sep-2022 11:03                3249
function.imagesetclip.php                          30-Sep-2022 11:03                4813
function.imagesetinterpolation.php                 30-Sep-2022 11:03               10183
function.imagesetpixel.php                         30-Sep-2022 11:03                2761
function.imagesetstyle.php                         30-Sep-2022 11:03               12091
function.imagesetthickness.php                     30-Sep-2022 11:03                7941
function.imagesettile.php                          30-Sep-2022 11:03                3043
function.imagestring.php                           30-Sep-2022 11:03                6187
function.imagestringup.php                         30-Sep-2022 11:03                3109
function.imagesx.php                               30-Sep-2022 11:03                3282
function.imagesy.php                               30-Sep-2022 11:03                3318
function.imagetruecolortopalette.php               30-Sep-2022 11:03                5912
function.imagettfbbox.php                          30-Sep-2022 11:03                4489
function.imagettftext.php                          30-Sep-2022 11:03               16156
function.imagetypes.php                            30-Sep-2022 11:03                2864
function.imagewbmp.php                             30-Sep-2022 11:03                3854
function.imagewebp.php                             30-Sep-2022 11:03                6778
function.imagexbm.php                              30-Sep-2022 11:03                9396
function.imap-8bit.php                             30-Sep-2022 11:03                2929
function.imap-alerts.php                           30-Sep-2022 11:03                3068
function.imap-append.php                           30-Sep-2022 11:03                9703
function.imap-base64.php                           30-Sep-2022 11:03                3351
function.imap-binary.php                           30-Sep-2022 11:03                2895
function.imap-body.php                             30-Sep-2022 11:03                5055
function.imap-bodystruct.php                       30-Sep-2022 11:03                4356
function.imap-check.php                            30-Sep-2022 11:03                5753
function.imap-clearflag-full.php                   30-Sep-2022 11:03                5319
function.imap-close.php                            30-Sep-2022 11:03                3951
function.imap-create.php                           30-Sep-2022 11:03                1710
function.imap-createmailbox.php                    30-Sep-2022 11:03               15420
function.imap-delete.php                           30-Sep-2022 11:03                9510
function.imap-deletemailbox.php                    30-Sep-2022 11:03                4615
function.imap-errors.php                           30-Sep-2022 11:03                3270
function.imap-expunge.php                          30-Sep-2022 11:03                3331
function.imap-fetch-overview.php                   30-Sep-2022 11:03               11076
function.imap-fetchbody.php                        30-Sep-2022 11:03                5623
function.imap-fetchheader.php                      30-Sep-2022 11:03                5307
function.imap-fetchmime.php                        30-Sep-2022 11:03                5827
function.imap-fetchstructure.php                   30-Sep-2022 11:03                9020
function.imap-fetchtext.php                        30-Sep-2022 11:03                1691
function.imap-gc.php                               30-Sep-2022 11:03                4734
function.imap-get-quota.php                        30-Sep-2022 11:03               12509
function.imap-get-quotaroot.php                    30-Sep-2022 11:03                9254
function.imap-getacl.php                           30-Sep-2022 11:03                5534
function.imap-getmailboxes.php                     30-Sep-2022 11:03               11796
function.imap-getsubscribed.php                    30-Sep-2022 11:03                7035
function.imap-header.php                           30-Sep-2022 11:03                1919
function.imap-headerinfo.php                       30-Sep-2022 11:03               11362
function.imap-headers.php                          30-Sep-2022 11:03                3199
function.imap-last-error.php                       30-Sep-2022 11:03                2982
function.imap-list.php                             30-Sep-2022 11:03                8540
function.imap-listmailbox.php                      30-Sep-2022 11:03                1696
function.imap-listscan.php                         30-Sep-2022 11:03                6466
function.imap-listsubscribed.php                   30-Sep-2022 11:03                1717
function.imap-lsub.php                             30-Sep-2022 11:03                5569
function.imap-mail-compose.php                     30-Sep-2022 11:03               14653
function.imap-mail-copy.php                        30-Sep-2022 11:03                5704
function.imap-mail-move.php                        30-Sep-2022 11:03                6154
function.imap-mail.php                             30-Sep-2022 11:03                6492
function.imap-mailboxmsginfo.php                   30-Sep-2022 11:03                9956
function.imap-mime-header-decode.php               30-Sep-2022 11:03                6332
function.imap-msgno.php                            30-Sep-2022 11:03                3915
function.imap-mutf7-to-utf8.php                    30-Sep-2022 11:03                3119
function.imap-num-msg.php                          30-Sep-2022 11:03                3763
function.imap-num-recent.php                       30-Sep-2022 11:03                3648
function.imap-open.php                             30-Sep-2022 11:03               21909
function.imap-ping.php                             30-Sep-2022 11:03                4684
function.imap-qprint.php                           30-Sep-2022 11:03                2941
function.imap-rename.php                           30-Sep-2022 11:03                1713
function.imap-renamemailbox.php                    30-Sep-2022 11:03                5201
function.imap-reopen.php                           30-Sep-2022 11:03                8110
function.imap-rfc822-parse-adrlist.php             30-Sep-2022 11:03                8100
function.imap-rfc822-parse-headers.php             30-Sep-2022 11:03                3550
function.imap-rfc822-write-address.php             30-Sep-2022 11:03                5050
function.imap-savebody.php                         30-Sep-2022 11:03                5794
function.imap-scan.php                             30-Sep-2022 11:03                1678
function.imap-scanmailbox.php                      30-Sep-2022 11:03                1708
function.imap-search.php                           30-Sep-2022 11:03               13119
function.imap-set-quota.php                        30-Sep-2022 11:03                6451
function.imap-setacl.php                           30-Sep-2022 11:03                5030
function.imap-setflag-full.php                     30-Sep-2022 11:03                7618
function.imap-sort.php                             30-Sep-2022 11:03                7271
function.imap-status.php                           30-Sep-2022 11:03               10609
function.imap-subscribe.php                        30-Sep-2022 11:03                4093
function.imap-thread.php                           30-Sep-2022 11:03                7809
function.imap-timeout.php                          30-Sep-2022 11:03                4217
function.imap-uid.php                              30-Sep-2022 11:03                4302
function.imap-undelete.php                         30-Sep-2022 11:03                4634
function.imap-unsubscribe.php                      30-Sep-2022 11:03                4170
function.imap-utf7-decode.php                      30-Sep-2022 11:03                3518
function.imap-utf7-encode.php                      30-Sep-2022 11:03                3113
function.imap-utf8-to-mutf7.php                    30-Sep-2022 11:03                3122
function.imap-utf8.php                             30-Sep-2022 11:03                4050
function.implode.php                               30-Sep-2022 11:03                7377
function.in-array.php                              30-Sep-2022 11:03               11703
function.include-once.php                          30-Sep-2022 11:03                2025
function.include.php                               30-Sep-2022 11:03               20116
function.inet-ntop.php                             30-Sep-2022 11:03                6203
function.inet-pton.php                             30-Sep-2022 11:03                4660
function.inflate-add.php                           30-Sep-2022 11:03                5349
function.inflate-get-read-len.php                  30-Sep-2022 11:03                3198
function.inflate-get-status.php                    30-Sep-2022 11:03                3137
function.inflate-init.php                          30-Sep-2022 11:03                6398
function.ini-alter.php                             30-Sep-2022 11:03                1646
function.ini-get-all.php                           30-Sep-2022 11:03                9583
function.ini-get.php                               30-Sep-2022 11:03               11199
function.ini-restore.php                           30-Sep-2022 11:03                6384
function.ini-set.php                               30-Sep-2022 11:03                5230
function.inotify-add-watch.php                     30-Sep-2022 11:03                3876
function.inotify-init.php                          30-Sep-2022 11:03                9249
function.inotify-queue-len.php                     30-Sep-2022 11:03                3695
function.inotify-read.php                          30-Sep-2022 11:03                4316
function.inotify-rm-watch.php                      30-Sep-2022 11:03                3365
function.intdiv.php                                30-Sep-2022 11:03                6630
function.interface-exists.php                      30-Sep-2022 11:03                5136
function.intl-error-name.php                       30-Sep-2022 11:03                4994
function.intl-get-error-code.php                   30-Sep-2022 11:03                4552
function.intl-get-error-message.php                30-Sep-2022 11:03                4551
function.intl-is-failure.php                       30-Sep-2022 11:03                5445
function.intval.php                                30-Sep-2022 11:03               13674
function.ip2long.php                               30-Sep-2022 11:03               10155
function.iptcembed.php                             30-Sep-2022 11:03               13685
function.iptcparse.php                             30-Sep-2022 11:03                4423
function.is-a.php                                  30-Sep-2022 11:03                6548
function.is-array.php                              30-Sep-2022 11:03                5550
function.is-bool.php                               30-Sep-2022 11:03                5488
function.is-callable.php                           30-Sep-2022 11:03                8072
function.is-countable.php                          30-Sep-2022 11:03                6224
function.is-dir.php                                30-Sep-2022 11:03                6230
function.is-double.php                             30-Sep-2022 11:03                1672
function.is-executable.php                         30-Sep-2022 11:03                5904
function.is-file.php                               30-Sep-2022 11:03                5571
function.is-finite.php                             30-Sep-2022 11:03                2985
function.is-float.php                              30-Sep-2022 11:03                3102
function.is-infinite.php                           30-Sep-2022 11:03                3107
function.is-int.php                                30-Sep-2022 11:03                6509
function.is-integer.php                            30-Sep-2022 11:03                1665
function.is-iterable.php                           30-Sep-2022 11:03                5741
function.is-link.php                               30-Sep-2022 11:03                5449
function.is-long.php                               30-Sep-2022 11:03                1646
function.is-nan.php                                30-Sep-2022 11:03                4446
function.is-null.php                               30-Sep-2022 11:03                3357
function.is-numeric.php                            30-Sep-2022 11:03               12633
function.is-object.php                             30-Sep-2022 11:03                2652
function.is-readable.php                           30-Sep-2022 11:03                6064
function.is-real.php                               30-Sep-2022 11:03                1674
function.is-resource.php                           30-Sep-2022 11:03                2275
function.is-scalar.php                             30-Sep-2022 11:03                7660
function.is-soap-fault.php                         30-Sep-2022 11:03                8220
function.is-string.php                             30-Sep-2022 11:03                2731
function.is-subclass-of.php                        30-Sep-2022 11:03               12723
function.is-tainted.php                            30-Sep-2022 11:03                2203
function.is-uploaded-file.php                      30-Sep-2022 11:03                6554
function.is-writable.php                           30-Sep-2022 11:03                5665
function.is-writeable.php                          30-Sep-2022 11:03                1691
function.isset.php                                 30-Sep-2022 11:03               16420
function.iterator-apply.php                        30-Sep-2022 11:03                6037
function.iterator-count.php                        30-Sep-2022 11:03                3976
function.iterator-to-array.php                     30-Sep-2022 11:03                5622
function.jddayofweek.php                           30-Sep-2022 11:03                3403
function.jdmonthname.php                           30-Sep-2022 11:03                4039
function.jdtofrench.php                            30-Sep-2022 11:03                2961
function.jdtogregorian.php                         30-Sep-2022 11:03                2956
function.jdtojewish.php                            30-Sep-2022 11:03                5894
function.jdtojulian.php                            30-Sep-2022 11:03                2943
function.jdtounix.php                              30-Sep-2022 11:03                2968
function.jewishtojd.php                            30-Sep-2022 11:03                3596
function.join.php                                  30-Sep-2022 11:03                1603
function.jpeg2wbmp.php                             30-Sep-2022 11:03                5927
function.json-decode.php                           30-Sep-2022 11:03               19815
function.json-encode.php                           30-Sep-2022 11:03               29724
function.json-last-error-msg.php                   30-Sep-2022 11:03                2918
function.json-last-error.php                       30-Sep-2022 11:03               14440
function.juliantojd.php                            30-Sep-2022 11:03                4083
function.key-exists.php                            30-Sep-2022 11:03                1677
function.key.php                                   30-Sep-2022 11:03                7201
function.krsort.php                                30-Sep-2022 11:03                7463
function.ksort.php                                 30-Sep-2022 11:03                9402
function.lcfirst.php                               30-Sep-2022 11:03                5430
function.lcg-value.php                             30-Sep-2022 11:03                2541
function.lchgrp.php                                30-Sep-2022 11:03                5618
function.lchown.php                                30-Sep-2022 11:03                5516
function.ldap-8859-to-t61.php                      30-Sep-2022 11:03                3151
function.ldap-add-ext.php                          30-Sep-2022 11:03                5383
function.ldap-add.php                              30-Sep-2022 11:03               10487
function.ldap-bind-ext.php                         30-Sep-2022 11:03                5400
function.ldap-bind.php                             30-Sep-2022 11:03                8672
function.ldap-close.php                            30-Sep-2022 11:03                1661
function.ldap-compare.php                          30-Sep-2022 11:03               10821
function.ldap-connect.php                          30-Sep-2022 11:03                9547
function.ldap-control-paged-result-response.php    30-Sep-2022 11:03                5521
function.ldap-control-paged-result.php             30-Sep-2022 11:03               15650
function.ldap-count-entries.php                    30-Sep-2022 11:03                5802
function.ldap-count-references.php                 30-Sep-2022 11:03                4589
function.ldap-delete-ext.php                       30-Sep-2022 11:03                4971
function.ldap-delete.php                           30-Sep-2022 11:03                4914
function.ldap-dn2ufn.php                           30-Sep-2022 11:03                2526
function.ldap-err2str.php                          30-Sep-2022 11:03                4602
function.ldap-errno.php                            30-Sep-2022 11:03                7768
function.ldap-error.php                            30-Sep-2022 11:03                4398
function.ldap-escape.php                           30-Sep-2022 11:03                6321
function.ldap-exop-passwd.php                      30-Sep-2022 11:03               10615
function.ldap-exop-refresh.php                     30-Sep-2022 11:03                4847
function.ldap-exop-whoami.php                      30-Sep-2022 11:03                3731
function.ldap-exop.php                             30-Sep-2022 11:03               12426
function.ldap-explode-dn.php                       30-Sep-2022 11:03                3380
function.ldap-first-attribute.php                  30-Sep-2022 11:03                5919
function.ldap-first-entry.php                      30-Sep-2022 11:03                5680
function.ldap-first-reference.php                  30-Sep-2022 11:03                2312
function.ldap-free-result.php                      30-Sep-2022 11:03                3891
function.ldap-get-attributes.php                   30-Sep-2022 11:03                8463
function.ldap-get-dn.php                           30-Sep-2022 11:03                4093
function.ldap-get-entries.php                      30-Sep-2022 11:03                5913
function.ldap-get-option.php                       30-Sep-2022 11:03               12656
function.ldap-get-values-len.php                   30-Sep-2022 11:03                5251
function.ldap-get-values.php                       30-Sep-2022 11:03                8805
function.ldap-list.php                             30-Sep-2022 11:03               14386
function.ldap-mod-add.php                          30-Sep-2022 11:03                6389
function.ldap-mod-del.php                          30-Sep-2022 11:03                5938
function.ldap-mod-replace.php                      30-Sep-2022 11:03                6334
function.ldap-mod_add-ext.php                      30-Sep-2022 11:03                5382
function.ldap-mod_del-ext.php                      30-Sep-2022 11:03                5398
function.ldap-mod_replace-ext.php                  30-Sep-2022 11:03                5460
function.ldap-modify-batch.php                     30-Sep-2022 11:03               20636
function.ldap-modify.php                           30-Sep-2022 11:03                2076
function.ldap-next-attribute.php                   30-Sep-2022 11:03                5379
function.ldap-next-entry.php                       30-Sep-2022 11:03                5717
function.ldap-next-reference.php                   30-Sep-2022 11:03                2282
function.ldap-parse-exop.php                       30-Sep-2022 11:03                5512
function.ldap-parse-reference.php                  30-Sep-2022 11:03                2290
function.ldap-parse-result.php                     30-Sep-2022 11:03                9184
function.ldap-read.php                             30-Sep-2022 11:03               11508
function.ldap-rename-ext.php                       30-Sep-2022 11:03                5611
function.ldap-rename.php                           30-Sep-2022 11:03                6589
function.ldap-sasl-bind.php                        30-Sep-2022 11:03                5819
function.ldap-search.php                           30-Sep-2022 11:03               14599
function.ldap-set-option.php                       30-Sep-2022 11:03               15602
function.ldap-set-rebind-proc.php                  30-Sep-2022 11:03                3033
function.ldap-sort.php                             30-Sep-2022 11:03                7380
function.ldap-start-tls.php                        30-Sep-2022 11:03                1919
function.ldap-t61-to-8859.php                      30-Sep-2022 11:03                1984
function.ldap-unbind.php                           30-Sep-2022 11:03                3616
function.levenshtein.php                           30-Sep-2022 11:03               12215
function.libxml-clear-errors.php                   30-Sep-2022 11:03                2790
function.libxml-disable-entity-loader.php          30-Sep-2022 11:03                4566
function.libxml-get-errors.php                     30-Sep-2022 11:03               11916
function.libxml-get-last-error.php                 30-Sep-2022 11:03                3081
function.libxml-set-external-entity-loader.php     30-Sep-2022 11:03                9915
function.libxml-set-streams-context.php            30-Sep-2022 11:03                5120
function.libxml-use-internal-errors.php            30-Sep-2022 11:03                6480
function.link.php                                  30-Sep-2022 11:03                5779
function.linkinfo.php                              30-Sep-2022 11:03                4659
function.list.php                                  30-Sep-2022 11:03               17215
function.localeconv.php                            30-Sep-2022 11:03                9150
function.localtime.php                             30-Sep-2022 11:03                8535
function.log.php                                   30-Sep-2022 11:03                4328
function.log10.php                                 30-Sep-2022 11:03                2576
function.log1p.php                                 30-Sep-2022 11:03                3783
function.long2ip.php                               30-Sep-2022 11:03                3856
function.lstat.php                                 30-Sep-2022 11:03                5942
function.ltrim.php                                 30-Sep-2022 11:03                9465
function.lzf-compress.php                          30-Sep-2022 11:03                2767
function.lzf-decompress.php                        30-Sep-2022 11:03                2859
function.lzf-optimized-for.php                     30-Sep-2022 11:03                2134
function.mail.php                                  30-Sep-2022 11:03               22571
function.mailparse-determine-best-xfer-encoding..> 30-Sep-2022 11:03                4132
function.mailparse-msg-create.php                  30-Sep-2022 11:03                3295
function.mailparse-msg-extract-part-file.php       30-Sep-2022 11:03                5012
function.mailparse-msg-extract-part.php            30-Sep-2022 11:03                3930
function.mailparse-msg-extract-whole-part-file.php 30-Sep-2022 11:03                3925
function.mailparse-msg-free.php                    30-Sep-2022 11:03                3412
function.mailparse-msg-get-part-data.php           30-Sep-2022 11:03                2399
function.mailparse-msg-get-part.php                30-Sep-2022 11:03                2620
function.mailparse-msg-get-structure.php           30-Sep-2022 11:03                2419
function.mailparse-msg-parse-file.php              30-Sep-2022 11:03                4072
function.mailparse-msg-parse.php                   30-Sep-2022 11:03                3249
function.mailparse-rfc822-parse-addresses.php      30-Sep-2022 11:03                5427
function.mailparse-stream-encode.php               30-Sep-2022 11:03                5622
function.mailparse-uudecode-all.php                30-Sep-2022 11:03                6845
function.max.php                                   30-Sep-2022 11:03               11868
function.mb-check-encoding.php                     30-Sep-2022 11:03                3081
function.mb-chr.php                                30-Sep-2022 11:03                6705
function.mb-convert-case.php                       30-Sep-2022 11:03                9847
function.mb-convert-encoding.php                   30-Sep-2022 11:03                9296
function.mb-convert-kana.php                       30-Sep-2022 11:03                9076
function.mb-convert-variables.php                  30-Sep-2022 11:03                6209
function.mb-decode-mimeheader.php                  30-Sep-2022 11:03                3001
function.mb-decode-numericentity.php               30-Sep-2022 11:03               35478
function.mb-detect-encoding.php                    30-Sep-2022 11:03                6806
function.mb-detect-order.php                       30-Sep-2022 11:03                8032
function.mb-encode-mimeheader.php                  30-Sep-2022 11:03                9281
function.mb-encode-numericentity.php               30-Sep-2022 11:03               13067
function.mb-encoding-aliases.php                   30-Sep-2022 11:03                5590
function.mb-ereg-match.php                         30-Sep-2022 11:03                5113
function.mb-ereg-replace-callback.php              30-Sep-2022 11:03               12809
function.mb-ereg-replace.php                       30-Sep-2022 11:03                6480
function.mb-ereg-search-getpos.php                 30-Sep-2022 11:03                3774
function.mb-ereg-search-getregs.php                30-Sep-2022 11:03                4117
function.mb-ereg-search-init.php                   30-Sep-2022 11:03                5626
function.mb-ereg-search-pos.php                    30-Sep-2022 11:03                5511
function.mb-ereg-search-regs.php                   30-Sep-2022 11:03                5263
function.mb-ereg-search-setpos.php                 30-Sep-2022 11:03                4302
function.mb-ereg-search.php                        30-Sep-2022 11:03                5176
function.mb-ereg.php                               30-Sep-2022 11:03                6011
function.mb-eregi-replace.php                      30-Sep-2022 11:03                6364
function.mb-eregi.php                              30-Sep-2022 11:03                6055
function.mb-get-info.php                           30-Sep-2022 11:03                5757
function.mb-http-input.php                         30-Sep-2022 11:03                3773
function.mb-http-output.php                        30-Sep-2022 11:03                4031
function.mb-internal-encoding.php                  30-Sep-2022 11:03                5197
function.mb-language.php                           30-Sep-2022 11:03                3685
function.mb-list-encodings.php                     30-Sep-2022 11:03                4921
function.mb-ord.php                                30-Sep-2022 11:03                6364
function.mb-output-handler.php                     30-Sep-2022 11:03                6308
function.mb-parse-str.php                          30-Sep-2022 11:03                3742
function.mb-preferred-mime-name.php                30-Sep-2022 11:03                4012
function.mb-regex-encoding.php                     30-Sep-2022 11:03                4170
function.mb-regex-set-options.php                  30-Sep-2022 11:03                6897
function.mb-scrub.php                              30-Sep-2022 11:03                3095
function.mb-send-mail.php                          30-Sep-2022 11:03                8046
function.mb-split.php                              30-Sep-2022 11:03                4131
function.mb-str-split.php                          30-Sep-2022 11:03                4758
function.mb-strcut.php                             30-Sep-2022 11:03                6244
function.mb-strimwidth.php                         30-Sep-2022 11:03                6464
function.mb-stripos.php                            30-Sep-2022 11:03                5508
function.mb-stristr.php                            30-Sep-2022 11:03                5423
function.mb-strlen.php                             30-Sep-2022 11:03                4144
function.mb-strpos.php                             30-Sep-2022 11:03                5326
function.mb-strrchr.php                            30-Sep-2022 11:03                5208
function.mb-strrichr.php                           30-Sep-2022 11:03                5286
function.mb-strripos.php                           30-Sep-2022 11:03                5172
function.mb-strrpos.php                            30-Sep-2022 11:03                6109
function.mb-strstr.php                             30-Sep-2022 11:03                5179
function.mb-strtolower.php                         30-Sep-2022 11:03                6922
function.mb-strtoupper.php                         30-Sep-2022 11:03                6890
function.mb-strwidth.php                           30-Sep-2022 11:03                4190
function.mb-substitute-character.php               30-Sep-2022 11:03                5934
function.mb-substr-count.php                       30-Sep-2022 11:03                5157
function.mb-substr.php                             30-Sep-2022 11:03                5961
function.mcrypt-create-iv.php                      30-Sep-2022 11:03                7546
function.mcrypt-decrypt.php                        30-Sep-2022 11:03                6134
function.mcrypt-enc-get-algorithms-name.php        30-Sep-2022 11:03                5194
function.mcrypt-enc-get-block-size.php             30-Sep-2022 11:03                2853
function.mcrypt-enc-get-iv-size.php                30-Sep-2022 11:03                2934
function.mcrypt-enc-get-key-size.php               30-Sep-2022 11:03                2826
function.mcrypt-enc-get-modes-name.php             30-Sep-2022 11:03                5063
function.mcrypt-enc-get-supported-key-sizes.php    30-Sep-2022 11:03                4792
function.mcrypt-enc-is-block-algorithm-mode.php    30-Sep-2022 11:03                3172
function.mcrypt-enc-is-block-algorithm.php         30-Sep-2022 11:03                2954
function.mcrypt-enc-is-block-mode.php              30-Sep-2022 11:03                3094
function.mcrypt-enc-self-test.php                  30-Sep-2022 11:03                2814
function.mcrypt-encrypt.php                        30-Sep-2022 11:03               15621
function.mcrypt-generic-deinit.php                 30-Sep-2022 11:03                3734
function.mcrypt-generic-init.php                   30-Sep-2022 11:03                4848
function.mcrypt-generic.php                        30-Sep-2022 11:03                5556
function.mcrypt-get-block-size.php                 30-Sep-2022 11:03                6008
function.mcrypt-get-cipher-name.php                30-Sep-2022 11:03                4643
function.mcrypt-get-iv-size.php                    30-Sep-2022 11:03                6163
function.mcrypt-get-key-size.php                   30-Sep-2022 11:03                6126
function.mcrypt-list-algorithms.php                30-Sep-2022 11:03                4523
function.mcrypt-list-modes.php                     30-Sep-2022 11:03                4522
function.mcrypt-module-close.php                   30-Sep-2022 11:03                3139
function.mcrypt-module-get-algo-block-size.php     30-Sep-2022 11:03                3276
function.mcrypt-module-get-algo-key-size.php       30-Sep-2022 11:03                3306
function.mcrypt-module-get-supported-key-sizes.php 30-Sep-2022 11:03                4258
function.mcrypt-module-is-block-algorithm-mode.php 30-Sep-2022 11:03                3771
function.mcrypt-module-is-block-algorithm.php      30-Sep-2022 11:03                3502
function.mcrypt-module-is-block-mode.php           30-Sep-2022 11:03                4017
function.mcrypt-module-open.php                    30-Sep-2022 11:03               14352
function.mcrypt-module-self-test.php               30-Sep-2022 11:03                4594
function.md5-file.php                              30-Sep-2022 11:03                4915
function.md5.php                                   30-Sep-2022 11:03                5768
function.mdecrypt-generic.php                      30-Sep-2022 11:03               11428
function.memcache-debug.php                        30-Sep-2022 11:03                3140
function.memory-get-peak-usage.php                 30-Sep-2022 11:03                3888
function.memory-get-usage.php                      30-Sep-2022 11:03                6004
function.memory-reset-peak-usage.php               30-Sep-2022 11:03                4892
function.metaphone.php                             30-Sep-2022 11:03                7958
function.method-exists.php                         30-Sep-2022 11:03                6179
function.mhash-count.php                           30-Sep-2022 11:03                4685
function.mhash-get-block-size.php                  30-Sep-2022 11:03                4346
function.mhash-get-hash-name.php                   30-Sep-2022 11:03                4299
function.mhash-keygen-s2k.php                      30-Sep-2022 11:03                5291
function.mhash.php                                 30-Sep-2022 11:03                4414
function.microtime.php                             30-Sep-2022 11:03                7505
function.mime-content-type.php                     30-Sep-2022 11:03                4545
function.min.php                                   30-Sep-2022 11:03                9442
function.mkdir.php                                 30-Sep-2022 11:03                7318
function.mktime.php                                30-Sep-2022 11:03               17498
function.money-format.php                          30-Sep-2022 11:03               16600
function.mongodb.bson-fromjson.php                 30-Sep-2022 11:03                5804
function.mongodb.bson-fromphp.php                  30-Sep-2022 11:03                5790
function.mongodb.bson-tocanonicalextendedjson.php  30-Sep-2022 11:03               16190
function.mongodb.bson-tojson.php                   30-Sep-2022 11:03               17677
function.mongodb.bson-tophp.php                    30-Sep-2022 11:03                8691
function.mongodb.bson-torelaxedextendedjson.php    30-Sep-2022 11:03               15889
function.mongodb.driver.monitoring.addsubscribe..> 30-Sep-2022 11:03                5086
function.mongodb.driver.monitoring.removesubscr..> 30-Sep-2022 11:03                4946
function.move-uploaded-file.php                    30-Sep-2022 11:03                8045
function.mqseries-back.php                         30-Sep-2022 11:03                6424
function.mqseries-begin.php                        30-Sep-2022 11:03                7901
function.mqseries-close.php                        30-Sep-2022 11:03                6508
function.mqseries-cmit.php                         30-Sep-2022 11:03                6374
function.mqseries-conn.php                         30-Sep-2022 11:03                5896
function.mqseries-connx.php                        30-Sep-2022 11:03               14328
function.mqseries-disc.php                         30-Sep-2022 11:03                5624
function.mqseries-get.php                          30-Sep-2022 11:03               13110
function.mqseries-inq.php                          30-Sep-2022 11:03                9149
function.mqseries-open.php                         30-Sep-2022 11:03                7620
function.mqseries-put.php                          30-Sep-2022 11:03               14087
function.mqseries-put1.php                         30-Sep-2022 11:03                5884
function.mqseries-set.php                          30-Sep-2022 11:03                5621
function.mqseries-strerror.php                     30-Sep-2022 11:03                4274
function.msg-get-queue.php                         30-Sep-2022 11:03                5433
function.msg-queue-exists.php                      30-Sep-2022 11:03                3209
function.msg-receive.php                           30-Sep-2022 11:03               10488
function.msg-remove-queue.php                      30-Sep-2022 11:03                4407
function.msg-send.php                              30-Sep-2022 11:03                8272
function.msg-set-queue.php                         30-Sep-2022 11:03                5011
function.msg-stat-queue.php                        30-Sep-2022 11:03                6464
function.mt-getrandmax.php                         30-Sep-2022 11:03                4976
function.mt-rand.php                               30-Sep-2022 11:03                7026
function.mt-srand.php                              30-Sep-2022 11:03                6291
function.mysql-affected-rows.php                   30-Sep-2022 11:03               11890
function.mysql-client-encoding.php                 30-Sep-2022 11:03                6124
function.mysql-close.php                           30-Sep-2022 11:03                6693
function.mysql-connect.php                         30-Sep-2022 11:03               16901
function.mysql-create-db.php                       30-Sep-2022 11:03                8013
function.mysql-data-seek.php                       30-Sep-2022 11:03               11882
function.mysql-db-name.php                         30-Sep-2022 11:03                8231
function.mysql-db-query.php                        30-Sep-2022 11:03                3989
function.mysql-drop-db.php                         30-Sep-2022 11:03                8372
function.mysql-errno.php                           30-Sep-2022 11:03                5441
function.mysql-error.php                           30-Sep-2022 11:03                5316
function.mysql-escape-string.php                   30-Sep-2022 11:03                4785
function.mysql-fetch-array.php                     30-Sep-2022 11:03                8162
function.mysql-fetch-assoc.php                     30-Sep-2022 11:03               11749
function.mysql-fetch-field.php                     30-Sep-2022 11:03               20372
function.mysql-fetch-lengths.php                   30-Sep-2022 11:03                2808
function.mysql-fetch-object.php                    30-Sep-2022 11:03               11255
function.mysql-fetch-row.php                       30-Sep-2022 11:03                7887
function.mysql-field-flags.php                     30-Sep-2022 11:03                2777
function.mysql-field-len.php                       30-Sep-2022 11:03                2191
function.mysql-field-name.php                      30-Sep-2022 11:03               11923
function.mysql-field-seek.php                      30-Sep-2022 11:03                2451
function.mysql-field-table.php                     30-Sep-2022 11:03                2163
function.mysql-field-type.php                      30-Sep-2022 11:03               17809
function.mysql-free-result.php                     30-Sep-2022 11:03                6928
function.mysql-get-client-info.php                 30-Sep-2022 11:03                3247
function.mysql-get-host-info.php                   30-Sep-2022 11:03                4278
function.mysql-get-proto-info.php                  30-Sep-2022 11:03                4227
function.mysql-get-server-info.php                 30-Sep-2022 11:03                4246
function.mysql-info.php                            30-Sep-2022 11:03                3708
function.mysql-insert-id.php                       30-Sep-2022 11:03                5594
function.mysql-list-dbs.php                        30-Sep-2022 11:03                4977
function.mysql-list-fields.php                     30-Sep-2022 11:03                6037
function.mysql-list-processes.php                  30-Sep-2022 11:03                5235
function.mysql-list-tables.php                     30-Sep-2022 11:03                9281
function.mysql-num-fields.php                      30-Sep-2022 11:03                2567
function.mysql-num-rows.php                        30-Sep-2022 11:03                5275
function.mysql-pconnect.php                        30-Sep-2022 11:03                8019
function.mysql-ping.php                            30-Sep-2022 11:03                2597
function.mysql-query.php                           30-Sep-2022 11:03               13760
function.mysql-real-escape-string.php              30-Sep-2022 11:03               16197
function.mysql-result.php                          30-Sep-2022 11:03                5623
function.mysql-select-db.php                       30-Sep-2022 11:03                9419
function.mysql-set-charset.php                     30-Sep-2022 11:03                5485
function.mysql-stat.php                            30-Sep-2022 11:03                4183
function.mysql-tablename.php                       30-Sep-2022 11:03                8449
function.mysql-thread-id.php                       30-Sep-2022 11:03                4271
function.mysql-unbuffered-query.php                30-Sep-2022 11:03                3572
function.mysql-xdevapi-expression.php              30-Sep-2022 11:03                4702
function.mysql-xdevapi-getsession.php              30-Sep-2022 11:03               13158
function.mysqli-connect.php                        30-Sep-2022 11:03                5334
function.mysqli-escape-string.php                  30-Sep-2022 11:03                1796
function.mysqli-execute.php                        30-Sep-2022 11:03                2508
function.mysqli-get-client-stats.php               30-Sep-2022 11:03                8173
function.mysqli-get-links-stats.php                30-Sep-2022 11:03                3009
function.mysqli-report.php                         30-Sep-2022 11:03                1702
function.mysqli-set-opt.php                        30-Sep-2022 11:03                1829
function.natcasesort.php                           30-Sep-2022 11:03                6959
function.natsort.php                               30-Sep-2022 11:03               10161
function.net-get-interfaces.php                    30-Sep-2022 11:03                4312
function.next.php                                  30-Sep-2022 11:03                8617
function.ngettext.php                              30-Sep-2022 11:03                5638
function.nl-langinfo.php                           30-Sep-2022 11:03               14849
function.nl2br.php                                 30-Sep-2022 11:03                6986
function.number-format.php                         30-Sep-2022 11:03                9642
function.oauth-get-sbs.php                         30-Sep-2022 11:03                2874
function.oauth-urlencode.php                       30-Sep-2022 11:03                2478
function.ob-clean.php                              30-Sep-2022 11:03                3226
function.ob-end-clean.php                          30-Sep-2022 11:03                4888
function.ob-end-flush.php                          30-Sep-2022 11:03                5726
function.ob-flush.php                              30-Sep-2022 11:03                3437
function.ob-get-clean.php                          30-Sep-2022 11:03                4465
function.ob-get-contents.php                       30-Sep-2022 11:03                4344
function.ob-get-flush.php                          30-Sep-2022 11:03                5044
function.ob-get-length.php                         30-Sep-2022 11:03                4302
function.ob-get-level.php                          30-Sep-2022 11:03                2533
function.ob-get-status.php                         30-Sep-2022 11:03                6837
function.ob-gzhandler.php                          30-Sep-2022 11:03                6222
function.ob-iconv-handler.php                      30-Sep-2022 11:03                4899
function.ob-implicit-flush.php                     30-Sep-2022 11:03                3506
function.ob-list-handlers.php                      30-Sep-2022 11:03                5780
function.ob-start.php                              30-Sep-2022 11:03               17111
function.ob-tidyhandler.php                        30-Sep-2022 11:03                4171
function.oci-bind-array-by-name.php                30-Sep-2022 11:03               13808
function.oci-bind-by-name.php                      30-Sep-2022 11:03              105992
function.oci-cancel.php                            30-Sep-2022 11:03                2496
function.oci-client-version.php                    30-Sep-2022 11:03                3942
function.oci-close.php                             30-Sep-2022 11:03               21039
function.oci-commit.php                            30-Sep-2022 11:03               16989
function.oci-connect.php                           30-Sep-2022 11:03               53446
function.oci-define-by-name.php                    30-Sep-2022 11:03                7131
function.oci-error.php                             30-Sep-2022 11:03                5408
function.oci-execute.php                           30-Sep-2022 11:03               23045
function.oci-fetch-all.php                         30-Sep-2022 11:03               33253
function.oci-fetch-array.php                       30-Sep-2022 11:03               71286
function.oci-fetch-assoc.php                       30-Sep-2022 11:03                8731
function.oci-fetch-object.php                      30-Sep-2022 11:03               19590
function.oci-fetch-row.php                         30-Sep-2022 11:03                8674
function.oci-fetch.php                             30-Sep-2022 11:03               14007
function.oci-field-is-null.php                     30-Sep-2022 11:03                2879
function.oci-field-name.php                        30-Sep-2022 11:03                8599
function.oci-field-precision.php                   30-Sep-2022 11:03                2953
function.oci-field-scale.php                       30-Sep-2022 11:03                3010
function.oci-field-size.php                        30-Sep-2022 11:03                8711
function.oci-field-type-raw.php                    30-Sep-2022 11:03                2915
function.oci-field-type.php                        30-Sep-2022 11:03                8825
function.oci-free-descriptor.php                   30-Sep-2022 11:03                3351
function.oci-free-statement.php                    30-Sep-2022 11:03                2750
function.oci-get-implicit-resultset.php            30-Sep-2022 11:03               32315
function.oci-internal-debug.php                    30-Sep-2022 11:03                3558
function.oci-lob-copy.php                          30-Sep-2022 11:03                4268
function.oci-lob-is-equal.php                      30-Sep-2022 11:03                3097
function.oci-new-collection.php                    30-Sep-2022 11:03                3135
function.oci-new-connect.php                       30-Sep-2022 11:03               36016
function.oci-new-cursor.php                        30-Sep-2022 11:03               12052
function.oci-new-descriptor.php                    30-Sep-2022 11:03               20878
function.oci-num-fields.php                        30-Sep-2022 11:03                7307
function.oci-num-rows.php                          30-Sep-2022 11:03                7477
function.oci-parse.php                             30-Sep-2022 11:03                3281
function.oci-password-change.php                   30-Sep-2022 11:03                7218
function.oci-pconnect.php                          30-Sep-2022 11:03               12465
function.oci-register-taf-callback.php             30-Sep-2022 11:03                5281
function.oci-result.php                            30-Sep-2022 11:03                6553
function.oci-rollback.php                          30-Sep-2022 11:03               15615
function.oci-server-version.php                    30-Sep-2022 11:03                3708
function.oci-set-action.php                        30-Sep-2022 11:03                8224
function.oci-set-call-timout.php                   30-Sep-2022 11:03                5682
function.oci-set-client-identifier.php             30-Sep-2022 11:03                8041
function.oci-set-client-info.php                   30-Sep-2022 11:03                8161
function.oci-set-db-operation.php                  30-Sep-2022 11:03                7630
function.oci-set-edition.php                       30-Sep-2022 11:03                9759
function.oci-set-module-name.php                   30-Sep-2022 11:03                8280
function.oci-set-prefetch-lob.php                  30-Sep-2022 11:03                8835
function.oci-set-prefetch.php                      30-Sep-2022 11:03               21311
function.oci-statement-type.php                    30-Sep-2022 11:03                5997
function.oci-unregister-taf-callback.php           30-Sep-2022 11:03                3396
function.ocibindbyname.php                         30-Sep-2022 11:03                1933
function.ocicancel.php                             30-Sep-2022 11:03                1875
function.ocicloselob.php                           30-Sep-2022 11:03                1874
function.ocicollappend.php                         30-Sep-2022 11:03                1939
function.ocicollassign.php                         30-Sep-2022 11:03                1944
function.ocicollassignelem.php                     30-Sep-2022 11:03                1989
function.ocicollgetelem.php                        30-Sep-2022 11:03                1956
function.ocicollmax.php                            30-Sep-2022 11:03                1908
function.ocicollsize.php                           30-Sep-2022 11:03                1911
function.ocicolltrim.php                           30-Sep-2022 11:03                1921
function.ocicolumnisnull.php                       30-Sep-2022 11:03                1945
function.ocicolumnname.php                         30-Sep-2022 11:03                1937
function.ocicolumnprecision.php                    30-Sep-2022 11:03                1980
function.ocicolumnscale.php                        30-Sep-2022 11:03                1944
function.ocicolumnsize.php                         30-Sep-2022 11:03                1925
function.ocicolumntype.php                         30-Sep-2022 11:03                1929
function.ocicolumntyperaw.php                      30-Sep-2022 11:03                1952
function.ocicommit.php                             30-Sep-2022 11:03                1889
function.ocidefinebyname.php                       30-Sep-2022 11:03                1935
function.ocierror.php                              30-Sep-2022 11:03                1866
function.ociexecute.php                            30-Sep-2022 11:03                1870
function.ocifetch.php                              30-Sep-2022 11:03                1860
function.ocifetchinto.php                          30-Sep-2022 11:03                2611
function.ocifetchstatement.php                     30-Sep-2022 11:03                1953
function.ocifreecollection.php                     30-Sep-2022 11:03                1971
function.ocifreecursor.php                         30-Sep-2022 11:03                1943
function.ocifreedesc.php                           30-Sep-2022 11:03                1887
function.ocifreestatement.php                      30-Sep-2022 11:03                1962
function.ociinternaldebug.php                      30-Sep-2022 11:03                1976
function.ociloadlob.php                            30-Sep-2022 11:03                1872
function.ocilogoff.php                             30-Sep-2022 11:03                1859
function.ocilogon.php                              30-Sep-2022 11:03                1874
function.ocinewcollection.php                      30-Sep-2022 11:03                1960
function.ocinewcursor.php                          30-Sep-2022 11:03                1928
function.ocinewdescriptor.php                      30-Sep-2022 11:03                1950
function.ocinlogon.php                             30-Sep-2022 11:03                1899
function.ocinumcols.php                            30-Sep-2022 11:03                1884
function.ociparse.php                              30-Sep-2022 11:03                1854
function.ociplogon.php                             30-Sep-2022 11:03                1869
function.ociresult.php                             30-Sep-2022 11:03                1867
function.ocirollback.php                           30-Sep-2022 11:03                1889
function.ocirowcount.php                           30-Sep-2022 11:03                1891
function.ocisavelob.php                            30-Sep-2022 11:03                1872
function.ocisavelobfile.php                        30-Sep-2022 11:03                1910
function.ociserverversion.php                      30-Sep-2022 11:03                1964
function.ocisetprefetch.php                        30-Sep-2022 11:03                1950
function.ocistatementtype.php                      30-Sep-2022 11:03                1970
function.ociwritelobtofile.php                     30-Sep-2022 11:03                1951
function.ociwritetemporarylob.php                  30-Sep-2022 11:03                1974
function.octdec.php                                30-Sep-2022 11:03                5031
function.odbc-autocommit.php                       30-Sep-2022 11:03                4041
function.odbc-binmode.php                          30-Sep-2022 11:03                6459
function.odbc-close-all.php                        30-Sep-2022 11:03                2505
function.odbc-close.php                            30-Sep-2022 11:03                2760
function.odbc-columnprivileges.php                 30-Sep-2022 11:03                8314
function.odbc-columns.php                          30-Sep-2022 11:03               11014
function.odbc-commit.php                           30-Sep-2022 11:03                2462
function.odbc-connect.php                          30-Sep-2022 11:03                8627
function.odbc-cursor.php                           30-Sep-2022 11:03                2439
function.odbc-data-source.php                      30-Sep-2022 11:03                5582
function.odbc-do.php                               30-Sep-2022 11:03                1640
function.odbc-error.php                            30-Sep-2022 11:03                3896
function.odbc-errormsg.php                         30-Sep-2022 11:03                3949
function.odbc-exec.php                             30-Sep-2022 11:03                3786
function.odbc-execute.php                          30-Sep-2022 11:03                6772
function.odbc-fetch-array.php                      30-Sep-2022 11:03                4040
function.odbc-fetch-into.php                       30-Sep-2022 11:03                4776
function.odbc-fetch-object.php                     30-Sep-2022 11:03                4082
function.odbc-fetch-row.php                        30-Sep-2022 11:03                4488
function.odbc-field-len.php                        30-Sep-2022 11:03                3194
function.odbc-field-name.php                       30-Sep-2022 11:03                2794
function.odbc-field-num.php                        30-Sep-2022 11:03                2814
function.odbc-field-precision.php                  30-Sep-2022 11:03                2179
function.odbc-field-scale.php                      30-Sep-2022 11:03                2811
function.odbc-field-type.php                       30-Sep-2022 11:03                2794
function.odbc-foreignkeys.php                      30-Sep-2022 11:03                8548
function.odbc-free-result.php                      30-Sep-2022 11:03                3180
function.odbc-gettypeinfo.php                      30-Sep-2022 11:03                4290
function.odbc-longreadlen.php                      30-Sep-2022 11:03                3702
function.odbc-next-result.php                      30-Sep-2022 11:03                8986
function.odbc-num-fields.php                       30-Sep-2022 11:03                2466
function.odbc-num-rows.php                         30-Sep-2022 11:03                3106
function.odbc-pconnect.php                         30-Sep-2022 11:03                4381
function.odbc-prepare.php                          30-Sep-2022 11:03                6182
function.odbc-primarykeys.php                      30-Sep-2022 11:03                7645
function.odbc-procedurecolumns.php                 30-Sep-2022 11:03               11226
function.odbc-procedures.php                       30-Sep-2022 11:03                9155
function.odbc-result-all.php                       30-Sep-2022 11:03                3912
function.odbc-result.php                           30-Sep-2022 11:03                5347
function.odbc-rollback.php                         30-Sep-2022 11:03                2481
function.odbc-setoption.php                        30-Sep-2022 11:03                7075
function.odbc-specialcolumns.php                   30-Sep-2022 11:03                6994
function.odbc-statistics.php                       30-Sep-2022 11:03                9430
function.odbc-tableprivileges.php                  30-Sep-2022 11:03                7976
function.odbc-tables.php                           30-Sep-2022 11:03               11991
function.opcache-compile-file.php                  30-Sep-2022 11:03                3553
function.opcache-get-configuration.php             30-Sep-2022 11:03                2851
function.opcache-get-status.php                    30-Sep-2022 11:03                3270
function.opcache-invalidate.php                    30-Sep-2022 11:03                3840
function.opcache-is-script-cached.php              30-Sep-2022 11:03                3189
function.opcache-reset.php                         30-Sep-2022 11:03                2778
function.openal-buffer-create.php                  30-Sep-2022 11:03                2729
function.openal-buffer-data.php                    30-Sep-2022 11:03                4362
function.openal-buffer-destroy.php                 30-Sep-2022 11:03                2949
function.openal-buffer-get.php                     30-Sep-2022 11:03                3506
function.openal-buffer-loadwav.php                 30-Sep-2022 11:03                3466
function.openal-context-create.php                 30-Sep-2022 11:03                3204
function.openal-context-current.php                30-Sep-2022 11:03                3004
function.openal-context-destroy.php                30-Sep-2022 11:03                2990
function.openal-context-process.php                30-Sep-2022 11:03                3408
function.openal-context-suspend.php                30-Sep-2022 11:03                3402
function.openal-device-close.php                   30-Sep-2022 11:03                2956
function.openal-device-open.php                    30-Sep-2022 11:03                3201
function.openal-listener-get.php                   30-Sep-2022 11:03                3121
function.openal-listener-set.php                   30-Sep-2022 11:03                3416
function.openal-source-create.php                  30-Sep-2022 11:03                2940
function.openal-source-destroy.php                 30-Sep-2022 11:03                2957
function.openal-source-get.php                     30-Sep-2022 11:03                4614
function.openal-source-pause.php                   30-Sep-2022 11:03                3288
function.openal-source-play.php                    30-Sep-2022 11:03                3287
function.openal-source-rewind.php                  30-Sep-2022 11:03                3297
function.openal-source-set.php                     30-Sep-2022 11:03                5140
function.openal-source-stop.php                    30-Sep-2022 11:03                3269
function.openal-stream.php                         30-Sep-2022 11:03                3880
function.opendir.php                               30-Sep-2022 11:03                7748
function.openlog.php                               30-Sep-2022 11:03                8344
function.openssl-cipher-iv-length.php              30-Sep-2022 11:03                4093
function.openssl-cipher-key-length.php             30-Sep-2022 11:03                4119
function.openssl-cms-decrypt.php                   30-Sep-2022 11:03                4544
function.openssl-cms-encrypt.php                   30-Sep-2022 11:03                5535
function.openssl-cms-read.php                      30-Sep-2022 11:03                2901
function.openssl-cms-sign.php                      30-Sep-2022 11:03                7211
function.openssl-cms-verify.php                    30-Sep-2022 11:03                6074
function.openssl-csr-export-to-file.php            30-Sep-2022 11:03                7249
function.openssl-csr-export.php                    30-Sep-2022 11:03                7021
function.openssl-csr-get-public-key.php            30-Sep-2022 11:03                7082
function.openssl-csr-get-subject.php               30-Sep-2022 11:03                8455
function.openssl-csr-new.php                       30-Sep-2022 11:03               19386
function.openssl-csr-sign.php                      30-Sep-2022 11:03               10072
function.openssl-decrypt.php                       30-Sep-2022 11:03                6416
function.openssl-dh-compute-key.php                30-Sep-2022 11:03                2802
function.openssl-digest.php                        30-Sep-2022 11:03                4169
function.openssl-encrypt.php                       30-Sep-2022 11:03               17799
function.openssl-error-string.php                  30-Sep-2022 11:03                3421
function.openssl-free-key.php                      30-Sep-2022 11:03                2514
function.openssl-get-cert-locations.php            30-Sep-2022 11:03                3862
function.openssl-get-cipher-methods.php            30-Sep-2022 11:03               14188
function.openssl-get-curve-names.php               30-Sep-2022 11:03                6765
function.openssl-get-md-methods.php                30-Sep-2022 11:03                6755
function.openssl-get-privatekey.php                30-Sep-2022 11:03                1865
function.openssl-get-publickey.php                 30-Sep-2022 11:03                1837
function.openssl-open.php                          30-Sep-2022 11:03                8844
function.openssl-pbkdf2.php                        30-Sep-2022 11:03                7093
function.openssl-pkcs12-export-to-file.php         30-Sep-2022 11:03                4985
function.openssl-pkcs12-export.php                 30-Sep-2022 11:03                4964
function.openssl-pkcs12-read.php                   30-Sep-2022 11:03                5300
function.openssl-pkcs7-decrypt.php                 30-Sep-2022 11:03                6105
function.openssl-pkcs7-encrypt.php                 30-Sep-2022 11:03                9195
function.openssl-pkcs7-read.php                    30-Sep-2022 11:03                6840
function.openssl-pkcs7-sign.php                    30-Sep-2022 11:03                9662
function.openssl-pkcs7-verify.php                  30-Sep-2022 11:03                6421
function.openssl-pkey-derive.php                   30-Sep-2022 11:03                7845
function.openssl-pkey-export-to-file.php           30-Sep-2022 11:03                4472
function.openssl-pkey-export.php                   30-Sep-2022 11:03                4386
function.openssl-pkey-free.php                     30-Sep-2022 11:03                2510
function.openssl-pkey-get-details.php              30-Sep-2022 11:03                8050
function.openssl-pkey-get-private.php              30-Sep-2022 11:03                3609
function.openssl-pkey-get-public.php               30-Sep-2022 11:03                3317
function.openssl-pkey-new.php                      30-Sep-2022 11:03                6732
function.openssl-private-decrypt.php               30-Sep-2022 11:03                5382
function.openssl-private-encrypt.php               30-Sep-2022 11:03                4735
function.openssl-public-decrypt.php                30-Sep-2022 11:03                4727
function.openssl-public-encrypt.php                30-Sep-2022 11:03                4942
function.openssl-random-pseudo-bytes.php           30-Sep-2022 11:03                7943
function.openssl-seal.php                          30-Sep-2022 11:03               10039
function.openssl-sign.php                          30-Sep-2022 11:03               12359
function.openssl-spki-export-challenge.php         30-Sep-2022 11:03                7300
function.openssl-spki-export.php                   30-Sep-2022 11:03                7906
function.openssl-spki-new.php                      30-Sep-2022 11:03                7488
function.openssl-spki-verify.php                   30-Sep-2022 11:03                7564
function.openssl-verify.php                        30-Sep-2022 11:03               12438
function.openssl-x509-check-private-key.php        30-Sep-2022 11:03                3713
function.openssl-x509-checkpurpose.php             30-Sep-2022 11:03                5599
function.openssl-x509-export-to-file.php           30-Sep-2022 11:03                3724
function.openssl-x509-export.php                   30-Sep-2022 11:03                3672
function.openssl-x509-fingerprint.php              30-Sep-2022 11:03                3973
function.openssl-x509-free.php                     30-Sep-2022 11:03                2499
function.openssl-x509-parse.php                    30-Sep-2022 11:03                3372
function.openssl-x509-read.php                     30-Sep-2022 11:03                2818
function.openssl-x509-verify.php                   30-Sep-2022 11:03               12821
function.ord.php                                   30-Sep-2022 11:03                6874
function.output-add-rewrite-var.php                30-Sep-2022 11:03                6511
function.output-reset-rewrite-vars.php             30-Sep-2022 11:03                5185
function.pack.php                                  30-Sep-2022 11:03               11806
function.parse-ini-file.php                        30-Sep-2022 11:03               12683
function.parse-ini-string.php                      30-Sep-2022 11:03                5464
function.parse-str.php                             30-Sep-2022 11:03               10142
function.parse-url.php                             30-Sep-2022 11:03               11311
function.passthru.php                              30-Sep-2022 11:03                5439
function.password-algos.php                        30-Sep-2022 11:03                3127
function.password-get-info.php                     30-Sep-2022 11:03                3306
function.password-hash.php                         30-Sep-2022 11:03               19913
function.password-needs-rehash.php                 30-Sep-2022 11:03                7446
function.password-verify.php                       30-Sep-2022 11:03                5591
function.pathinfo.php                              30-Sep-2022 11:03               11362
function.pclose.php                                30-Sep-2022 11:03                4492
function.pcntl-alarm.php                           30-Sep-2022 11:03                2723
function.pcntl-async-signals.php                   30-Sep-2022 11:03                3865
function.pcntl-errno.php                           30-Sep-2022 11:03                1728
function.pcntl-exec.php                            30-Sep-2022 11:03                3490
function.pcntl-fork.php                            30-Sep-2022 11:03                5184
function.pcntl-get-last-error.php                  30-Sep-2022 11:03                2636
function.pcntl-getpriority.php                     30-Sep-2022 11:03                4257
function.pcntl-rfork.php                           30-Sep-2022 11:03                7739
function.pcntl-setpriority.php                     30-Sep-2022 11:03                4107
function.pcntl-signal-dispatch.php                 30-Sep-2022 11:03                5300
function.pcntl-signal-get-handler.php              30-Sep-2022 11:03                6650
function.pcntl-signal.php                          30-Sep-2022 11:03               11031
function.pcntl-sigprocmask.php                     30-Sep-2022 11:03                5727
function.pcntl-sigtimedwait.php                    30-Sep-2022 11:03                4584
function.pcntl-sigwaitinfo.php                     30-Sep-2022 11:03                7044
function.pcntl-strerror.php                        30-Sep-2022 11:03                2797
function.pcntl-unshare.php                         30-Sep-2022 11:03                4217
function.pcntl-wait.php                            30-Sep-2022 11:03                7917
function.pcntl-waitpid.php                         30-Sep-2022 11:03                8986
function.pcntl-wexitstatus.php                     30-Sep-2022 11:03                3320
function.pcntl-wifexited.php                       30-Sep-2022 11:03                3241
function.pcntl-wifsignaled.php                     30-Sep-2022 11:03                3263
function.pcntl-wifstopped.php                      30-Sep-2022 11:03                3228
function.pcntl-wstopsig.php                        30-Sep-2022 11:03                3241
function.pcntl-wtermsig.php                        30-Sep-2022 11:03                3432
function.pfsockopen.php                            30-Sep-2022 11:03                3536
function.pg-affected-rows.php                      30-Sep-2022 11:03                3934
function.pg-cancel-query.php                       30-Sep-2022 11:03                2460
function.pg-client-encoding.php                    30-Sep-2022 11:03                3103
function.pg-close.php                              30-Sep-2022 11:03                5146
function.pg-connect-poll.php                       30-Sep-2022 11:03                2860
function.pg-connect.php                            30-Sep-2022 11:03                6430
function.pg-connection-busy.php                    30-Sep-2022 11:03                4171
function.pg-connection-reset.php                   30-Sep-2022 11:03                5020
function.pg-connection-status.php                  30-Sep-2022 11:03                4901
function.pg-consume-input.php                      30-Sep-2022 11:03                3420
function.pg-convert.php                            30-Sep-2022 11:03                7437
function.pg-copy-from.php                          30-Sep-2022 11:03                7005
function.pg-copy-to.php                            30-Sep-2022 11:03                2741
function.pg-dbname.php                             30-Sep-2022 11:03                3046
function.pg-delete.php                             30-Sep-2022 11:03                7179
function.pg-end-copy.php                           30-Sep-2022 11:03                6065
function.pg-escape-bytea.php                       30-Sep-2022 11:03                3083
function.pg-escape-identifier.php                  30-Sep-2022 11:03                7789
function.pg-escape-literal.php                     30-Sep-2022 11:03                8294
function.pg-escape-string.php                      30-Sep-2022 11:03                2443
function.pg-execute.php                            30-Sep-2022 11:03               10520
function.pg-fetch-all-columns.php                  30-Sep-2022 11:03                7046
function.pg-fetch-all.php                          30-Sep-2022 11:03                4571
function.pg-fetch-array.php                        30-Sep-2022 11:03                7861
function.pg-fetch-assoc.php                        30-Sep-2022 11:03                6160
function.pg-fetch-object.php                       30-Sep-2022 11:03                8472
function.pg-fetch-result.php                       30-Sep-2022 11:03                3576
function.pg-fetch-row.php                          30-Sep-2022 11:03                7905
function.pg-field-is-null.php                      30-Sep-2022 11:03                5749
function.pg-field-name.php                         30-Sep-2022 11:03                7297
function.pg-field-num.php                          30-Sep-2022 11:03                2721
function.pg-field-prtlen.php                       30-Sep-2022 11:03                2835
function.pg-field-size.php                         30-Sep-2022 11:03                2972
function.pg-field-table.php                        30-Sep-2022 11:03                8284
function.pg-field-type-oid.php                     30-Sep-2022 11:03                7435
function.pg-field-type.php                         30-Sep-2022 11:03                2797
function.pg-flush.php                              30-Sep-2022 11:03                2641
function.pg-free-result.php                        30-Sep-2022 11:03                6838
function.pg-get-notify.php                         30-Sep-2022 11:03                4480
function.pg-get-pid.php                            30-Sep-2022 11:03                3440
function.pg-get-result.php                         30-Sep-2022 11:03                2443
function.pg-host.php                               30-Sep-2022 11:03                2219
function.pg-insert.php                             30-Sep-2022 11:03                7295
function.pg-last-error.php                         30-Sep-2022 11:03                3006
function.pg-last-notice.php                        30-Sep-2022 11:03                6971
function.pg-last-oid.php                           30-Sep-2022 11:03                3151
function.pg-lo-close.php                           30-Sep-2022 11:03                2735
function.pg-lo-create.php                          30-Sep-2022 11:03                2858
function.pg-lo-export.php                          30-Sep-2022 11:03                7192
function.pg-lo-import.php                          30-Sep-2022 11:03                6506
function.pg-lo-open.php                            30-Sep-2022 11:03                3115
function.pg-lo-read-all.php                        30-Sep-2022 11:03                2635
function.pg-lo-read.php                            30-Sep-2022 11:03                2785
function.pg-lo-seek.php                            30-Sep-2022 11:03                2424
function.pg-lo-tell.php                            30-Sep-2022 11:03                2139
function.pg-lo-truncate.php                        30-Sep-2022 11:03                6601
function.pg-lo-unlink.php                          30-Sep-2022 11:03                6152
function.pg-lo-write.php                           30-Sep-2022 11:03                2895
function.pg-meta-data.php                          30-Sep-2022 11:03                6351
function.pg-num-fields.php                         30-Sep-2022 11:03                2575
function.pg-num-rows.php                           30-Sep-2022 11:03                2923
function.pg-options.php                            30-Sep-2022 11:03                1982
function.pg-parameter-status.php                   30-Sep-2022 11:03                8230
function.pg-pconnect.php                           30-Sep-2022 11:03                8726
function.pg-ping.php                               30-Sep-2022 11:03                3502
function.pg-port.php                               30-Sep-2022 11:03                1908
function.pg-prepare.php                            30-Sep-2022 11:03               10466
function.pg-put-line.php                           30-Sep-2022 11:03                7793
function.pg-query-params.php                       30-Sep-2022 11:03               10829
function.pg-query.php                              30-Sep-2022 11:03                4846
function.pg-result-error-field.php                 30-Sep-2022 11:03                8650
function.pg-result-error.php                       30-Sep-2022 11:03                2735
function.pg-result-seek.php                        30-Sep-2022 11:03                2717
function.pg-result-status.php                      30-Sep-2022 11:03                2307
function.pg-select.php                             30-Sep-2022 11:03                7489
function.pg-send-execute.php                       30-Sep-2022 11:03               10714
function.pg-send-prepare.php                       30-Sep-2022 11:03               11089
function.pg-send-query-params.php                  30-Sep-2022 11:03                8062
function.pg-send-query.php                         30-Sep-2022 11:03                7676
function.pg-set-client-encoding.php                30-Sep-2022 11:03                3184
function.pg-set-error-verbosity.php                30-Sep-2022 11:03                8444
function.pg-socket.php                             30-Sep-2022 11:03                3546
function.pg-trace.php                              30-Sep-2022 11:03                3530
function.pg-transaction-status.php                 30-Sep-2022 11:03                6493
function.pg-tty.php                                30-Sep-2022 11:03                1949
function.pg-unescape-bytea.php                     30-Sep-2022 11:03                3126
function.pg-untrace.php                            30-Sep-2022 11:03                2336
function.pg-update.php                             30-Sep-2022 11:03                8151
function.pg-version.php                            30-Sep-2022 11:03                6463
function.php-ini-loaded-file.php                   30-Sep-2022 11:03                4442
function.php-ini-scanned-files.php                 30-Sep-2022 11:03                5955
function.php-sapi-name.php                         30-Sep-2022 11:03                5610
function.php-strip-whitespace.php                  30-Sep-2022 11:03                4623
function.php-uname.php                             30-Sep-2022 11:03                9174
function.phpcredits.php                            30-Sep-2022 11:03                7668
function.phpdbg-break-file.php                     30-Sep-2022 11:03                3608
function.phpdbg-break-function.php                 30-Sep-2022 11:03                3401
function.phpdbg-break-method.php                   30-Sep-2022 11:03                3679
function.phpdbg-break-next.php                     30-Sep-2022 11:03                3085
function.phpdbg-clear.php                          30-Sep-2022 11:03                3315
function.phpdbg-color.php                          30-Sep-2022 11:03                3502
function.phpdbg-end-oplog.php                      30-Sep-2022 11:03                2381
function.phpdbg-exec.php                           30-Sep-2022 11:03                2704
function.phpdbg-get-executable.php                 30-Sep-2022 11:03                2380
function.phpdbg-prompt.php                         30-Sep-2022 11:03                2699
function.phpdbg-start-oplog.php                    30-Sep-2022 11:03                2153
function.phpinfo.php                               30-Sep-2022 11:03                9872
function.phpversion.php                            30-Sep-2022 11:03                9727
function.pi.php                                    30-Sep-2022 11:03                3030
function.png2wbmp.php                              30-Sep-2022 11:03                6175
function.popen.php                                 30-Sep-2022 11:03                7451
function.pos.php                                   30-Sep-2022 11:03                1575
function.posix-access.php                          30-Sep-2022 11:03                6157
function.posix-ctermid.php                         30-Sep-2022 11:03                4221
function.posix-errno.php                           30-Sep-2022 11:03                1744
function.posix-get-last-error.php                  30-Sep-2022 11:03                4115
function.posix-getcwd.php                          30-Sep-2022 11:03                4089
function.posix-getegid.php                         30-Sep-2022 11:03                5220
function.posix-geteuid.php                         30-Sep-2022 11:03                5160
function.posix-getgid.php                          30-Sep-2022 11:03                4665
function.posix-getgrgid.php                        30-Sep-2022 11:03                6188
function.posix-getgrnam.php                        30-Sep-2022 11:03                6065
function.posix-getgroups.php                       30-Sep-2022 11:03                3974
function.posix-getlogin.php                        30-Sep-2022 11:03                3429
function.posix-getpgid.php                         30-Sep-2022 11:03                4420
function.posix-getpgrp.php                         30-Sep-2022 11:03                2424
function.posix-getpid.php                          30-Sep-2022 11:03                3525
function.posix-getppid.php                         30-Sep-2022 11:03                2846
function.posix-getpwnam.php                        30-Sep-2022 11:03                6530
function.posix-getpwuid.php                        30-Sep-2022 11:03                6531
function.posix-getrlimit.php                       30-Sep-2022 11:03                6954
function.posix-getsid.php                          30-Sep-2022 11:03                4503
function.posix-getuid.php                          30-Sep-2022 11:03                3252
function.posix-initgroups.php                      30-Sep-2022 11:03                3001
function.posix-isatty.php                          30-Sep-2022 11:03                3531
function.posix-kill.php                            30-Sep-2022 11:03                3184
function.posix-mkfifo.php                          30-Sep-2022 11:03                3239
function.posix-mknod.php                           30-Sep-2022 11:03                7045
function.posix-setegid.php                         30-Sep-2022 11:03                5018
function.posix-seteuid.php                         30-Sep-2022 11:03                3317
function.posix-setgid.php                          30-Sep-2022 11:03                5223
function.posix-setpgid.php                         30-Sep-2022 11:03                3105
function.posix-setrlimit.php                       30-Sep-2022 11:03                4115
function.posix-setsid.php                          30-Sep-2022 11:03                2408
function.posix-setuid.php                          30-Sep-2022 11:03                5334
function.posix-strerror.php                        30-Sep-2022 11:03                4642
function.posix-times.php                           30-Sep-2022 11:03                4461
function.posix-ttyname.php                         30-Sep-2022 11:03                3093
function.posix-uname.php                           30-Sep-2022 11:03                4588
function.pow.php                                   30-Sep-2022 11:03                7336
function.preg-filter.php                           30-Sep-2022 11:03                8925
function.preg-grep.php                             30-Sep-2022 11:03                5321
function.preg-last-error-msg.php                   30-Sep-2022 11:03                3984
function.preg-last-error.php                       30-Sep-2022 11:03                4171
function.preg-match-all.php                        30-Sep-2022 11:03               24615
function.preg-match.php                            30-Sep-2022 11:03               22677
function.preg-quote.php                            30-Sep-2022 11:03                8350
function.preg-replace-callback-array.php           30-Sep-2022 11:03               10168
function.preg-replace-callback.php                 30-Sep-2022 11:03               16590
function.preg-replace.php                          30-Sep-2022 11:03               21017
function.preg-split.php                            30-Sep-2022 11:03               11752
function.prev.php                                  30-Sep-2022 11:03                8738
function.print-r.php                               30-Sep-2022 11:03                8692
function.print.php                                 30-Sep-2022 11:03                7846
function.printf.php                                30-Sep-2022 11:03               22851
function.proc-close.php                            30-Sep-2022 11:03                3420
function.proc-get-status.php                       30-Sep-2022 11:03                5505
function.proc-nice.php                             30-Sep-2022 11:03                7465
function.proc-open.php                             30-Sep-2022 11:03               21377
function.proc-terminate.php                        30-Sep-2022 11:03                4399
function.property-exists.php                       30-Sep-2022 11:03                8344
function.ps-add-bookmark.php                       30-Sep-2022 11:03                4782
function.ps-add-launchlink.php                     30-Sep-2022 11:03                5285
function.ps-add-locallink.php                      30-Sep-2022 11:03                6015
function.ps-add-note.php                           30-Sep-2022 11:03                6644
function.ps-add-pdflink.php                        30-Sep-2022 11:03                6332
function.ps-add-weblink.php                        30-Sep-2022 11:03                5371
function.ps-arc.php                                30-Sep-2022 11:03                4802
function.ps-arcn.php                               30-Sep-2022 11:03                4808
function.ps-begin-page.php                         30-Sep-2022 11:03                6657
function.ps-begin-pattern.php                      30-Sep-2022 11:03               13250
function.ps-begin-template.php                     30-Sep-2022 11:03               11321
function.ps-circle.php                             30-Sep-2022 11:03                4444
function.ps-clip.php                               30-Sep-2022 11:03                2870
function.ps-close-image.php                        30-Sep-2022 11:03                3734
function.ps-close.php                              30-Sep-2022 11:03                3523
function.ps-closepath-stroke.php                   30-Sep-2022 11:03                2943
function.ps-closepath.php                          30-Sep-2022 11:03                3119
function.ps-continue-text.php                      30-Sep-2022 11:03                3890
function.ps-curveto.php                            30-Sep-2022 11:03                4623
function.ps-delete.php                             30-Sep-2022 11:03                3387
function.ps-end-page.php                           30-Sep-2022 11:03                3113
function.ps-end-pattern.php                        30-Sep-2022 11:03                3044
function.ps-end-template.php                       30-Sep-2022 11:03                3051
function.ps-fill-stroke.php                        30-Sep-2022 11:03                3164
function.ps-fill.php                               30-Sep-2022 11:03                3097
function.ps-findfont.php                           30-Sep-2022 11:03                6809
function.ps-get-buffer.php                         30-Sep-2022 11:03                3076
function.ps-get-parameter.php                      30-Sep-2022 11:03                7539
function.ps-get-value.php                          30-Sep-2022 11:03                9290
function.ps-hyphenate.php                          30-Sep-2022 11:03                7109
function.ps-include-file.php                       30-Sep-2022 11:03                2853
function.ps-lineto.php                             30-Sep-2022 11:03                8136
function.ps-makespotcolor.php                      30-Sep-2022 11:03               10240
function.ps-moveto.php                             30-Sep-2022 11:03                3573
function.ps-new.php                                30-Sep-2022 11:03                2873
function.ps-open-file.php                          30-Sep-2022 11:03                3466
function.ps-open-image-file.php                    30-Sep-2022 11:03                4647
function.ps-open-image.php                         30-Sep-2022 11:03                6462
function.ps-open-memory-image.php                  30-Sep-2022 11:03                2643
function.ps-place-image.php                        30-Sep-2022 11:03                4881
function.ps-rect.php                               30-Sep-2022 11:03                4616
function.ps-restore.php                            30-Sep-2022 11:03                3226
function.ps-rotate.php                             30-Sep-2022 11:03               12306
function.ps-save.php                               30-Sep-2022 11:03                2973
function.ps-scale.php                              30-Sep-2022 11:03                3497
function.ps-set-border-color.php                   30-Sep-2022 11:03                4561
function.ps-set-border-dash.php                    30-Sep-2022 11:03                4203
function.ps-set-border-style.php                   30-Sep-2022 11:03                4265
function.ps-set-info.php                           30-Sep-2022 11:03                5737
function.ps-set-parameter.php                      30-Sep-2022 11:03                3673
function.ps-set-text-pos.php                       30-Sep-2022 11:03                9298
function.ps-set-value.php                          30-Sep-2022 11:03                4508
function.ps-setcolor.php                           30-Sep-2022 11:03                5446
function.ps-setdash.php                            30-Sep-2022 11:03                3369
function.ps-setflat.php                            30-Sep-2022 11:03                2842
function.ps-setfont.php                            30-Sep-2022 11:03                3802
function.ps-setgray.php                            30-Sep-2022 11:03                3096
function.ps-setlinecap.php                         30-Sep-2022 11:03                3652
function.ps-setlinejoin.php                        30-Sep-2022 11:03                3670
function.ps-setlinewidth.php                       30-Sep-2022 11:03                3534
function.ps-setmiterlimit.php                      30-Sep-2022 11:03                3954
function.ps-setoverprintmode.php                   30-Sep-2022 11:03                2879
function.ps-setpolydash.php                        30-Sep-2022 11:03                7701
function.ps-shading-pattern.php                    30-Sep-2022 11:03                4015
function.ps-shading.php                            30-Sep-2022 11:03                6492
function.ps-shfill.php                             30-Sep-2022 11:03                3760
function.ps-show-boxed.php                         30-Sep-2022 11:03               12064
function.ps-show-xy.php                            30-Sep-2022 11:03                3929
function.ps-show-xy2.php                           30-Sep-2022 11:03                2671
function.ps-show.php                               30-Sep-2022 11:03                5582
function.ps-show2.php                              30-Sep-2022 11:03                3024
function.ps-string-geometry.php                    30-Sep-2022 11:03                4637
function.ps-stringwidth.php                        30-Sep-2022 11:03                4099
function.ps-stroke.php                             30-Sep-2022 11:03                3309
function.ps-symbol-name.php                        30-Sep-2022 11:03                3696
function.ps-symbol-width.php                       30-Sep-2022 11:03                4188
function.ps-symbol.php                             30-Sep-2022 11:03                3506
function.ps-translate.php                          30-Sep-2022 11:03               14341
function.pspell-add-to-personal.php                30-Sep-2022 11:03                6237
function.pspell-add-to-session.php                 30-Sep-2022 11:03                3849
function.pspell-check.php                          30-Sep-2022 11:03                4894
function.pspell-clear-session.php                  30-Sep-2022 11:03                5745
function.pspell-config-create.php                  30-Sep-2022 11:03                7889
function.pspell-config-data-dir.php                30-Sep-2022 11:03                3120
function.pspell-config-dict-dir.php                30-Sep-2022 11:03                3119
function.pspell-config-ignore.php                  30-Sep-2022 11:03                5580
function.pspell-config-mode.php                    30-Sep-2022 11:03                6201
function.pspell-config-personal.php                30-Sep-2022 11:03                6323
function.pspell-config-repl.php                    30-Sep-2022 11:03                6631
function.pspell-config-runtogether.php             30-Sep-2022 11:03                6084
function.pspell-config-save-repl.php               30-Sep-2022 11:03                4983
function.pspell-new-config.php                     30-Sep-2022 11:03                6317
function.pspell-new-personal.php                   30-Sep-2022 11:03               10192
function.pspell-new.php                            30-Sep-2022 11:03                8836
function.pspell-save-wordlist.php                  30-Sep-2022 11:03                5901
function.pspell-store-replacement.php              30-Sep-2022 11:03                7474
function.pspell-suggest.php                        30-Sep-2022 11:03                5573
function.putenv.php                                30-Sep-2022 11:03                3729
function.quoted-printable-decode.php               30-Sep-2022 11:03                3396
function.quoted-printable-encode.php               30-Sep-2022 11:03                3413
function.quotemeta.php                             30-Sep-2022 11:03                4534
function.rad2deg.php                               30-Sep-2022 11:03                3421
function.radius-acct-open.php                      30-Sep-2022 11:03                3127
function.radius-add-server.php                     30-Sep-2022 11:03                7356
function.radius-auth-open.php                      30-Sep-2022 11:03                3139
function.radius-close.php                          30-Sep-2022 11:03                2413
function.radius-config.php                         30-Sep-2022 11:03                3783
function.radius-create-request.php                 30-Sep-2022 11:03                4962
function.radius-cvt-addr.php                       30-Sep-2022 11:03                6712
function.radius-cvt-int.php                        30-Sep-2022 11:03                5949
function.radius-cvt-string.php                     30-Sep-2022 11:03                6006
function.radius-demangle-mppe-key.php              30-Sep-2022 11:03                2970
function.radius-demangle.php                       30-Sep-2022 11:03                2701
function.radius-get-attr.php                       30-Sep-2022 11:03                6743
function.radius-get-tagged-attr-data.php           30-Sep-2022 11:03                6716
function.radius-get-tagged-attr-tag.php            30-Sep-2022 11:03                6771
function.radius-get-vendor-attr.php                30-Sep-2022 11:03                8804
function.radius-put-addr.php                       30-Sep-2022 11:03                4924
function.radius-put-attr.php                       30-Sep-2022 11:03                8343
function.radius-put-int.php                        30-Sep-2022 11:03                7012
function.radius-put-string.php                     30-Sep-2022 11:03                7400
function.radius-put-vendor-addr.php                30-Sep-2022 11:03                4935
function.radius-put-vendor-attr.php                30-Sep-2022 11:03                7183
function.radius-put-vendor-int.php                 30-Sep-2022 11:03                5608
function.radius-put-vendor-string.php              30-Sep-2022 11:03                5999
function.radius-request-authenticator.php          30-Sep-2022 11:03                2963
function.radius-salt-encrypt-attr.php              30-Sep-2022 11:03                3949
function.radius-send-request.php                   30-Sep-2022 11:03                3583
function.radius-server-secret.php                  30-Sep-2022 11:03                2485
function.radius-strerror.php                       30-Sep-2022 11:03                2422
function.rand.php                                  30-Sep-2022 11:03                6323
function.random-bytes.php                          30-Sep-2022 11:03                7645
function.random-int.php                            30-Sep-2022 11:03                7762
function.range.php                                 30-Sep-2022 11:03                7855
function.rar-wrapper-cache-stats.php               30-Sep-2022 11:03                2195
function.rawurldecode.php                          30-Sep-2022 11:03                4520
function.rawurlencode.php                          30-Sep-2022 11:03                7233
function.read-exif-data.php                        30-Sep-2022 11:03                2435
function.readdir.php                               30-Sep-2022 11:03               10025
function.readfile.php                              30-Sep-2022 11:03                9345
function.readgzfile.php                            30-Sep-2022 11:03                4234
function.readline-add-history.php                  30-Sep-2022 11:03                2577
function.readline-callback-handler-install.php     30-Sep-2022 11:03                9825
function.readline-callback-handler-remove.php      30-Sep-2022 11:03                3458
function.readline-callback-read-char.php           30-Sep-2022 11:03                3542
function.readline-clear-history.php                30-Sep-2022 11:03                2101
function.readline-completion-function.php          30-Sep-2022 11:03                2820
function.readline-info.php                         30-Sep-2022 11:03                3180
function.readline-list-history.php                 30-Sep-2022 11:03                2000
function.readline-on-new-line.php                  30-Sep-2022 11:03                2013
function.readline-read-history.php                 30-Sep-2022 11:03                2554
function.readline-redisplay.php                    30-Sep-2022 11:03                1974
function.readline-write-history.php                30-Sep-2022 11:03                2525
function.readline.php                              30-Sep-2022 11:03                4664
function.readlink.php                              30-Sep-2022 11:03                4474
function.realpath-cache-get.php                    30-Sep-2022 11:03                3860
function.realpath-cache-size.php                   30-Sep-2022 11:03                3404
function.realpath.php                              30-Sep-2022 11:03                8137
function.recode-file.php                           30-Sep-2022 11:03                5409
function.recode-string.php                         30-Sep-2022 11:03                4843
function.recode.php                                30-Sep-2022 11:03                1667
function.register-shutdown-function.php            30-Sep-2022 11:03                7391
function.register-tick-function.php                30-Sep-2022 11:03                5391
function.rename.php                                30-Sep-2022 11:03                5409
function.require-once.php                          30-Sep-2022 11:03                1741
function.require.php                               30-Sep-2022 11:03                1852
function.reset.php                                 30-Sep-2022 11:03                8551
function.restore-error-handler.php                 30-Sep-2022 11:03                5684
function.restore-exception-handler.php             30-Sep-2022 11:03                6782
function.restore-include-path.php                  30-Sep-2022 11:03                4645
function.return.php                                30-Sep-2022 11:03                3904
function.rewind.php                                30-Sep-2022 11:03                6084
function.rewinddir.php                             30-Sep-2022 11:03                3233
function.rmdir.php                                 30-Sep-2022 11:03                4620
function.round.php                                 30-Sep-2022 11:03               23194
function.rpmaddtag.php                             30-Sep-2022 11:03                3088
function.rpmdbinfo.php                             30-Sep-2022 11:03                4657
function.rpmdbsearch.php                           30-Sep-2022 11:03                5442
function.rpminfo.php                               30-Sep-2022 11:03                4841
function.rpmvercmp.php                             30-Sep-2022 11:03                2522
function.rrd-create.php                            30-Sep-2022 11:03                2614
function.rrd-error.php                             30-Sep-2022 11:03                1970
function.rrd-fetch.php                             30-Sep-2022 11:03                2714
function.rrd-first.php                             30-Sep-2022 11:03                2644
function.rrd-graph.php                             30-Sep-2022 11:03                2896
function.rrd-info.php                              30-Sep-2022 11:03                2283
function.rrd-last.php                              30-Sep-2022 11:03                2281
function.rrd-lastupdate.php                        30-Sep-2022 11:03                2413
function.rrd-restore.php                           30-Sep-2022 11:03                2947
function.rrd-tune.php                              30-Sep-2022 11:03                2685
function.rrd-update.php                            30-Sep-2022 11:03                2758
function.rrd-version.php                           30-Sep-2022 11:03                2064
function.rrd-xport.php                             30-Sep-2022 11:03                2459
function.rrdc-disconnect.php                       30-Sep-2022 11:03                2446
function.rsort.php                                 30-Sep-2022 11:03                8065
function.rtrim.php                                 30-Sep-2022 11:03                9430
function.runkit7-constant-add.php                  30-Sep-2022 11:03                4168
function.runkit7-constant-redefine.php             30-Sep-2022 11:03                4053
function.runkit7-constant-remove.php               30-Sep-2022 11:03                3387
function.runkit7-function-add.php                  30-Sep-2022 11:03                8767
function.runkit7-function-copy.php                 30-Sep-2022 11:03                5216
function.runkit7-function-redefine.php             30-Sep-2022 11:03                9141
function.runkit7-function-remove.php               30-Sep-2022 11:03                3844
function.runkit7-function-rename.php               30-Sep-2022 11:03                4065
function.runkit7-import.php                        30-Sep-2022 11:03                3512
function.runkit7-method-add.php                    30-Sep-2022 11:03               10663
function.runkit7-method-copy.php                   30-Sep-2022 11:03                7002
function.runkit7-method-redefine.php               30-Sep-2022 11:03               11129
function.runkit7-method-remove.php                 30-Sep-2022 11:03                6396
function.runkit7-method-rename.php                 30-Sep-2022 11:03                6447
function.runkit7-object-id.php                     30-Sep-2022 11:03                3587
function.runkit7-superglobals.php                  30-Sep-2022 11:03                2510
function.runkit7-zval-inspect.php                  30-Sep-2022 11:03                5003
function.sapi-windows-cp-conv.php                  30-Sep-2022 11:03                4230
function.sapi-windows-cp-get.php                   30-Sep-2022 11:03                3290
function.sapi-windows-cp-is-utf8.php               30-Sep-2022 11:03                2614
function.sapi-windows-cp-set.php                   30-Sep-2022 11:03                2802
function.sapi-windows-generate-ctrl-event.php      30-Sep-2022 11:03                7634
function.sapi-windows-set-ctrl-handler.php         30-Sep-2022 11:03                7377
function.sapi-windows-vt100-support.php            30-Sep-2022 11:03                9796
function.scandir.php                               30-Sep-2022 11:03                7859
function.scoutapm-get-calls.php                    30-Sep-2022 11:03                4289
function.scoutapm-list-instrumented-functions.php  30-Sep-2022 11:03                3629
function.seaslog-get-author.php                    30-Sep-2022 11:03                2953
function.seaslog-get-version.php                   30-Sep-2022 11:03                2940
function.sem-acquire.php                           30-Sep-2022 11:03                4809
function.sem-get.php                               30-Sep-2022 11:03                6578
function.sem-release.php                           30-Sep-2022 11:03                4035
function.sem-remove.php                            30-Sep-2022 11:03                4016
function.serialize.php                             30-Sep-2022 11:03                6969
function.session-abort.php                         30-Sep-2022 11:03                3900
function.session-cache-expire.php                  30-Sep-2022 11:03                6625
function.session-cache-limiter.php                 30-Sep-2022 11:03                7992
function.session-commit.php                        30-Sep-2022 11:03                1779
function.session-create-id.php                     30-Sep-2022 11:03               10891
function.session-decode.php                        30-Sep-2022 11:03                3498
function.session-destroy.php                       30-Sep-2022 11:03                9270
function.session-encode.php                        30-Sep-2022 11:03                3384
function.session-gc.php                            30-Sep-2022 11:03                8038
function.session-get-cookie-params.php             30-Sep-2022 11:03                4786
function.session-id.php                            30-Sep-2022 11:03                4866
function.session-module-name.php                   30-Sep-2022 11:03                3489
function.session-name.php                          30-Sep-2022 11:03                7021
function.session-regenerate-id.php                 30-Sep-2022 11:03               17369
function.session-register-shutdown.php             30-Sep-2022 11:03                2579
function.session-reset.php                         30-Sep-2022 11:03                3990
function.session-save-path.php                     30-Sep-2022 11:03                3555
function.session-set-cookie-params.php             30-Sep-2022 11:03                8944
function.session-set-save-handler.php              30-Sep-2022 11:03               20934
function.session-start.php                         30-Sep-2022 11:03               14857
function.session-status.php                        30-Sep-2022 11:03                2784
function.session-unset.php                         30-Sep-2022 11:03                3081
function.session-write-close.php                   30-Sep-2022 11:03                3744
function.set-error-handler.php                     30-Sep-2022 11:03               26985
function.set-exception-handler.php                 30-Sep-2022 11:03                6699
function.set-file-buffer.php                       30-Sep-2022 11:03                1744
function.set-include-path.php                      30-Sep-2022 11:03                5835
function.set-time-limit.php                        30-Sep-2022 11:03                4240
function.setcookie.php                             30-Sep-2022 11:03               24155
function.setlocale.php                             30-Sep-2022 11:03               14662
function.setrawcookie.php                          30-Sep-2022 11:03                4630
function.settype.php                               30-Sep-2022 11:03                6387
function.sha1-file.php                             30-Sep-2022 11:03                5488
function.sha1.php                                  30-Sep-2022 11:03                5601
function.shell-exec.php                            30-Sep-2022 11:03                5179
function.shm-attach.php                            30-Sep-2022 11:03                5587
function.shm-detach.php                            30-Sep-2022 11:03                4277
function.shm-get-var.php                           30-Sep-2022 11:03                4240
function.shm-has-var.php                           30-Sep-2022 11:03                4060
function.shm-put-var.php                           30-Sep-2022 11:03                5101
function.shm-remove-var.php                        30-Sep-2022 11:03                3936
function.shm-remove.php                            30-Sep-2022 11:03                3717
function.shmop-close.php                           30-Sep-2022 11:03                4665
function.shmop-delete.php                          30-Sep-2022 11:03                3974
function.shmop-open.php                            30-Sep-2022 11:03                8103
function.shmop-read.php                            30-Sep-2022 11:03                5190
function.shmop-size.php                            30-Sep-2022 11:03                4103
function.shmop-write.php                           30-Sep-2022 11:03                5373
function.show-source.php                           30-Sep-2022 11:03                1702
function.shuffle.php                               30-Sep-2022 11:03                5542
function.similar-text.php                          30-Sep-2022 11:03                3873
function.simplexml-import-dom.php                  30-Sep-2022 11:03                6356
function.simplexml-load-file.php                   30-Sep-2022 11:03                9581
function.simplexml-load-string.php                 30-Sep-2022 11:03                9218
function.sin.php                                   30-Sep-2022 11:03                4552
function.sinh.php                                  30-Sep-2022 11:03                3050
function.sizeof.php                                30-Sep-2022 11:03                1595
function.sleep.php                                 30-Sep-2022 11:03                5571
function.snmp-get-quick-print.php                  30-Sep-2022 11:03                2985
function.snmp-get-valueretrieval.php               30-Sep-2022 11:03                4330
function.snmp-read-mib.php                         30-Sep-2022 11:03                4650
function.snmp-set-enum-print.php                   30-Sep-2022 11:03                4562
function.snmp-set-oid-numeric-print.php            30-Sep-2022 11:03                2287
function.snmp-set-oid-output-format.php            30-Sep-2022 11:03                6636
function.snmp-set-quick-print.php                  30-Sep-2022 11:03                4939
function.snmp-set-valueretrieval.php               30-Sep-2022 11:03                9105
function.snmp2-get.php                             30-Sep-2022 11:03                5431
function.snmp2-getnext.php                         30-Sep-2022 11:03                5814
function.snmp2-real-walk.php                       30-Sep-2022 11:03                6085
function.snmp2-set.php                             30-Sep-2022 11:03               10241
function.snmp2-walk.php                            30-Sep-2022 11:03                6592
function.snmp3-get.php                             30-Sep-2022 11:03                8269
function.snmp3-getnext.php                         30-Sep-2022 11:03                8612
function.snmp3-real-walk.php                       30-Sep-2022 11:03                9121
function.snmp3-set.php                             30-Sep-2022 11:03               12802
function.snmp3-walk.php                            30-Sep-2022 11:03                9545
function.snmpget.php                               30-Sep-2022 11:03                3473
function.snmpgetnext.php                           30-Sep-2022 11:03                5689
function.snmprealwalk.php                          30-Sep-2022 11:03                5779
function.snmpset.php                               30-Sep-2022 11:03                3167
function.snmpwalk.php                              30-Sep-2022 11:03                4656
function.snmpwalkoid.php                           30-Sep-2022 11:03                5618
function.socket-accept.php                         30-Sep-2022 11:03                6540
function.socket-addrinfo-bind.php                  30-Sep-2022 11:03                5192
function.socket-addrinfo-connect.php               30-Sep-2022 11:03                4934
function.socket-addrinfo-explain.php               30-Sep-2022 11:03                4293
function.socket-addrinfo-lookup.php                30-Sep-2022 11:03                5505
function.socket-bind.php                           30-Sep-2022 11:03               10638
function.socket-clear-error.php                    30-Sep-2022 11:03                4409
function.socket-close.php                          30-Sep-2022 11:03                4481
function.socket-cmsg-space.php                     30-Sep-2022 11:03                3415
function.socket-connect.php                        30-Sep-2022 11:03                7102
function.socket-create-listen.php                  30-Sep-2022 11:03                6737
function.socket-create-pair.php                    30-Sep-2022 11:03               20517
function.socket-create.php                         30-Sep-2022 11:03               10998
function.socket-export-stream.php                  30-Sep-2022 11:03                3224
function.socket-get-option.php                     30-Sep-2022 11:03               26898
function.socket-get-status.php                     30-Sep-2022 11:03                1778
function.socket-getopt.php                         30-Sep-2022 11:03                1758
function.socket-getpeername.php                    30-Sep-2022 11:03                7579
function.socket-getsockname.php                    30-Sep-2022 11:03                6895
function.socket-import-stream.php                  30-Sep-2022 11:03                4960
function.socket-last-error.php                     30-Sep-2022 11:03                7073
function.socket-listen.php                         30-Sep-2022 11:03                6964
function.socket-read.php                           30-Sep-2022 11:03                7530
function.socket-recv.php                           30-Sep-2022 11:03               16536
function.socket-recvfrom.php                       30-Sep-2022 11:03               12796
function.socket-recvmsg.php                        30-Sep-2022 11:03                4099
function.socket-select.php                         30-Sep-2022 11:03               15372
function.socket-send.php                           30-Sep-2022 11:03                6243
function.socket-sendmsg.php                        30-Sep-2022 11:03                4180
function.socket-sendto.php                         30-Sep-2022 11:03                9486
function.socket-set-block.php                      30-Sep-2022 11:03                5871
function.socket-set-blocking.php                   30-Sep-2022 11:03                1798
function.socket-set-nonblock.php                   30-Sep-2022 11:03                6250
function.socket-set-option.php                     30-Sep-2022 11:03               11418
function.socket-set-timeout.php                    30-Sep-2022 11:03                1766
function.socket-setopt.php                         30-Sep-2022 11:03                1752
function.socket-shutdown.php                       30-Sep-2022 11:03                4658
function.socket-strerror.php                       30-Sep-2022 11:03                7165
function.socket-write.php                          30-Sep-2022 11:03                6935
function.socket-wsaprotocol-info-export.php        30-Sep-2022 11:03                4779
function.socket-wsaprotocol-info-import.php        30-Sep-2022 11:03                4210
function.socket-wsaprotocol-info-release.php       30-Sep-2022 11:03                3377
function.sodium-add.php                            30-Sep-2022 11:03                2982
function.sodium-base642bin.php                     30-Sep-2022 11:03                4183
function.sodium-bin2base64.php                     30-Sep-2022 11:03                3829
function.sodium-bin2hex.php                        30-Sep-2022 11:03                2520
function.sodium-compare.php                        30-Sep-2022 11:03                2993
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-Sep-2022 11:03                4226
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-Sep-2022 11:03                4008
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-Sep-2022 11:03                2604
function.sodium-crypto-aead-aes256gcm-keygen.php   30-Sep-2022 11:03                2696
function.sodium-crypto-aead-chacha20poly1305-de..> 30-Sep-2022 11:03                4142
function.sodium-crypto-aead-chacha20poly1305-en..> 30-Sep-2022 11:03                3887
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:03                4372
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:03                4053
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:03                2890
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-Sep-2022 11:03                2825
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:03                4550
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:03                4271
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:03                2866
function.sodium-crypto-auth-keygen.php             30-Sep-2022 11:03                2517
function.sodium-crypto-auth-verify.php             30-Sep-2022 11:03                3495
function.sodium-crypto-auth.php                    30-Sep-2022 11:03                3120
function.sodium-crypto-box-keypair-from-secretk..> 30-Sep-2022 11:03                3199
function.sodium-crypto-box-keypair.php             30-Sep-2022 11:03                2798
function.sodium-crypto-box-open.php                30-Sep-2022 11:03                3633
function.sodium-crypto-box-publickey-from-secre..> 30-Sep-2022 11:03                3086
function.sodium-crypto-box-publickey.php           30-Sep-2022 11:03                2799
function.sodium-crypto-box-seal-open.php           30-Sep-2022 11:03                5861
function.sodium-crypto-box-seal.php                30-Sep-2022 11:03                7036
function.sodium-crypto-box-secretkey.php           30-Sep-2022 11:03                2766
function.sodium-crypto-box-seed-keypair.php        30-Sep-2022 11:03                2825
function.sodium-crypto-box.php                     30-Sep-2022 11:03                3933
function.sodium-crypto-core-ristretto255-add.php   30-Sep-2022 11:03                5851
function.sodium-crypto-core-ristretto255-from-h..> 30-Sep-2022 11:03                5282
function.sodium-crypto-core-ristretto255-is-val..> 30-Sep-2022 11:03                5356
function.sodium-crypto-core-ristretto255-random..> 30-Sep-2022 11:03                5459
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:03                6119
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:03                3379
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:03                5232
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:03                3582
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:03                5216
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:03                5619
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:03                3323
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:03                6110
function.sodium-crypto-core-ristretto255-sub.php   30-Sep-2022 11:03                5888
function.sodium-crypto-generichash-final.php       30-Sep-2022 11:03                6679
function.sodium-crypto-generichash-init.php        30-Sep-2022 11:03                6628
function.sodium-crypto-generichash-keygen.php      30-Sep-2022 11:03                2327
function.sodium-crypto-generichash-update.php      30-Sep-2022 11:03                6443
function.sodium-crypto-generichash.php             30-Sep-2022 11:03                3395
function.sodium-crypto-kdf-derive-from-key.php     30-Sep-2022 11:03                3628
function.sodium-crypto-kdf-keygen.php              30-Sep-2022 11:03                2429
function.sodium-crypto-kx-client-session-keys.php  30-Sep-2022 11:03                3154
function.sodium-crypto-kx-keypair.php              30-Sep-2022 11:03                4908
function.sodium-crypto-kx-publickey.php            30-Sep-2022 11:03                2618
function.sodium-crypto-kx-secretkey.php            30-Sep-2022 11:03                2629
function.sodium-crypto-kx-seed-keypair.php         30-Sep-2022 11:03                2530
function.sodium-crypto-kx-server-session-keys.php  30-Sep-2022 11:03                3220
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:03                3080
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:03                3230
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:03                5536
function.sodium-crypto-pwhash-str-needs-rehash.php 30-Sep-2022 11:03                3638
function.sodium-crypto-pwhash-str-verify.php       30-Sep-2022 11:03                4496
function.sodium-crypto-pwhash-str.php              30-Sep-2022 11:03                7875
function.sodium-crypto-pwhash.php                  30-Sep-2022 11:03                9373
function.sodium-crypto-scalarmult-base.php         30-Sep-2022 11:03                2005
function.sodium-crypto-scalarmult-ristretto255-..> 30-Sep-2022 11:03                3292
function.sodium-crypto-scalarmult-ristretto255.php 30-Sep-2022 11:03                3585
function.sodium-crypto-scalarmult.php              30-Sep-2022 11:03                2841
function.sodium-crypto-secretbox-keygen.php        30-Sep-2022 11:03                6215
function.sodium-crypto-secretbox-open.php          30-Sep-2022 11:03                8542
function.sodium-crypto-secretbox.php               30-Sep-2022 11:03                8460
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:03               11593
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:03               10745
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:03                2593
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:03                5476
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:03                5575
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:03                2836
function.sodium-crypto-shorthash-keygen.php        30-Sep-2022 11:03                2540
function.sodium-crypto-shorthash.php               30-Sep-2022 11:03                2953
function.sodium-crypto-sign-detached.php           30-Sep-2022 11:03                2946
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-Sep-2022 11:03                2786
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-Sep-2022 11:03                2842
function.sodium-crypto-sign-keypair-from-secret..> 30-Sep-2022 11:03                3025
function.sodium-crypto-sign-keypair.php            30-Sep-2022 11:03                2315
function.sodium-crypto-sign-open.php               30-Sep-2022 11:03                3055
function.sodium-crypto-sign-publickey-from-secr..> 30-Sep-2022 11:03                2644
function.sodium-crypto-sign-publickey.php          30-Sep-2022 11:03                2654
function.sodium-crypto-sign-secretkey.php          30-Sep-2022 11:03                2630
function.sodium-crypto-sign-seed-keypair.php       30-Sep-2022 11:03                2863
function.sodium-crypto-sign-verify-detached.php    30-Sep-2022 11:03                3272
function.sodium-crypto-sign.php                    30-Sep-2022 11:03                3024
function.sodium-crypto-stream-keygen.php           30-Sep-2022 11:03                2498
function.sodium-crypto-stream-xchacha20-keygen.php 30-Sep-2022 11:03                2656
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-Sep-2022 11:03                9403
function.sodium-crypto-stream-xchacha20-xor.php    30-Sep-2022 11:03                4422
function.sodium-crypto-stream-xchacha20.php        30-Sep-2022 11:03                3426
function.sodium-crypto-stream-xor.php              30-Sep-2022 11:03                3210
function.sodium-crypto-stream.php                  30-Sep-2022 11:03                3145
function.sodium-hex2bin.php                        30-Sep-2022 11:03                3072
function.sodium-increment.php                      30-Sep-2022 11:03                2376
function.sodium-memcmp.php                         30-Sep-2022 11:03                3180
function.sodium-memzero.php                        30-Sep-2022 11:03                2371
function.sodium-pad.php                            30-Sep-2022 11:03                2523
function.sodium-unpad.php                          30-Sep-2022 11:03                2478
function.solr-get-version.php                      30-Sep-2022 11:03                3690
function.sort.php                                  30-Sep-2022 11:03               10926
function.soundex.php                               30-Sep-2022 11:03                7330
function.spl-autoload-call.php                     30-Sep-2022 11:03                2501
function.spl-autoload-extensions.php               30-Sep-2022 11:03                4059
function.spl-autoload-functions.php                30-Sep-2022 11:03                2408
function.spl-autoload-register.php                 30-Sep-2022 11:03               10204
function.spl-autoload-unregister.php               30-Sep-2022 11:03                2948
function.spl-autoload.php                          30-Sep-2022 11:03                2971
function.spl-classes.php                           30-Sep-2022 11:03                3570
function.spl-object-hash.php                       30-Sep-2022 11:03                3801
function.spl-object-id.php                         30-Sep-2022 11:03                3997
function.sprintf.php                               30-Sep-2022 11:03               24236
function.sqlsrv-begin-transaction.php              30-Sep-2022 11:03               11999
function.sqlsrv-cancel.php                         30-Sep-2022 11:03               10700
function.sqlsrv-client-info.php                    30-Sep-2022 11:03                6876
function.sqlsrv-close.php                          30-Sep-2022 11:03                5519
function.sqlsrv-commit.php                         30-Sep-2022 11:03               11864
function.sqlsrv-configure.php                      30-Sep-2022 11:03                4436
function.sqlsrv-connect.php                        30-Sep-2022 11:03               12695
function.sqlsrv-errors.php                         30-Sep-2022 11:03               10634
function.sqlsrv-execute.php                        30-Sep-2022 11:03               10818
function.sqlsrv-fetch-array.php                    30-Sep-2022 11:03               15199
function.sqlsrv-fetch-object.php                   30-Sep-2022 11:03               12426
function.sqlsrv-fetch.php                          30-Sep-2022 11:03               11154
function.sqlsrv-field-metadata.php                 30-Sep-2022 11:03                8968
function.sqlsrv-free-stmt.php                      30-Sep-2022 11:03                7725
function.sqlsrv-get-config.php                     30-Sep-2022 11:03                3233
function.sqlsrv-get-field.php                      30-Sep-2022 11:03               10672
function.sqlsrv-has-rows.php                       30-Sep-2022 11:03                6433
function.sqlsrv-next-result.php                    30-Sep-2022 11:03                9596
function.sqlsrv-num-fields.php                     30-Sep-2022 11:03                8553
function.sqlsrv-num-rows.php                       30-Sep-2022 11:03                8068
function.sqlsrv-prepare.php                        30-Sep-2022 11:03               14921
function.sqlsrv-query.php                          30-Sep-2022 11:03               11659
function.sqlsrv-rollback.php                       30-Sep-2022 11:03               11334
function.sqlsrv-rows-affected.php                  30-Sep-2022 11:03                8185
function.sqlsrv-send-stream-data.php               30-Sep-2022 11:03                8938
function.sqlsrv-server-info.php                    30-Sep-2022 11:03                6298
function.sqrt.php                                  30-Sep-2022 11:03                3733
function.srand.php                                 30-Sep-2022 11:03                5804
function.sscanf.php                                30-Sep-2022 11:03               10380
function.ssdeep-fuzzy-compare.php                  30-Sep-2022 11:03                3005
function.ssdeep-fuzzy-hash-filename.php            30-Sep-2022 11:03                2784
function.ssdeep-fuzzy-hash.php                     30-Sep-2022 11:03                2628
function.ssh2-auth-agent.php                       30-Sep-2022 11:03                4523
function.ssh2-auth-hostbased-file.php              30-Sep-2022 11:03                7703
function.ssh2-auth-none.php                        30-Sep-2022 11:03                4784
function.ssh2-auth-password.php                    30-Sep-2022 11:03                4735
function.ssh2-auth-pubkey-file.php                 30-Sep-2022 11:03                7126
function.ssh2-connect.php                          30-Sep-2022 11:03               15804
function.ssh2-disconnect.php                       30-Sep-2022 11:03                2846
function.ssh2-exec.php                             30-Sep-2022 11:03                7026
function.ssh2-fetch-stream.php                     30-Sep-2022 11:03                5358
function.ssh2-fingerprint.php                      30-Sep-2022 11:03                5274
function.ssh2-forward-accept.php                   30-Sep-2022 11:03                2794
function.ssh2-forward-listen.php                   30-Sep-2022 11:03                4084
function.ssh2-methods-negotiated.php               30-Sep-2022 11:03                8107
function.ssh2-poll.php                             30-Sep-2022 11:03                3310
function.ssh2-publickey-add.php                    30-Sep-2022 11:03                7957
function.ssh2-publickey-init.php                   30-Sep-2022 11:03                4366
function.ssh2-publickey-list.php                   30-Sep-2022 11:03                8781
function.ssh2-publickey-remove.php                 30-Sep-2022 11:03                4324
function.ssh2-scp-recv.php                         30-Sep-2022 11:03                5162
function.ssh2-scp-send.php                         30-Sep-2022 11:03                5724
function.ssh2-send-eof.php                         30-Sep-2022 11:03                3199
function.ssh2-sftp-chmod.php                       30-Sep-2022 11:03                5699
function.ssh2-sftp-lstat.php                       30-Sep-2022 11:03                7237
function.ssh2-sftp-mkdir.php                       30-Sep-2022 11:03                6414
function.ssh2-sftp-readlink.php                    30-Sep-2022 11:03                5235
function.ssh2-sftp-realpath.php                    30-Sep-2022 11:03                5467
function.ssh2-sftp-rename.php                      30-Sep-2022 11:03                5259
function.ssh2-sftp-rmdir.php                       30-Sep-2022 11:03                5329
function.ssh2-sftp-stat.php                        30-Sep-2022 11:03                7135
function.ssh2-sftp-symlink.php                     30-Sep-2022 11:03                5464
function.ssh2-sftp-unlink.php                      30-Sep-2022 11:03                4774
function.ssh2-sftp.php                             30-Sep-2022 11:03                5337
function.ssh2-shell.php                            30-Sep-2022 11:03                7488
function.ssh2-tunnel.php                           30-Sep-2022 11:03                5150
function.stat.php                                  30-Sep-2022 11:03               13313
function.stats-absolute-deviation.php              30-Sep-2022 11:03                2621
function.stats-cdf-beta.php                        30-Sep-2022 11:03                4878
function.stats-cdf-binomial.php                    30-Sep-2022 11:03                4863
function.stats-cdf-cauchy.php                      30-Sep-2022 11:03                4898
function.stats-cdf-chisquare.php                   30-Sep-2022 11:03                4271
function.stats-cdf-exponential.php                 30-Sep-2022 11:03                4302
function.stats-cdf-f.php                           30-Sep-2022 11:03                4803
function.stats-cdf-gamma.php                       30-Sep-2022 11:03                4862
function.stats-cdf-laplace.php                     30-Sep-2022 11:03                4883
function.stats-cdf-logistic.php                    30-Sep-2022 11:03                4918
function.stats-cdf-negative-binomial.php           30-Sep-2022 11:03                5006
function.stats-cdf-noncentral-chisquare.php        30-Sep-2022 11:03                5108
function.stats-cdf-noncentral-f.php                30-Sep-2022 11:03                5628
function.stats-cdf-noncentral-t.php                30-Sep-2022 11:03                4968
function.stats-cdf-normal.php                      30-Sep-2022 11:03                4900
function.stats-cdf-poisson.php                     30-Sep-2022 11:03                4236
function.stats-cdf-t.php                           30-Sep-2022 11:03                4164
function.stats-cdf-uniform.php                     30-Sep-2022 11:03                4863
function.stats-cdf-weibull.php                     30-Sep-2022 11:03                4900
function.stats-covariance.php                      30-Sep-2022 11:03                2767
function.stats-dens-beta.php                       30-Sep-2022 11:03                3199
function.stats-dens-cauchy.php                     30-Sep-2022 11:03                3257
function.stats-dens-chisquare.php                  30-Sep-2022 11:03                2981
function.stats-dens-exponential.php                30-Sep-2022 11:03                2971
function.stats-dens-f.php                          30-Sep-2022 11:03                3197
function.stats-dens-gamma.php                      30-Sep-2022 11:03                3250
function.stats-dens-laplace.php                    30-Sep-2022 11:03                3284
function.stats-dens-logistic.php                   30-Sep-2022 11:03                3296
function.stats-dens-normal.php                     30-Sep-2022 11:03                3267
function.stats-dens-pmf-binomial.php               30-Sep-2022 11:03                3321
function.stats-dens-pmf-hypergeometric.php         30-Sep-2022 11:03                3919
function.stats-dens-pmf-negative-binomial.php      30-Sep-2022 11:03                3450
function.stats-dens-pmf-poisson.php                30-Sep-2022 11:03                2972
function.stats-dens-t.php                          30-Sep-2022 11:03                2885
function.stats-dens-uniform.php                    30-Sep-2022 11:03                3232
function.stats-dens-weibull.php                    30-Sep-2022 11:03                3264
function.stats-harmonic-mean.php                   30-Sep-2022 11:03                2611
function.stats-kurtosis.php                        30-Sep-2022 11:03                2528
function.stats-rand-gen-beta.php                   30-Sep-2022 11:03                2832
function.stats-rand-gen-chisquare.php              30-Sep-2022 11:03                2559
function.stats-rand-gen-exponential.php            30-Sep-2022 11:03                2557
function.stats-rand-gen-f.php                      30-Sep-2022 11:03                2886
function.stats-rand-gen-funiform.php               30-Sep-2022 11:03                2813
function.stats-rand-gen-gamma.php                  30-Sep-2022 11:03                2899
function.stats-rand-gen-ibinomial-negative.php     30-Sep-2022 11:03                2979
function.stats-rand-gen-ibinomial.php              30-Sep-2022 11:03                2903
function.stats-rand-gen-int.php                    30-Sep-2022 11:03                2170
function.stats-rand-gen-ipoisson.php               30-Sep-2022 11:03                2532
function.stats-rand-gen-iuniform.php               30-Sep-2022 11:03                2880
function.stats-rand-gen-noncentral-chisquare.php   30-Sep-2022 11:03                3021
function.stats-rand-gen-noncentral-f.php           30-Sep-2022 11:03                3320
function.stats-rand-gen-noncentral-t.php           30-Sep-2022 11:03                2934
function.stats-rand-gen-normal.php                 30-Sep-2022 11:03                2847
function.stats-rand-gen-t.php                      30-Sep-2022 11:03                2451
function.stats-rand-get-seeds.php                  30-Sep-2022 11:03                2213
function.stats-rand-phrase-to-seeds.php            30-Sep-2022 11:03                2538
function.stats-rand-ranf.php                       30-Sep-2022 11:03                2214
function.stats-rand-setall.php                     30-Sep-2022 11:03                2788
function.stats-skew.php                            30-Sep-2022 11:03                2494
function.stats-standard-deviation.php              30-Sep-2022 11:03                3388
function.stats-stat-binomial-coef.php              30-Sep-2022 11:03                2792
function.stats-stat-correlation.php                30-Sep-2022 11:03                2947
function.stats-stat-factorial.php                  30-Sep-2022 11:03                2419
function.stats-stat-independent-t.php              30-Sep-2022 11:03                3028
function.stats-stat-innerproduct.php               30-Sep-2022 11:03                2889
function.stats-stat-paired-t.php                   30-Sep-2022 11:03                2826
function.stats-stat-percentile.php                 30-Sep-2022 11:03                2744
function.stats-stat-powersum.php                   30-Sep-2022 11:03                2736
function.stats-variance.php                        30-Sep-2022 11:03                2948
function.stomp-connect-error.php                   30-Sep-2022 11:03                3552
function.stomp-version.php                         30-Sep-2022 11:03                2979
function.str-contains.php                          30-Sep-2022 11:03                8369
function.str-ends-with.php                         30-Sep-2022 11:03                8244
function.str-getcsv.php                            30-Sep-2022 11:03                3952
function.str-ireplace.php                          30-Sep-2022 11:03                8119
function.str-pad.php                               30-Sep-2022 11:03                7627
function.str-repeat.php                            30-Sep-2022 11:03                4472
function.str-replace.php                           30-Sep-2022 11:03               17231
function.str-rot13.php                             30-Sep-2022 11:03                3420
function.str-shuffle.php                           30-Sep-2022 11:03                5284
function.str-split.php                             30-Sep-2022 11:03                6758
function.str-starts-with.php                       30-Sep-2022 11:03                8274
function.str-word-count.php                        30-Sep-2022 11:03                8734
function.strcasecmp.php                            30-Sep-2022 11:03                5520
function.strchr.php                                30-Sep-2022 11:03                1618
function.strcmp.php                                30-Sep-2022 11:03                5397
function.strcoll.php                               30-Sep-2022 11:03                5404
function.strcspn.php                               30-Sep-2022 11:03                6675
function.stream-bucket-append.php                  30-Sep-2022 11:03                2063
function.stream-bucket-make-writeable.php          30-Sep-2022 11:03                4050
function.stream-bucket-new.php                     30-Sep-2022 11:03                2062
function.stream-bucket-prepend.php                 30-Sep-2022 11:03                6582
function.stream-context-create.php                 30-Sep-2022 11:03                7543
function.stream-context-get-default.php            30-Sep-2022 11:03                9140
function.stream-context-get-options.php            30-Sep-2022 11:03                4421
function.stream-context-get-params.php             30-Sep-2022 11:03                5277
function.stream-context-set-default.php            30-Sep-2022 11:03                6427
function.stream-context-set-option.php             30-Sep-2022 11:03                4980
function.stream-context-set-params.php             30-Sep-2022 11:03                4379
function.stream-copy-to-stream.php                 30-Sep-2022 11:03                7335
function.stream-filter-append.php                  30-Sep-2022 11:03               10860
function.stream-filter-prepend.php                 30-Sep-2022 11:03                7621
function.stream-filter-register.php                30-Sep-2022 11:03               19754
function.stream-filter-remove.php                  30-Sep-2022 11:03                6474
function.stream-get-contents.php                   30-Sep-2022 11:03                8280
function.stream-get-filters.php                    30-Sep-2022 11:03                3935
function.stream-get-line.php                       30-Sep-2022 11:03                4923
function.stream-get-meta-data.php                  30-Sep-2022 11:03               14684
function.stream-get-transports.php                 30-Sep-2022 11:03                3912
function.stream-get-wrappers.php                   30-Sep-2022 11:03                4760
function.stream-is-local.php                       30-Sep-2022 11:03                3846
function.stream-isatty.php                         30-Sep-2022 11:03                3709
function.stream-notification-callback.php          30-Sep-2022 11:03               25212
function.stream-register-wrapper.php               30-Sep-2022 11:03                1880
function.stream-resolve-include-path.php           30-Sep-2022 11:03                4041
function.stream-select.php                         30-Sep-2022 11:03               15835
function.stream-set-blocking.php                   30-Sep-2022 11:03                4443
function.stream-set-chunk-size.php                 30-Sep-2022 11:03                3201
function.stream-set-read-buffer.php                30-Sep-2022 11:03                3537
function.stream-set-timeout.php                    30-Sep-2022 11:03                8099
function.stream-set-write-buffer.php               30-Sep-2022 11:03                5826
function.stream-socket-accept.php                  30-Sep-2022 11:03                7239
function.stream-socket-client.php                  30-Sep-2022 11:03               17217
function.stream-socket-enable-crypto.php           30-Sep-2022 11:03               11153
function.stream-socket-get-name.php                30-Sep-2022 11:03                3531
function.stream-socket-pair.php                    30-Sep-2022 11:03                8982
function.stream-socket-recvfrom.php                30-Sep-2022 11:03               10706
function.stream-socket-sendto.php                  30-Sep-2022 11:03                7282
function.stream-socket-server.php                  30-Sep-2022 11:03               14920
function.stream-socket-shutdown.php                30-Sep-2022 11:03                6164
function.stream-supports-lock.php                  30-Sep-2022 11:03                2978
function.stream-wrapper-register.php               30-Sep-2022 11:03                9063
function.stream-wrapper-restore.php                30-Sep-2022 11:03                2671
function.stream-wrapper-unregister.php             30-Sep-2022 11:03                2872
function.strftime.php                              30-Sep-2022 11:03               60724
function.strip-tags.php                            30-Sep-2022 11:03                8071
function.stripcslashes.php                         30-Sep-2022 11:03                2935
function.stripos.php                               30-Sep-2022 11:03                9895
function.stripslashes.php                          30-Sep-2022 11:03                8040
function.stristr.php                               30-Sep-2022 11:03                9416
function.strlen.php                                30-Sep-2022 11:03                5318
function.strnatcasecmp.php                         30-Sep-2022 11:03                5026
function.strnatcmp.php                             30-Sep-2022 11:03                7996
function.strncasecmp.php                           30-Sep-2022 11:03                4547
function.strncmp.php                               30-Sep-2022 11:03                4518
function.strpbrk.php                               30-Sep-2022 11:03                5042
function.strpos.php                                30-Sep-2022 11:03               12824
function.strptime.php                              30-Sep-2022 11:03               10399
function.strrchr.php                               30-Sep-2022 11:03                6468
function.strrev.php                                30-Sep-2022 11:03                3081
function.strripos.php                              30-Sep-2022 11:03                8022
function.strrpos.php                               30-Sep-2022 11:03                9638
function.strspn.php                                30-Sep-2022 11:03                8711
function.strstr.php                                30-Sep-2022 11:03                7772
function.strtok.php                                30-Sep-2022 11:03               12438
function.strtolower.php                            30-Sep-2022 11:03                4892
function.strtotime.php                             30-Sep-2022 11:03               12364
function.strtoupper.php                            30-Sep-2022 11:03                4890
function.strtr.php                                 30-Sep-2022 11:03               10638
function.strval.php                                30-Sep-2022 11:03                2587
function.substr-compare.php                        30-Sep-2022 11:03               10065
function.substr-count.php                          30-Sep-2022 11:03                9142
function.substr-replace.php                        30-Sep-2022 11:03               16015
function.substr.php                                30-Sep-2022 11:03               22635
function.svn-add.php                               30-Sep-2022 11:03                5656
function.svn-auth-get-parameter.php                30-Sep-2022 11:03                3777
function.svn-auth-set-parameter.php                30-Sep-2022 11:03                5265
function.svn-blame.php                             30-Sep-2022 11:03                4750
function.svn-cat.php                               30-Sep-2022 11:03                4613
function.svn-checkout.php                          30-Sep-2022 11:03                7023
function.svn-cleanup.php                           30-Sep-2022 11:03                4934
function.svn-client-version.php                    30-Sep-2022 11:03                3338
function.svn-commit.php                            30-Sep-2022 11:03                7355
function.svn-delete.php                            30-Sep-2022 11:03                4257
function.svn-diff.php                              30-Sep-2022 11:03               13231
function.svn-export.php                            30-Sep-2022 11:03                4904
function.svn-fs-abort-txn.php                      30-Sep-2022 11:03                2903
function.svn-fs-apply-text.php                     30-Sep-2022 11:03                2526
function.svn-fs-begin-txn2.php                     30-Sep-2022 11:03                2471
function.svn-fs-change-node-prop.php               30-Sep-2022 11:03                2882
function.svn-fs-check-path.php                     30-Sep-2022 11:03                2577
function.svn-fs-contents-changed.php               30-Sep-2022 11:03                2883
function.svn-fs-copy.php                           30-Sep-2022 11:03                3724
function.svn-fs-delete.php                         30-Sep-2022 11:03                3125
function.svn-fs-dir-entries.php                    30-Sep-2022 11:03                2590
function.svn-fs-file-contents.php                  30-Sep-2022 11:03                2607
function.svn-fs-file-length.php                    30-Sep-2022 11:03                2536
function.svn-fs-is-dir.php                         30-Sep-2022 11:03                3172
function.svn-fs-is-file.php                        30-Sep-2022 11:03                3160
function.svn-fs-make-dir.php                       30-Sep-2022 11:03                3149
function.svn-fs-make-file.php                      30-Sep-2022 11:03                3166
function.svn-fs-node-created-rev.php               30-Sep-2022 11:03                2579
function.svn-fs-node-prop.php                      30-Sep-2022 11:03                2615
function.svn-fs-props-changed.php                  30-Sep-2022 11:03                2870
function.svn-fs-revision-prop.php                  30-Sep-2022 11:03                2630
function.svn-fs-revision-root.php                  30-Sep-2022 11:03                2554
function.svn-fs-txn-root.php                       30-Sep-2022 11:03                2377
function.svn-fs-youngest-rev.php                   30-Sep-2022 11:03                2425
function.svn-import.php                            30-Sep-2022 11:03                5645
function.svn-log.php                               30-Sep-2022 11:03                8650
function.svn-ls.php                                30-Sep-2022 11:03                6919
function.svn-mkdir.php                             30-Sep-2022 11:03                2961
function.svn-repos-create.php                      30-Sep-2022 11:03                2685
function.svn-repos-fs-begin-txn-for-commit.php     30-Sep-2022 11:03                2939
function.svn-repos-fs-commit-txn.php               30-Sep-2022 11:03                2480
function.svn-repos-fs.php                          30-Sep-2022 11:03                2374
function.svn-repos-hotcopy.php                     30-Sep-2022 11:03                2633
function.svn-repos-open.php                        30-Sep-2022 11:03                2350
function.svn-repos-recover.php                     30-Sep-2022 11:03                2399
function.svn-revert.php                            30-Sep-2022 11:03                3277
function.svn-status.php                            30-Sep-2022 11:03               14422
function.svn-update.php                            30-Sep-2022 11:03                5765
function.swoole-async-dns-lookup.php               30-Sep-2022 11:03                3535
function.swoole-async-read.php                     30-Sep-2022 11:03                4141
function.swoole-async-readfile.php                 30-Sep-2022 11:03                3560
function.swoole-async-set.php                      30-Sep-2022 11:03                2295
function.swoole-async-write.php                    30-Sep-2022 11:03                3400
function.swoole-async-writefile.php                30-Sep-2022 11:03                3428
function.swoole-clear-error.php                    30-Sep-2022 11:03                2198
function.swoole-client-select.php                  30-Sep-2022 11:03                3188
function.swoole-cpu-num.php                        30-Sep-2022 11:03                2022
function.swoole-errno.php                          30-Sep-2022 11:03                1999
function.swoole-error-log.php                      30-Sep-2022 11:03                2962
function.swoole-event-add.php                      30-Sep-2022 11:03                3311
function.swoole-event-defer.php                    30-Sep-2022 11:03                2449
function.swoole-event-del.php                      30-Sep-2022 11:03                2357
function.swoole-event-exit.php                     30-Sep-2022 11:03                2098
function.swoole-event-set.php                      30-Sep-2022 11:03                3298
function.swoole-event-wait.php                     30-Sep-2022 11:03                2069
function.swoole-event-write.php                    30-Sep-2022 11:03                2573
function.swoole-get-local-ip.php                   30-Sep-2022 11:03                2093
function.swoole-last-error.php                     30-Sep-2022 11:03                2048
function.swoole-load-module.php                    30-Sep-2022 11:03                2245
function.swoole-select.php                         30-Sep-2022 11:03                3155
function.swoole-set-process-name.php               30-Sep-2022 11:03                2463
function.swoole-strerror.php                       30-Sep-2022 11:03                2384
function.swoole-timer-after.php                    30-Sep-2022 11:03                2917
function.swoole-timer-exists.php                   30-Sep-2022 11:03                2280
function.swoole-timer-tick.php                     30-Sep-2022 11:03                2790
function.swoole-version.php                        30-Sep-2022 11:03                2025
function.symlink.php                               30-Sep-2022 11:03                5529
function.sys-get-temp-dir.php                      30-Sep-2022 11:03                3790
function.sys-getloadavg.php                        30-Sep-2022 11:03                3701
function.syslog.php                                30-Sep-2022 11:03                9012
function.system.php                                30-Sep-2022 11:03                7272
function.taint.php                                 30-Sep-2022 11:03                2466
function.tan.php                                   30-Sep-2022 11:03                4177
function.tanh.php                                  30-Sep-2022 11:03                3047
function.tcpwrap-check.php                         30-Sep-2022 11:03                5344
function.tempnam.php                               30-Sep-2022 11:03                7376
function.textdomain.php                            30-Sep-2022 11:03                3004
function.tidy-access-count.php                     30-Sep-2022 11:03                6505
function.tidy-config-count.php                     30-Sep-2022 11:03                4331
function.tidy-error-count.php                      30-Sep-2022 11:03                5281
function.tidy-get-output.php                       30-Sep-2022 11:03                4182
function.tidy-warning-count.php                    30-Sep-2022 11:03                4890
function.time-nanosleep.php                        30-Sep-2022 11:03                8951
function.time-sleep-until.php                      30-Sep-2022 11:03                6035
function.time.php                                  30-Sep-2022 11:03                4387
function.timezone-abbreviations-list.php           30-Sep-2022 11:03                1879
function.timezone-identifiers-list.php             30-Sep-2022 11:03                1895
function.timezone-location-get.php                 30-Sep-2022 11:03                1851
function.timezone-name-from-abbr.php               30-Sep-2022 11:03                5933
function.timezone-name-get.php                     30-Sep-2022 11:03                1795
function.timezone-offset-get.php                   30-Sep-2022 11:03                1793
function.timezone-open.php                         30-Sep-2022 11:03                1781
function.timezone-transitions-get.php              30-Sep-2022 11:03                1854
function.timezone-version-get.php                  30-Sep-2022 11:03                4009
function.tmpfile.php                               30-Sep-2022 11:03                5060
function.token-get-all.php                         30-Sep-2022 11:03                6794
function.token-name.php                            30-Sep-2022 11:03                4039
function.touch.php                                 30-Sep-2022 11:03                8036
function.trader-acos.php                           30-Sep-2022 11:03                2318
function.trader-ad.php                             30-Sep-2022 11:03                3053
function.trader-add.php                            30-Sep-2022 11:03                2595
function.trader-adosc.php                          30-Sep-2022 11:03                3805
function.trader-adx.php                            30-Sep-2022 11:03                3145
function.trader-adxr.php                           30-Sep-2022 11:03                3156
function.trader-apo.php                            30-Sep-2022 11:03                3359
function.trader-aroon.php                          30-Sep-2022 11:03                2773
function.trader-aroonosc.php                       30-Sep-2022 11:03                2810
function.trader-asin.php                           30-Sep-2022 11:03                2336
function.trader-atan.php                           30-Sep-2022 11:03                2329
function.trader-atr.php                            30-Sep-2022 11:03                3135
function.trader-avgprice.php                       30-Sep-2022 11:03                3110
function.trader-bbands.php                         30-Sep-2022 11:03                4064
function.trader-beta.php                           30-Sep-2022 11:03                2746
function.trader-bop.php                            30-Sep-2022 11:03                3059
function.trader-cci.php                            30-Sep-2022 11:03                3140
function.trader-cdl2crows.php                      30-Sep-2022 11:03                3132
function.trader-cdl3blackcrows.php                 30-Sep-2022 11:03                3194
function.trader-cdl3inside.php                     30-Sep-2022 11:03                3175
function.trader-cdl3linestrike.php                 30-Sep-2022 11:03                3198
function.trader-cdl3outside.php                    30-Sep-2022 11:03                3190
function.trader-cdl3starsinsouth.php               30-Sep-2022 11:03                3239
function.trader-cdl3whitesoldiers.php              30-Sep-2022 11:03                3263
function.trader-cdlabandonedbaby.php               30-Sep-2022 11:03                3588
function.trader-cdladvanceblock.php                30-Sep-2022 11:03                3216
function.trader-cdlbelthold.php                    30-Sep-2022 11:03                3172
function.trader-cdlbreakaway.php                   30-Sep-2022 11:03                3186
function.trader-cdlclosingmarubozu.php             30-Sep-2022 11:03                3257
function.trader-cdlconcealbabyswall.php            30-Sep-2022 11:03                3280
function.trader-cdlcounterattack.php               30-Sep-2022 11:03                3244
function.trader-cdldarkcloudcover.php              30-Sep-2022 11:03                3582
function.trader-cdldoji.php                        30-Sep-2022 11:03                3129
function.trader-cdldojistar.php                    30-Sep-2022 11:03                3164
function.trader-cdldragonflydoji.php               30-Sep-2022 11:03                3219
function.trader-cdlengulfing.php                   30-Sep-2022 11:03                3204
function.trader-cdleveningdojistar.php             30-Sep-2022 11:03                3599
function.trader-cdleveningstar.php                 30-Sep-2022 11:03                3576
function.trader-cdlgapsidesidewhite.php            30-Sep-2022 11:03                3287
function.trader-cdlgravestonedoji.php              30-Sep-2022 11:03                3240
function.trader-cdlhammer.php                      30-Sep-2022 11:03                3155
function.trader-cdlhangingman.php                  30-Sep-2022 11:03                3176
function.trader-cdlharami.php                      30-Sep-2022 11:03                3157
function.trader-cdlharamicross.php                 30-Sep-2022 11:03                3199
function.trader-cdlhighwave.php                    30-Sep-2022 11:03                3173
function.trader-cdlhikkake.php                     30-Sep-2022 11:03                3162
function.trader-cdlhikkakemod.php                  30-Sep-2022 11:03                3203
function.trader-cdlhomingpigeon.php                30-Sep-2022 11:03                3224
function.trader-cdlidentical3crows.php             30-Sep-2022 11:03                3248
function.trader-cdlinneck.php                      30-Sep-2022 11:03                3174
function.trader-cdlinvertedhammer.php              30-Sep-2022 11:03                3222
function.trader-cdlkicking.php                     30-Sep-2022 11:03                3176
function.trader-cdlkickingbylength.php             30-Sep-2022 11:03                3282
function.trader-cdlladderbottom.php                30-Sep-2022 11:03                3232
function.trader-cdllongleggeddoji.php              30-Sep-2022 11:03                3237
function.trader-cdllongline.php                    30-Sep-2022 11:03                3181
function.trader-cdlmarubozu.php                    30-Sep-2022 11:03                3167
function.trader-cdlmatchinglow.php                 30-Sep-2022 11:03                3193
function.trader-cdlmathold.php                     30-Sep-2022 11:03                3522
function.trader-cdlmorningdojistar.php             30-Sep-2022 11:03                3595
function.trader-cdlmorningstar.php                 30-Sep-2022 11:03                3556
function.trader-cdlonneck.php                      30-Sep-2022 11:03                3154
function.trader-cdlpiercing.php                    30-Sep-2022 11:03                3171
function.trader-cdlrickshawman.php                 30-Sep-2022 11:03                3211
function.trader-cdlrisefall3methods.php            30-Sep-2022 11:03                3281
function.trader-cdlseparatinglines.php             30-Sep-2022 11:03                3263
function.trader-cdlshootingstar.php                30-Sep-2022 11:03                3222
function.trader-cdlshortline.php                   30-Sep-2022 11:03                3194
function.trader-cdlspinningtop.php                 30-Sep-2022 11:03                3209
function.trader-cdlstalledpattern.php              30-Sep-2022 11:03                3244
function.trader-cdlsticksandwich.php               30-Sep-2022 11:03                3225
function.trader-cdltakuri.php                      30-Sep-2022 11:03                3196
function.trader-cdltasukigap.php                   30-Sep-2022 11:03                3171
function.trader-cdlthrusting.php                   30-Sep-2022 11:03                3180
function.trader-cdltristar.php                     30-Sep-2022 11:03                3168
function.trader-cdlunique3river.php                30-Sep-2022 11:03                3219
function.trader-cdlupsidegap2crows.php             30-Sep-2022 11:03                3267
function.trader-cdlxsidegap3methods.php            30-Sep-2022 11:03                3266
function.trader-ceil.php                           30-Sep-2022 11:03                2353
function.trader-cmo.php                            30-Sep-2022 11:03                2516
function.trader-correl.php                         30-Sep-2022 11:03                2798
function.trader-cos.php                            30-Sep-2022 11:03                2319
function.trader-cosh.php                           30-Sep-2022 11:03                2335
function.trader-dema.php                           30-Sep-2022 11:03                2527
function.trader-div.php                            30-Sep-2022 11:03                2611
function.trader-dx.php                             30-Sep-2022 11:03                3121
function.trader-ema.php                            30-Sep-2022 11:03                2510
function.trader-errno.php                          30-Sep-2022 11:03                2092
function.trader-exp.php                            30-Sep-2022 11:03                2363
function.trader-floor.php                          30-Sep-2022 11:03                2345
function.trader-get-compat.php                     30-Sep-2022 11:03                2282
function.trader-get-unstable-period.php            30-Sep-2022 11:03                2570
function.trader-ht-dcperiod.php                    30-Sep-2022 11:03                2333
function.trader-ht-dcphase.php                     30-Sep-2022 11:03                2304
function.trader-ht-phasor.php                      30-Sep-2022 11:03                2285
function.trader-ht-sine.php                        30-Sep-2022 11:03                2264
function.trader-ht-trendline.php                   30-Sep-2022 11:03                2325
function.trader-ht-trendmode.php                   30-Sep-2022 11:03                2315
function.trader-kama.php                           30-Sep-2022 11:03                2565
function.trader-linearreg-angle.php                30-Sep-2022 11:03                2659
function.trader-linearreg-intercept.php            30-Sep-2022 11:03                2717
function.trader-linearreg-slope.php                30-Sep-2022 11:03                2669
function.trader-linearreg.php                      30-Sep-2022 11:03                2581
function.trader-ln.php                             30-Sep-2022 11:03                2321
function.trader-log10.php                          30-Sep-2022 11:03                2325
function.trader-ma.php                             30-Sep-2022 11:03                2877
function.trader-macd.php                           30-Sep-2022 11:03                3344
function.trader-macdext.php                        30-Sep-2022 11:03                4675
function.trader-macdfix.php                        30-Sep-2022 11:03                2611
function.trader-mama.php                           30-Sep-2022 11:03                2898
function.trader-mavp.php                           30-Sep-2022 11:03                3694
function.trader-max.php                            30-Sep-2022 11:03                2531
function.trader-maxindex.php                       30-Sep-2022 11:03                2588
function.trader-medprice.php                       30-Sep-2022 11:03                2494
function.trader-mfi.php                            30-Sep-2022 11:03                3424
function.trader-midpoint.php                       30-Sep-2022 11:03                2562
function.trader-midprice.php                       30-Sep-2022 11:03                2824
function.trader-min.php                            30-Sep-2022 11:03                2538
function.trader-minindex.php                       30-Sep-2022 11:03                2583
function.trader-minmax.php                         30-Sep-2022 11:03                2587
function.trader-minmaxindex.php                    30-Sep-2022 11:03                2638
function.trader-minus-di.php                       30-Sep-2022 11:03                3208
function.trader-minus-dm.php                       30-Sep-2022 11:03                2824
function.trader-mom.php                            30-Sep-2022 11:03                2502
function.trader-mult.php                           30-Sep-2022 11:03                2611
function.trader-natr.php                           30-Sep-2022 11:03                3146
function.trader-obv.php                            30-Sep-2022 11:03                2449
function.trader-plus-di.php                        30-Sep-2022 11:03                3179
function.trader-plus-dm.php                        30-Sep-2022 11:03                2811
function.trader-ppo.php                            30-Sep-2022 11:03                3363
function.trader-roc.php                            30-Sep-2022 11:03                2526
function.trader-rocp.php                           30-Sep-2022 11:03                2554
function.trader-rocr.php                           30-Sep-2022 11:03                2539
function.trader-rocr100.php                        30-Sep-2022 11:03                2579
function.trader-rsi.php                            30-Sep-2022 11:03                2507
function.trader-sar.php                            30-Sep-2022 11:03                3401
function.trader-sarext.php                         30-Sep-2022 11:03                6489
function.trader-set-compat.php                     30-Sep-2022 11:03                2504
function.trader-set-unstable-period.php            30-Sep-2022 11:03                3038
function.trader-sin.php                            30-Sep-2022 11:03                2343
function.trader-sinh.php                           30-Sep-2022 11:03                2331
function.trader-sma.php                            30-Sep-2022 11:03                2507
function.trader-sqrt.php                           30-Sep-2022 11:03                2324
function.trader-stddev.php                         30-Sep-2022 11:03                2797
function.trader-stoch.php                          30-Sep-2022 11:03                4797
function.trader-stochf.php                         30-Sep-2022 11:03                4012
function.trader-stochrsi.php                       30-Sep-2022 11:03                3822
function.trader-sub.php                            30-Sep-2022 11:03                2616
function.trader-sum.php                            30-Sep-2022 11:03                2489
function.trader-t3.php                             30-Sep-2022 11:03                2816
function.trader-tan.php                            30-Sep-2022 11:03                2312
function.trader-tanh.php                           30-Sep-2022 11:03                2336
function.trader-tema.php                           30-Sep-2022 11:03                2533
function.trader-trange.php                         30-Sep-2022 11:03                2722
function.trader-trima.php                          30-Sep-2022 11:03                2535
function.trader-trix.php                           30-Sep-2022 11:03                2545
function.trader-tsf.php                            30-Sep-2022 11:03                2514
function.trader-typprice.php                       30-Sep-2022 11:03                2745
function.trader-ultosc.php                         30-Sep-2022 11:03                3895
function.trader-var.php                            30-Sep-2022 11:03                2767
function.trader-wclprice.php                       30-Sep-2022 11:03                2750
function.trader-willr.php                          30-Sep-2022 11:03                3152
function.trader-wma.php                            30-Sep-2022 11:03                2531
function.trait-exists.php                          30-Sep-2022 11:03                2671
function.trigger-error.php                         30-Sep-2022 11:03                6069
function.trim.php                                  30-Sep-2022 11:03               12823
function.uasort.php                                30-Sep-2022 11:03                9470
function.ucfirst.php                               30-Sep-2022 11:03                5428
function.ucwords.php                               30-Sep-2022 11:03                8090
function.ui-draw-text-font-fontfamilies.php        30-Sep-2022 11:04                2234
function.ui-quit.php                               30-Sep-2022 11:04                1965
function.ui-run.php                                30-Sep-2022 11:04                2303
function.uksort.php                                30-Sep-2022 11:03                8891
function.umask.php                                 30-Sep-2022 11:03                4801
function.uniqid.php                                30-Sep-2022 11:03                7056
function.unixtojd.php                              30-Sep-2022 11:03                2776
function.unlink.php                                30-Sep-2022 11:03                5226
function.unpack.php                                30-Sep-2022 11:03               10143
function.unregister-tick-function.php              30-Sep-2022 11:03                3064
function.unserialize.php                           30-Sep-2022 11:03               10976
function.unset.php                                 30-Sep-2022 11:03               14788
function.untaint.php                               30-Sep-2022 11:03                2322
function.uopz-add-function.php                     30-Sep-2022 11:03                6519
function.uopz-allow-exit.php                       30-Sep-2022 11:03                4497
function.uopz-backup.php                           30-Sep-2022 11:03                4325
function.uopz-compose.php                          30-Sep-2022 11:03                6822
function.uopz-copy.php                             30-Sep-2022 11:03                5037
function.uopz-del-function.php                     30-Sep-2022 11:03                6067
function.uopz-delete.php                           30-Sep-2022 11:03                5791
function.uopz-extend.php                           30-Sep-2022 11:03                4704
function.uopz-flags.php                            30-Sep-2022 11:03               10644
function.uopz-function.php                         30-Sep-2022 11:03                7003
function.uopz-get-exit-status.php                  30-Sep-2022 11:03                4120
function.uopz-get-hook.php                         30-Sep-2022 11:03                5124
function.uopz-get-mock.php                         30-Sep-2022 11:03                5077
function.uopz-get-property.php                     30-Sep-2022 11:03                6057
function.uopz-get-return.php                       30-Sep-2022 11:03                4286
function.uopz-get-static.php                       30-Sep-2022 11:03                4754
function.uopz-implement.php                        30-Sep-2022 11:03                4729
function.uopz-overload.php                         30-Sep-2022 11:03                3810
function.uopz-redefine.php                         30-Sep-2022 11:03                4772
function.uopz-rename.php                           30-Sep-2022 11:03                6485
function.uopz-restore.php                          30-Sep-2022 11:03                4683
function.uopz-set-hook.php                         30-Sep-2022 11:03                5292
function.uopz-set-mock.php                         30-Sep-2022 11:03               12482
function.uopz-set-property.php                     30-Sep-2022 11:03                7512
function.uopz-set-return.php                       30-Sep-2022 11:03                9302
function.uopz-set-static.php                       30-Sep-2022 11:03                5387
function.uopz-undefine.php                         30-Sep-2022 11:03                4234
function.uopz-unset-hook.php                       30-Sep-2022 11:03                5186
function.uopz-unset-mock.php                       30-Sep-2022 11:03                5408
function.uopz-unset-return.php                     30-Sep-2022 11:03                4582
function.urldecode.php                             30-Sep-2022 11:03                6393
function.urlencode.php                             30-Sep-2022 11:03                7765
function.use-soap-error-handler.php                30-Sep-2022 11:03                3575
function.user-error.php                            30-Sep-2022 11:03                1671
function.usleep.php                                30-Sep-2022 11:03                4886
function.usort.php                                 30-Sep-2022 11:03               25119
function.utf8-decode.php                           30-Sep-2022 11:03                8916
function.utf8-encode.php                           30-Sep-2022 11:03                7266
function.var-dump.php                              30-Sep-2022 11:03                6764
function.var-export.php                            30-Sep-2022 11:03               16676
function.var-representation.php                    30-Sep-2022 11:03               14227
function.variant-abs.php                           30-Sep-2022 11:03                3966
function.variant-add.php                           30-Sep-2022 11:03                5344
function.variant-and.php                           30-Sep-2022 11:03                6048
function.variant-cast.php                          30-Sep-2022 11:03                3448
function.variant-cat.php                           30-Sep-2022 11:03                4562
function.variant-cmp.php                           30-Sep-2022 11:03                6997
function.variant-date-from-timestamp.php           30-Sep-2022 11:03                3499
function.variant-date-to-timestamp.php             30-Sep-2022 11:03                3551
function.variant-div.php                           30-Sep-2022 11:03                6140
function.variant-eqv.php                           30-Sep-2022 11:03                4171
function.variant-fix.php                           30-Sep-2022 11:03                5351
function.variant-get-type.php                      30-Sep-2022 11:03                3381
function.variant-idiv.php                          30-Sep-2022 11:03                5563
function.variant-imp.php                           30-Sep-2022 11:03                5591
function.variant-int.php                           30-Sep-2022 11:03                4849
function.variant-mod.php                           30-Sep-2022 11:03                4639
function.variant-mul.php                           30-Sep-2022 11:03                5648
function.variant-neg.php                           30-Sep-2022 11:03                3631
function.variant-not.php                           30-Sep-2022 11:03                3795
function.variant-or.php                            30-Sep-2022 11:03                6223
function.variant-pow.php                           30-Sep-2022 11:03                4462
function.variant-round.php                         30-Sep-2022 11:03                4161
function.variant-set-type.php                      30-Sep-2022 11:03                3564
function.variant-set.php                           30-Sep-2022 11:03                2869
function.variant-sub.php                           30-Sep-2022 11:03                5306
function.variant-xor.php                           30-Sep-2022 11:03                5575
function.version-compare.php                       30-Sep-2022 11:03               11193
function.vfprintf.php                              30-Sep-2022 11:03                5977
function.virtual.php                               30-Sep-2022 11:03                4888
function.vprintf.php                               30-Sep-2022 11:03                4677
function.vsprintf.php                              30-Sep-2022 11:03               14744
function.wddx-add-vars.php                         30-Sep-2022 11:03                3611
function.wddx-deserialize.php                      30-Sep-2022 11:03                3485
function.wddx-packet-end.php                       30-Sep-2022 11:03                2695
function.wddx-packet-start.php                     30-Sep-2022 11:03                2822
function.wddx-serialize-value.php                  30-Sep-2022 11:03                3101
function.wddx-serialize-vars.php                   30-Sep-2022 11:03                5987
function.win32-continue-service.php                30-Sep-2022 11:03                6331
function.win32-create-service.php                  30-Sep-2022 11:03               32844
function.win32-delete-service.php                  30-Sep-2022 11:03                6760
function.win32-get-last-control-message.php        30-Sep-2022 11:03                7064
function.win32-pause-service.php                   30-Sep-2022 11:03                6332
function.win32-query-service-status.php            30-Sep-2022 11:03                8249
function.win32-send-custom-control.php             30-Sep-2022 11:03                6887
function.win32-set-service-exit-code.php           30-Sep-2022 11:03                5621
function.win32-set-service-exit-mode.php           30-Sep-2022 11:03                5664
function.win32-set-service-status.php              30-Sep-2022 11:03                8039
function.win32-start-service-ctrl-dispatcher.php   30-Sep-2022 11:03               10922
function.win32-start-service.php                   30-Sep-2022 11:03                6336
function.win32-stop-service.php                    30-Sep-2022 11:03                6251
function.wincache-fcache-fileinfo.php              30-Sep-2022 11:03                9101
function.wincache-fcache-meminfo.php               30-Sep-2022 11:03                7022
function.wincache-lock.php                         30-Sep-2022 11:03                8515
function.wincache-ocache-fileinfo.php              30-Sep-2022 11:03                9782
function.wincache-ocache-meminfo.php               30-Sep-2022 11:03                7225
function.wincache-refresh-if-changed.php           30-Sep-2022 11:03                7792
function.wincache-rplist-fileinfo.php              30-Sep-2022 11:03                7471
function.wincache-rplist-meminfo.php               30-Sep-2022 11:03                7137
function.wincache-scache-info.php                  30-Sep-2022 11:03                9374
function.wincache-scache-meminfo.php               30-Sep-2022 11:03                6595
function.wincache-ucache-add.php                   30-Sep-2022 11:03               13165
function.wincache-ucache-cas.php                   30-Sep-2022 11:03                6033
function.wincache-ucache-clear.php                 30-Sep-2022 11:03                7502
function.wincache-ucache-dec.php                   30-Sep-2022 11:03                6071
function.wincache-ucache-delete.php                30-Sep-2022 11:03               11383
function.wincache-ucache-exists.php                30-Sep-2022 11:03                6028
function.wincache-ucache-get.php                   30-Sep-2022 11:03               10474
function.wincache-ucache-inc.php                   30-Sep-2022 11:03                6063
function.wincache-ucache-info.php                  30-Sep-2022 11:03               11093
function.wincache-ucache-meminfo.php               30-Sep-2022 11:03                6799
function.wincache-ucache-set.php                   30-Sep-2022 11:03               13393
function.wincache-unlock.php                       30-Sep-2022 11:03                7884
function.wordwrap.php                              30-Sep-2022 11:03                8754
function.xattr-get.php                             30-Sep-2022 11:03                5718
function.xattr-list.php                            30-Sep-2022 11:03                6337
function.xattr-remove.php                          30-Sep-2022 11:03                5907
function.xattr-set.php                             30-Sep-2022 11:03                7523
function.xattr-supported.php                       30-Sep-2022 11:03                5037
function.xdiff-file-bdiff-size.php                 30-Sep-2022 11:03                4789
function.xdiff-file-bdiff.php                      30-Sep-2022 11:03                5644
function.xdiff-file-bpatch.php                     30-Sep-2022 11:03                6306
function.xdiff-file-diff-binary.php                30-Sep-2022 11:03                6079
function.xdiff-file-diff.php                       30-Sep-2022 11:03                6874
function.xdiff-file-merge3.php                     30-Sep-2022 11:03                6622
function.xdiff-file-patch-binary.php               30-Sep-2022 11:03                6440
function.xdiff-file-patch.php                      30-Sep-2022 11:03                8691
function.xdiff-file-rabdiff.php                    30-Sep-2022 11:03                6200
function.xdiff-string-bdiff-size.php               30-Sep-2022 11:03                5117
function.xdiff-string-bdiff.php                    30-Sep-2022 11:03                3611
function.xdiff-string-bpatch.php                   30-Sep-2022 11:03                3724
function.xdiff-string-diff-binary.php              30-Sep-2022 11:03                4114
function.xdiff-string-diff.php                     30-Sep-2022 11:03                7364
function.xdiff-string-merge3.php                   30-Sep-2022 11:03                4496
function.xdiff-string-patch-binary.php             30-Sep-2022 11:03                4271
function.xdiff-string-patch.php                    30-Sep-2022 11:03                8053
function.xdiff-string-rabdiff.php                  30-Sep-2022 11:03                4198
function.xhprof-disable.php                        30-Sep-2022 11:03                3810
function.xhprof-enable.php                         30-Sep-2022 11:03                7642
function.xhprof-sample-disable.php                 30-Sep-2022 11:03                4614
function.xhprof-sample-enable.php                  30-Sep-2022 11:03                3358
function.xml-error-string.php                      30-Sep-2022 11:03                3138
function.xml-get-current-byte-index.php            30-Sep-2022 11:03                3576
function.xml-get-current-column-number.php         30-Sep-2022 11:03                3504
function.xml-get-current-line-number.php           30-Sep-2022 11:03                3318
function.xml-get-error-code.php                    30-Sep-2022 11:03                3119
function.xml-parse-into-struct.php                 30-Sep-2022 11:03               19138
function.xml-parse.php                             30-Sep-2022 11:03                4488
function.xml-parser-create-ns.php                  30-Sep-2022 11:03                3611
function.xml-parser-create.php                     30-Sep-2022 11:03                3111
function.xml-parser-free.php                       30-Sep-2022 11:03                2338
function.xml-parser-get-option.php                 30-Sep-2022 11:03                3210
function.xml-parser-set-option.php                 30-Sep-2022 11:03                4840
function.xml-set-character-data-handler.php        30-Sep-2022 11:03                4959
function.xml-set-default-handler.php               30-Sep-2022 11:03                4826
function.xml-set-element-handler.php               30-Sep-2022 11:03                7452
function.xml-set-end-namespace-decl-handler.php    30-Sep-2022 11:03                6046
function.xml-set-external-entity-ref-handler.php   30-Sep-2022 11:03                6832
function.xml-set-notation-decl-handler.php         30-Sep-2022 11:03                6553
function.xml-set-object.php                        30-Sep-2022 11:03                8359
function.xml-set-processing-instruction-handler..> 30-Sep-2022 11:03                5928
function.xml-set-start-namespace-decl-handler.php  30-Sep-2022 11:03                6143
function.xml-set-unparsed-entity-decl-handler.php  30-Sep-2022 11:03                7246
function.xmlrpc-decode-request.php                 30-Sep-2022 11:03                2579
function.xmlrpc-decode.php                         30-Sep-2022 11:03                3977
function.xmlrpc-encode-request.php                 30-Sep-2022 11:03                8720
function.xmlrpc-encode.php                         30-Sep-2022 11:03                2272
function.xmlrpc-get-type.php                       30-Sep-2022 11:03                6475
function.xmlrpc-is-fault.php                       30-Sep-2022 11:03                3625
function.xmlrpc-parse-method-descriptions.php      30-Sep-2022 11:03                2381
function.xmlrpc-server-add-introspection-data.php  30-Sep-2022 11:03                2506
function.xmlrpc-server-call-method.php             30-Sep-2022 11:03                2896
function.xmlrpc-server-create.php                  30-Sep-2022 11:03                2154
function.xmlrpc-server-destroy.php                 30-Sep-2022 11:03                2299
function.xmlrpc-server-register-introspection-c..> 30-Sep-2022 11:03                2584
function.xmlrpc-server-register-method.php         30-Sep-2022 11:03                2597
function.xmlrpc-set-type.php                       30-Sep-2022 11:03                5167
function.yaml-emit-file.php                        30-Sep-2022 11:03                5780
function.yaml-emit.php                             30-Sep-2022 11:03               12764
function.yaml-parse-file.php                       30-Sep-2022 11:03                5669
function.yaml-parse-url.php                        30-Sep-2022 11:03                5997
function.yaml-parse.php                            30-Sep-2022 11:03                9914
function.yaz-addinfo.php                           30-Sep-2022 11:03                3259
function.yaz-ccl-conf.php                          30-Sep-2022 11:03                5613
function.yaz-ccl-parse.php                         30-Sep-2022 11:03                6555
function.yaz-close.php                             30-Sep-2022 11:03                3250
function.yaz-connect.php                           30-Sep-2022 11:03                8893
function.yaz-database.php                          30-Sep-2022 11:03                3119
function.yaz-element.php                           30-Sep-2022 11:03                3553
function.yaz-errno.php                             30-Sep-2022 11:03                3499
function.yaz-error.php                             30-Sep-2022 11:03                3252
function.yaz-es-result.php                         30-Sep-2022 11:03                3157
function.yaz-es.php                                30-Sep-2022 11:03                7072
function.yaz-get-option.php                        30-Sep-2022 11:03                3176
function.yaz-hits.php                              30-Sep-2022 11:03                4659
function.yaz-itemorder.php                         30-Sep-2022 11:03                6871
function.yaz-present.php                           30-Sep-2022 11:03                2751
function.yaz-range.php                             30-Sep-2022 11:03                3378
function.yaz-record.php                            30-Sep-2022 11:03               14160
function.yaz-scan-result.php                       30-Sep-2022 11:03                3806
function.yaz-scan.php                              30-Sep-2022 11:03                9672
function.yaz-schema.php                            30-Sep-2022 11:03                3266
function.yaz-search.php                            30-Sep-2022 11:03                8307
function.yaz-set-option.php                        30-Sep-2022 11:03                6626
function.yaz-sort.php                              30-Sep-2022 11:03                5432
function.yaz-syntax.php                            30-Sep-2022 11:03                3224
function.yaz-wait.php                              30-Sep-2022 11:03                3954
function.zend-thread-id.php                        30-Sep-2022 11:03                3436
function.zend-version.php                          30-Sep-2022 11:03                3679
function.zip-close.php                             30-Sep-2022 11:03                2918
function.zip-entry-close.php                       30-Sep-2022 11:03                3117
function.zip-entry-compressedsize.php              30-Sep-2022 11:03                3123
function.zip-entry-compressionmethod.php           30-Sep-2022 11:03                3202
function.zip-entry-filesize.php                    30-Sep-2022 11:03                3064
function.zip-entry-name.php                        30-Sep-2022 11:03                2989
function.zip-entry-open.php                        30-Sep-2022 11:03                4616
function.zip-entry-read.php                        30-Sep-2022 11:03                3859
function.zip-open.php                              30-Sep-2022 11:03                3171
function.zip-read.php                              30-Sep-2022 11:03                3518
function.zlib-decode.php                           30-Sep-2022 11:03                3134
function.zlib-encode.php                           30-Sep-2022 11:03                4882
function.zlib-get-coding-type.php                  30-Sep-2022 11:03                2711
function.zookeeper-dispatch.php                    30-Sep-2022 11:03                8586
functional.parallel.php                            30-Sep-2022 11:03                2540
functions.anonymous.php                            30-Sep-2022 11:03               25788
functions.arguments.php                            30-Sep-2022 11:03               45829
functions.arrow.php                                30-Sep-2022 11:03               10639
functions.first_class_callable_syntax.php          30-Sep-2022 11:03               12018
functions.internal.php                             30-Sep-2022 11:03                7053
functions.returning-values.php                     30-Sep-2022 11:03                6073
functions.user-defined.php                         30-Sep-2022 11:03                9425
functions.variable-functions.php                   30-Sep-2022 11:03               12305
gearman.configuration.php                          30-Sep-2022 11:03                1176
gearman.constants.php                              30-Sep-2022 11:03               17815
gearman.examples-reverse-bg.php                    30-Sep-2022 11:03               11660
gearman.examples-reverse-task.php                  30-Sep-2022 11:03               18839
gearman.examples-reverse.php                       30-Sep-2022 11:03               14278
gearman.examples.php                               30-Sep-2022 11:03                1535
gearman.installation.php                           30-Sep-2022 11:03                1472
gearman.requirements.php                           30-Sep-2022 11:03                1435
gearman.resources.php                              30-Sep-2022 11:03                1163
gearman.setup.php                                  30-Sep-2022 11:03                1501
gearmanclient.addoptions.php                       30-Sep-2022 11:03                2837
gearmanclient.addserver.php                        30-Sep-2022 11:03                4898
gearmanclient.addservers.php                       30-Sep-2022 11:03                4387
gearmanclient.addtask.php                          30-Sep-2022 11:03               15102
gearmanclient.addtaskbackground.php                30-Sep-2022 11:03               21436
gearmanclient.addtaskhigh.php                      30-Sep-2022 11:03               11237
gearmanclient.addtaskhighbackground.php            30-Sep-2022 11:03                5805
gearmanclient.addtasklow.php                       30-Sep-2022 11:03               11219
gearmanclient.addtasklowbackground.php             30-Sep-2022 11:03                5798
gearmanclient.addtaskstatus.php                    30-Sep-2022 11:03                9873
gearmanclient.clearcallbacks.php                   30-Sep-2022 11:03                4302
gearmanclient.clone.php                            30-Sep-2022 11:03                2543
gearmanclient.construct.php                        30-Sep-2022 11:03                2776
gearmanclient.context.php                          30-Sep-2022 11:03                2789
gearmanclient.data.php                             30-Sep-2022 11:03                3056
gearmanclient.do.php                               30-Sep-2022 11:03               23795
gearmanclient.dobackground.php                     30-Sep-2022 11:03                9655
gearmanclient.dohigh.php                           30-Sep-2022 11:03                4701
gearmanclient.dohighbackground.php                 30-Sep-2022 11:03                4528
gearmanclient.dojobhandle.php                      30-Sep-2022 11:03                2846
gearmanclient.dolow.php                            30-Sep-2022 11:03                4687
gearmanclient.dolowbackground.php                  30-Sep-2022 11:03                4510
gearmanclient.donormal.php                         30-Sep-2022 11:03               24183
gearmanclient.dostatus.php                         30-Sep-2022 11:03                8712
gearmanclient.echo.php                             30-Sep-2022 11:03                2726
gearmanclient.error.php                            30-Sep-2022 11:03                2534
gearmanclient.geterrno.php                         30-Sep-2022 11:03                2558
gearmanclient.jobstatus.php                        30-Sep-2022 11:03                8574
gearmanclient.ping.php                             30-Sep-2022 11:03                2699
gearmanclient.removeoptions.php                    30-Sep-2022 11:03                2483
gearmanclient.returncode.php                       30-Sep-2022 11:03                2193
gearmanclient.runtasks.php                         30-Sep-2022 11:03                3505
gearmanclient.setclientcallback.php                30-Sep-2022 11:03                5311
gearmanclient.setcompletecallback.php              30-Sep-2022 11:03                5146
gearmanclient.setcontext.php                       30-Sep-2022 11:03                3038
gearmanclient.setcreatedcallback.php               30-Sep-2022 11:03                4619
gearmanclient.setdata.php                          30-Sep-2022 11:03                3232
gearmanclient.setdatacallback.php                  30-Sep-2022 11:03                4670
gearmanclient.setexceptioncallback.php             30-Sep-2022 11:03                4590
gearmanclient.setfailcallback.php                  30-Sep-2022 11:03                4676
gearmanclient.setoptions.php                       30-Sep-2022 11:03                2469
gearmanclient.setstatuscallback.php                30-Sep-2022 11:03                4676
gearmanclient.settimeout.php                       30-Sep-2022 11:03                2511
gearmanclient.setwarningcallback.php               30-Sep-2022 11:03                4679
gearmanclient.setworkloadcallback.php              30-Sep-2022 11:03                4833
gearmanclient.timeout.php                          30-Sep-2022 11:03                2653
gearmanclient.wait.php                             30-Sep-2022 11:03                2596
gearmanjob.complete.php                            30-Sep-2022 11:03                3350
gearmanjob.construct.php                           30-Sep-2022 11:03                2285
gearmanjob.data.php                                30-Sep-2022 11:03                3310
gearmanjob.exception.php                           30-Sep-2022 11:03                3532
gearmanjob.fail.php                                30-Sep-2022 11:03                3513
gearmanjob.functionname.php                        30-Sep-2022 11:03                2579
gearmanjob.handle.php                              30-Sep-2022 11:03                2466
gearmanjob.returncode.php                          30-Sep-2022 11:03                2513
gearmanjob.sendcomplete.php                        30-Sep-2022 11:03                3069
gearmanjob.senddata.php                            30-Sep-2022 11:03                3036
gearmanjob.sendexception.php                       30-Sep-2022 11:03                3264
gearmanjob.sendfail.php                            30-Sep-2022 11:03                3230
gearmanjob.sendstatus.php                          30-Sep-2022 11:03                3727
gearmanjob.sendwarning.php                         30-Sep-2022 11:03                3260
gearmanjob.setreturn.php                           30-Sep-2022 11:03                2404
gearmanjob.status.php                              30-Sep-2022 11:03                4010
gearmanjob.unique.php                              30-Sep-2022 11:03                2718
gearmanjob.warning.php                             30-Sep-2022 11:03                3543
gearmanjob.workload.php                            30-Sep-2022 11:03                2724
gearmanjob.workloadsize.php                        30-Sep-2022 11:03                2529
gearmantask.construct.php                          30-Sep-2022 11:03                2305
gearmantask.create.php                             30-Sep-2022 11:03                2669
gearmantask.data.php                               30-Sep-2022 11:03                2520
gearmantask.datasize.php                           30-Sep-2022 11:03                2545
gearmantask.function.php                           30-Sep-2022 11:03                2537
gearmantask.functionname.php                       30-Sep-2022 11:03                2227
gearmantask.isknown.php                            30-Sep-2022 11:03                2242
gearmantask.isrunning.php                          30-Sep-2022 11:03                2246
gearmantask.jobhandle.php                          30-Sep-2022 11:03                2615
gearmantask.recvdata.php                           30-Sep-2022 11:03                3166
gearmantask.returncode.php                         30-Sep-2022 11:03                2540
gearmantask.senddata.php                           30-Sep-2022 11:03                3093
gearmantask.sendworkload.php                       30-Sep-2022 11:03                3126
gearmantask.taskdenominator.php                    30-Sep-2022 11:03                2738
gearmantask.tasknumerator.php                      30-Sep-2022 11:03                2710
gearmantask.unique.php                             30-Sep-2022 11:03                2968
gearmantask.uuid.php                               30-Sep-2022 11:03                3259
gearmanworker.addfunction.php                      30-Sep-2022 11:03                7788
gearmanworker.addoptions.php                       30-Sep-2022 11:03                3224
gearmanworker.addserver.php                        30-Sep-2022 11:03                4555
gearmanworker.addservers.php                       30-Sep-2022 11:03                4039
gearmanworker.clone.php                            30-Sep-2022 11:03                2241
gearmanworker.construct.php                        30-Sep-2022 11:03                2749
gearmanworker.echo.php                             30-Sep-2022 11:03                2877
gearmanworker.error.php                            30-Sep-2022 11:03                2487
gearmanworker.geterrno.php                         30-Sep-2022 11:03                2525
gearmanworker.options.php                          30-Sep-2022 11:03                2532
gearmanworker.register.php                         30-Sep-2022 11:03                3595
gearmanworker.removeoptions.php                    30-Sep-2022 11:03                3246
gearmanworker.returncode.php                       30-Sep-2022 11:03                2735
gearmanworker.setid.php                            30-Sep-2022 11:03                3802
gearmanworker.setoptions.php                       30-Sep-2022 11:03                3394
gearmanworker.settimeout.php                       30-Sep-2022 11:03                8056
gearmanworker.timeout.php                          30-Sep-2022 11:03                2632
gearmanworker.unregister.php                       30-Sep-2022 11:03                3213
gearmanworker.unregisterall.php                    30-Sep-2022 11:03                2910
gearmanworker.wait.php                             30-Sep-2022 11:03                8389
gearmanworker.work.php                             30-Sep-2022 11:03                5321
gender-gender.connect.php                          30-Sep-2022 11:03                2400
gender-gender.construct.php                        30-Sep-2022 11:03                2318
gender-gender.country.php                          30-Sep-2022 11:03                3567
gender-gender.get.php                              30-Sep-2022 11:03                2663
gender-gender.isnick.php                           30-Sep-2022 11:03                3108
gender-gender.similarnames.php                     30-Sep-2022 11:03                2776
gender.example.admin.php                           30-Sep-2022 11:03                9296
gender.examples.php                                30-Sep-2022 11:03                1311
gender.installation.php                            30-Sep-2022 11:03                1844
gender.setup.php                                   30-Sep-2022 11:03                1299
generator.current.php                              30-Sep-2022 11:03                2096
generator.getreturn.php                            30-Sep-2022 11:03                3909
generator.key.php                                  30-Sep-2022 11:03                3908
generator.next.php                                 30-Sep-2022 11:03                2289
generator.rewind.php                               30-Sep-2022 11:03                2094
generator.send.php                                 30-Sep-2022 11:03                5645
generator.throw.php                                30-Sep-2022 11:03                5197
generator.valid.php                                30-Sep-2022 11:03                2081
generator.wakeup.php                               30-Sep-2022 11:03                2091
geoip.configuration.php                            30-Sep-2022 11:03                2267
geoip.constants.php                                30-Sep-2022 11:03                4431
geoip.installation.php                             30-Sep-2022 11:03                1591
geoip.requirements.php                             30-Sep-2022 11:03                1598
geoip.resources.php                                30-Sep-2022 11:03                1119
geoip.setup.php                                    30-Sep-2022 11:03                1465
gettext.configuration.php                          30-Sep-2022 11:03                1176
gettext.constants.php                              30-Sep-2022 11:03                1100
gettext.installation.php                           30-Sep-2022 11:03                1318
gettext.requirements.php                           30-Sep-2022 11:03                1296
gettext.resources.php                              30-Sep-2022 11:03                1133
gettext.setup.php                                  30-Sep-2022 11:03                1508
getting-started.php                                30-Sep-2022 11:03                1871
globiterator.construct.php                         30-Sep-2022 11:03                7786
globiterator.count.php                             30-Sep-2022 11:03                4293
gmagick.addimage.php                               30-Sep-2022 11:03                2810
gmagick.addnoiseimage.php                          30-Sep-2022 11:03                2807
gmagick.annotateimage.php                          30-Sep-2022 11:03                4182
gmagick.blurimage.php                              30-Sep-2022 11:03                3091
gmagick.borderimage.php                            30-Sep-2022 11:03                3602
gmagick.charcoalimage.php                          30-Sep-2022 11:03                3099
gmagick.chopimage.php                              30-Sep-2022 11:03                3643
gmagick.clear.php                                  30-Sep-2022 11:03                2539
gmagick.commentimage.php                           30-Sep-2022 11:03                2752
gmagick.compositeimage.php                         30-Sep-2022 11:03                3864
gmagick.configuration.php                          30-Sep-2022 11:03                1179
gmagick.constants.php                              30-Sep-2022 11:03               68397
gmagick.construct.php                              30-Sep-2022 11:03                2514
gmagick.cropimage.php                              30-Sep-2022 11:03                3778
gmagick.cropthumbnailimage.php                     30-Sep-2022 11:03                3136
gmagick.current.php                                30-Sep-2022 11:03                2440
gmagick.cyclecolormapimage.php                     30-Sep-2022 11:03                2880
gmagick.deconstructimages.php                      30-Sep-2022 11:03                2688
gmagick.despeckleimage.php                         30-Sep-2022 11:03                3357
gmagick.destroy.php                                30-Sep-2022 11:03                2509
gmagick.drawimage.php                              30-Sep-2022 11:03                2934
gmagick.edgeimage.php                              30-Sep-2022 11:03                2823
gmagick.embossimage.php                            30-Sep-2022 11:03                3277
gmagick.enhanceimage.php                           30-Sep-2022 11:03                2550
gmagick.equalizeimage.php                          30-Sep-2022 11:03                2509
gmagick.examples.php                               30-Sep-2022 11:03                3660
gmagick.flipimage.php                              30-Sep-2022 11:03                2856
gmagick.flopimage.php                              30-Sep-2022 11:03                2853
gmagick.frameimage.php                             30-Sep-2022 11:03                4319
gmagick.gammaimage.php                             30-Sep-2022 11:03                3034
gmagick.getcopyright.php                           30-Sep-2022 11:03                2471
gmagick.getfilename.php                            30-Sep-2022 11:03                2421
gmagick.getimagebackgroundcolor.php                30-Sep-2022 11:03                2618
gmagick.getimageblueprimary.php                    30-Sep-2022 11:03                2886
gmagick.getimagebordercolor.php                    30-Sep-2022 11:03                2662
gmagick.getimagechanneldepth.php                   30-Sep-2022 11:03                2607
gmagick.getimagecolors.php                         30-Sep-2022 11:03                2459
gmagick.getimagecolorspace.php                     30-Sep-2022 11:03                2417
gmagick.getimagecompose.php                        30-Sep-2022 11:03                2497
gmagick.getimagedelay.php                          30-Sep-2022 11:03                2394
gmagick.getimagedepth.php                          30-Sep-2022 11:03                2364
gmagick.getimagedispose.php                        30-Sep-2022 11:03                2418
gmagick.getimageextrema.php                        30-Sep-2022 11:03                2623
gmagick.getimagefilename.php                       30-Sep-2022 11:03                2500
gmagick.getimageformat.php                         30-Sep-2022 11:03                2483
gmagick.getimagegamma.php                          30-Sep-2022 11:03                2385
gmagick.getimagegreenprimary.php                   30-Sep-2022 11:03                2604
gmagick.getimageheight.php                         30-Sep-2022 11:03                2416
gmagick.getimagehistogram.php                      30-Sep-2022 11:03                2777
gmagick.getimageindex.php                          30-Sep-2022 11:03                2547
gmagick.getimageinterlacescheme.php                30-Sep-2022 11:03                2535
gmagick.getimageiterations.php                     30-Sep-2022 11:03                2462
gmagick.getimagematte.php                          30-Sep-2022 11:03                2596
gmagick.getimagemattecolor.php                     30-Sep-2022 11:03                2568
gmagick.getimageprofile.php                        30-Sep-2022 11:03                2555
gmagick.getimageredprimary.php                     30-Sep-2022 11:03                2625
gmagick.getimagerenderingintent.php                30-Sep-2022 11:03                2546
gmagick.getimageresolution.php                     30-Sep-2022 11:03                2478
gmagick.getimagescene.php                          30-Sep-2022 11:03                2381
gmagick.getimagesignature.php                      30-Sep-2022 11:03                2494
gmagick.getimagetype.php                           30-Sep-2022 11:03                2388
gmagick.getimageunits.php                          30-Sep-2022 11:03                2158
gmagick.getimagewhitepoint.php                     30-Sep-2022 11:03                2601
gmagick.getimagewidth.php                          30-Sep-2022 11:03                2395
gmagick.getpackagename.php                         30-Sep-2022 11:03                2447
gmagick.getquantumdepth.php                        30-Sep-2022 11:03                2626
gmagick.getreleasedate.php                         30-Sep-2022 11:03                2481
gmagick.getsamplingfactors.php                     30-Sep-2022 11:03                2536
gmagick.getsize.php                                30-Sep-2022 11:03                2685
gmagick.getversion.php                             30-Sep-2022 11:03                2426
gmagick.hasnextimage.php                           30-Sep-2022 11:03                2728
gmagick.haspreviousimage.php                       30-Sep-2022 11:03                2772
gmagick.implodeimage.php                           30-Sep-2022 11:03                2904
gmagick.installation.php                           30-Sep-2022 11:03                1846
gmagick.labelimage.php                             30-Sep-2022 11:03                2671
gmagick.levelimage.php                             30-Sep-2022 11:03                4462
gmagick.magnifyimage.php                           30-Sep-2022 11:03                2576
gmagick.mapimage.php                               30-Sep-2022 11:03                3171
gmagick.medianfilterimage.php                      30-Sep-2022 11:03                2927
gmagick.minifyimage.php                            30-Sep-2022 11:03                2569
gmagick.modulateimage.php                          30-Sep-2022 11:03                3673
gmagick.motionblurimage.php                        30-Sep-2022 11:03                3698
gmagick.newimage.php                               30-Sep-2022 11:03                3662
gmagick.nextimage.php                              30-Sep-2022 11:03                2530
gmagick.normalizeimage.php                         30-Sep-2022 11:03                2908
gmagick.oilpaintimage.php                          30-Sep-2022 11:03                2924
gmagick.previousimage.php                          30-Sep-2022 11:03                2525
gmagick.profileimage.php                           30-Sep-2022 11:03                3322
gmagick.quantizeimage.php                          30-Sep-2022 11:03                5033
gmagick.quantizeimages.php                         30-Sep-2022 11:03                5036
gmagick.queryfontmetrics.php                       30-Sep-2022 11:03                2744
gmagick.queryfonts.php                             30-Sep-2022 11:03                2520
gmagick.queryformats.php                           30-Sep-2022 11:03                2882
gmagick.radialblurimage.php                        30-Sep-2022 11:03                3074
gmagick.raiseimage.php                             30-Sep-2022 11:03                4102
gmagick.read.php                                   30-Sep-2022 11:03                2645
gmagick.readimage.php                              30-Sep-2022 11:03                2695
gmagick.readimageblob.php                          30-Sep-2022 11:03                3062
gmagick.readimagefile.php                          30-Sep-2022 11:03                2931
gmagick.reducenoiseimage.php                       30-Sep-2022 11:03                3102
gmagick.removeimage.php                            30-Sep-2022 11:03                2517
gmagick.removeimageprofile.php                     30-Sep-2022 11:03                2747
gmagick.requirements.php                           30-Sep-2022 11:03                1598
gmagick.resampleimage.php                          30-Sep-2022 11:03                3669
gmagick.resizeimage.php                            30-Sep-2022 11:03                3895
gmagick.rollimage.php                              30-Sep-2022 11:03                2853
gmagick.rotateimage.php                            30-Sep-2022 11:03                3127
gmagick.scaleimage.php                             30-Sep-2022 11:03                3285
gmagick.separateimagechannel.php                   30-Sep-2022 11:03                3094
gmagick.setcompressionquality.php                  30-Sep-2022 11:03                4128
gmagick.setfilename.php                            30-Sep-2022 11:03                2825
gmagick.setimagebackgroundcolor.php                30-Sep-2022 11:03                2954
gmagick.setimageblueprimary.php                    30-Sep-2022 11:03                3136
gmagick.setimagebordercolor.php                    30-Sep-2022 11:03                2916
gmagick.setimagechanneldepth.php                   30-Sep-2022 11:03                3283
gmagick.setimagecolorspace.php                     30-Sep-2022 11:03                2979
gmagick.setimagecompose.php                        30-Sep-2022 11:03                2745
gmagick.setimagedelay.php                          30-Sep-2022 11:03                2759
gmagick.setimagedepth.php                          30-Sep-2022 11:03                2757
gmagick.setimagedispose.php                        30-Sep-2022 11:03                2801
gmagick.setimagefilename.php                       30-Sep-2022 11:03                2849
gmagick.setimageformat.php                         30-Sep-2022 11:03                2812
gmagick.setimagegamma.php                          30-Sep-2022 11:03                2751
gmagick.setimagegreenprimary.php                   30-Sep-2022 11:03                3144
gmagick.setimageindex.php                          30-Sep-2022 11:03                2898
gmagick.setimageinterlacescheme.php                30-Sep-2022 11:03                3045
gmagick.setimageiterations.php                     30-Sep-2022 11:03                2854
gmagick.setimageprofile.php                        30-Sep-2022 11:03                3229
gmagick.setimageredprimary.php                     30-Sep-2022 11:03                3047
gmagick.setimagerenderingintent.php                30-Sep-2022 11:03                3076
gmagick.setimageresolution.php                     30-Sep-2022 11:03                3041
gmagick.setimagescene.php                          30-Sep-2022 11:03                2747
gmagick.setimagetype.php                           30-Sep-2022 11:03                2872
gmagick.setimageunits.php                          30-Sep-2022 11:03                2931
gmagick.setimagewhitepoint.php                     30-Sep-2022 11:03                3073
gmagick.setsamplingfactors.php                     30-Sep-2022 11:03                2915
gmagick.setsize.php                                30-Sep-2022 11:03                3180
gmagick.setup.php                                  30-Sep-2022 11:03                1431
gmagick.shearimage.php                             30-Sep-2022 11:03                3816
gmagick.solarizeimage.php                          30-Sep-2022 11:03                3005
gmagick.spreadimage.php                            30-Sep-2022 11:03                2849
gmagick.stripimage.php                             30-Sep-2022 11:03                2497
gmagick.swirlimage.php                             30-Sep-2022 11:03                2930
gmagick.thumbnailimage.php                         30-Sep-2022 11:03                3545
gmagick.trimimage.php                              30-Sep-2022 11:03                2994
gmagick.write.php                                  30-Sep-2022 11:03                1688
gmagick.writeimage.php                             30-Sep-2022 11:03                3242
gmagickdraw.annotate.php                           30-Sep-2022 11:03                2981
gmagickdraw.arc.php                                30-Sep-2022 11:03                3981
gmagickdraw.bezier.php                             30-Sep-2022 11:03                2530
gmagickdraw.ellipse.php                            30-Sep-2022 11:03                3902
gmagickdraw.getfillcolor.php                       30-Sep-2022 11:03                2386
gmagickdraw.getfillopacity.php                     30-Sep-2022 11:03                2279
gmagickdraw.getfont.php                            30-Sep-2022 11:03                2317
gmagickdraw.getfontsize.php                        30-Sep-2022 11:03                2321
gmagickdraw.getfontstyle.php                       30-Sep-2022 11:03                2397
gmagickdraw.getfontweight.php                      30-Sep-2022 11:03                2242
gmagickdraw.getstrokecolor.php                     30-Sep-2022 11:03                2441
gmagickdraw.getstrokeopacity.php                   30-Sep-2022 11:03                2298
gmagickdraw.getstrokewidth.php                     30-Sep-2022 11:03                2317
gmagickdraw.gettextdecoration.php                  30-Sep-2022 11:03                2309
gmagickdraw.gettextencoding.php                    30-Sep-2022 11:03                2445
gmagickdraw.line.php                               30-Sep-2022 11:03                3373
gmagickdraw.point.php                              30-Sep-2022 11:03                2768
gmagickdraw.polygon.php                            30-Sep-2022 11:03                2597
gmagickdraw.polyline.php                           30-Sep-2022 11:03                2632
gmagickdraw.rectangle.php                          30-Sep-2022 11:03                3477
gmagickdraw.rotate.php                             30-Sep-2022 11:03                2588
gmagickdraw.roundrectangle.php                     30-Sep-2022 11:03                4146
gmagickdraw.scale.php                              30-Sep-2022 11:03                2832
gmagickdraw.setfillcolor.php                       30-Sep-2022 11:03                2887
gmagickdraw.setfillopacity.php                     30-Sep-2022 11:03                2686
gmagickdraw.setfont.php                            30-Sep-2022 11:03                2584
gmagickdraw.setfontsize.php                        30-Sep-2022 11:03                2616
gmagickdraw.setfontstyle.php                       30-Sep-2022 11:03                2747
gmagickdraw.setfontweight.php                      30-Sep-2022 11:03                2618
gmagickdraw.setstrokecolor.php                     30-Sep-2022 11:03                2911
gmagickdraw.setstrokeopacity.php                   30-Sep-2022 11:03                2704
gmagickdraw.setstrokewidth.php                     30-Sep-2022 11:03                2664
gmagickdraw.settextdecoration.php                  30-Sep-2022 11:03                2750
gmagickdraw.settextencoding.php                    30-Sep-2022 11:03                2956
gmagickpixel.construct.php                         30-Sep-2022 11:03                2464
gmagickpixel.getcolor.php                          30-Sep-2022 11:03                3624
gmagickpixel.getcolorcount.php                     30-Sep-2022 11:03                2370
gmagickpixel.getcolorvalue.php                     30-Sep-2022 11:03                2736
gmagickpixel.setcolor.php                          30-Sep-2022 11:03                2923
gmagickpixel.setcolorvalue.php                     30-Sep-2022 11:03                3150
gmp.configuration.php                              30-Sep-2022 11:03                1151
gmp.constants.php                                  30-Sep-2022 11:03                3031
gmp.examples.php                                   30-Sep-2022 11:03                3213
gmp.installation.php                               30-Sep-2022 11:03                1263
gmp.requirements.php                               30-Sep-2022 11:03                1643
gmp.serialize.php                                  30-Sep-2022 11:03                2085
gmp.setup.php                                      30-Sep-2022 11:03                1393
gmp.unserialize.php                                30-Sep-2022 11:03                2405
gnupg.configuration.php                            30-Sep-2022 11:03                1160
gnupg.constants.php                                30-Sep-2022 11:03                6332
gnupg.examples-clearsign.php                       30-Sep-2022 11:03                6705
gnupg.examples.php                                 30-Sep-2022 11:03                1317
gnupg.installation.php                             30-Sep-2022 11:03                1453
gnupg.requirements.php                             30-Sep-2022 11:03                1202
gnupg.resources.php                                30-Sep-2022 11:03                1119
gnupg.setup.php                                    30-Sep-2022 11:03                1480
hash.configuration.php                             30-Sep-2022 11:03                1155
hash.constants.php                                 30-Sep-2022 11:03                1551
hash.installation.php                              30-Sep-2022 11:03                1553
hash.requirements.php                              30-Sep-2022 11:03                1124
hash.resources.php                                 30-Sep-2022 11:03                1268
hash.setup.php                                     30-Sep-2022 11:03                1461
history.php                                        30-Sep-2022 11:04                1862
history.php.books.php                              30-Sep-2022 11:04                2228
history.php.php                                    30-Sep-2022 11:04                6186
history.php.publications.php                       30-Sep-2022 11:04                1690
history.php.related.php                            30-Sep-2022 11:04                5411
hrtime-performancecounter.getfrequency.php         30-Sep-2022 11:03                2568
hrtime-performancecounter.getticks.php             30-Sep-2022 11:03                2441
hrtime-performancecounter.gettickssince.php        30-Sep-2022 11:03                2707
hrtime-stopwatch.getelapsedticks.php               30-Sep-2022 11:03                2343
hrtime-stopwatch.getelapsedtime.php                30-Sep-2022 11:03                2702
hrtime-stopwatch.getlastelapsedticks.php           30-Sep-2022 11:03                2411
hrtime-stopwatch.getlastelapsedtime.php            30-Sep-2022 11:03                2726
hrtime-stopwatch.isrunning.php                     30-Sep-2022 11:03                2267
hrtime-stopwatch.start.php                         30-Sep-2022 11:03                2296
hrtime-stopwatch.stop.php                          30-Sep-2022 11:03                2175
hrtime.example.basic.php                           30-Sep-2022 11:03                5952
hrtime.examples.php                                30-Sep-2022 11:03                1305
hrtime.installation.php                            30-Sep-2022 11:03                1844
hrtime.setup.php                                   30-Sep-2022 11:03                1296
ibase.configuration.php                            30-Sep-2022 11:03                7004
ibase.constants.php                                30-Sep-2022 11:03               18044
ibase.installation.php                             30-Sep-2022 11:03                3038
ibase.requirements.php                             30-Sep-2022 11:03                1099
ibase.resources.php                                30-Sep-2022 11:03                1119
ibase.setup.php                                    30-Sep-2022 11:03                1498
ibm-db2.configuration.php                          30-Sep-2022 11:03                9190
ibm-db2.constants.php                              30-Sep-2022 11:03                6719
ibm-db2.installation.php                           30-Sep-2022 11:03                3471
ibm-db2.requirements.php                           30-Sep-2022 11:03                3141
ibm-db2.resources.php                              30-Sep-2022 11:03                1205
ibm-db2.setup.php                                  30-Sep-2022 11:03                1510
iconv.configuration.php                            30-Sep-2022 11:03                4250
iconv.constants.php                                30-Sep-2022 11:03                3173
iconv.installation.php                             30-Sep-2022 11:03                1427
iconv.requirements.php                             30-Sep-2022 11:03                1360
iconv.resources.php                                30-Sep-2022 11:03                1119
iconv.setup.php                                    30-Sep-2022 11:03                1490
igbinary.configuration.php                         30-Sep-2022 11:03                3138
igbinary.installation.php                          30-Sep-2022 11:03                1856
igbinary.requirements.php                          30-Sep-2022 11:03                1120
igbinary.setup.php                                 30-Sep-2022 11:03                1438
image.configuration.php                            30-Sep-2022 11:03                3012
image.constants.php                                30-Sep-2022 11:03               39989
image.examples-png.php                             30-Sep-2022 11:03                4793
image.examples-watermark.php                       30-Sep-2022 11:03                5822
image.examples.merged-watermark.php                30-Sep-2022 11:03                8674
image.examples.php                                 30-Sep-2022 11:03                1531
image.installation.php                             30-Sep-2022 11:03                5525
image.requirements.php                             30-Sep-2022 11:03                5088
image.resources.php                                30-Sep-2022 11:03                2526
image.setup.php                                    30-Sep-2022 11:03                1486
imagick.adaptiveblurimage.php                      30-Sep-2022 11:03                6555
imagick.adaptiveresizeimage.php                    30-Sep-2022 11:03                8661
imagick.adaptivesharpenimage.php                   30-Sep-2022 11:03                6185
imagick.adaptivethresholdimage.php                 30-Sep-2022 11:03                6103
imagick.addimage.php                               30-Sep-2022 11:03                2753
imagick.addnoiseimage.php                          30-Sep-2022 11:03                5366
imagick.affinetransformimage.php                   30-Sep-2022 11:03                6940
imagick.animateimages.php                          30-Sep-2022 11:03                2938
imagick.annotateimage.php                          30-Sep-2022 11:03                8612
imagick.appendimages.php                           30-Sep-2022 11:03                6651
imagick.autolevelimage.php                         30-Sep-2022 11:03                4336
imagick.averageimages.php                          30-Sep-2022 11:03                2644
imagick.blackthresholdimage.php                    30-Sep-2022 11:03                5304
imagick.blueshiftimage.php                         30-Sep-2022 11:03                4405
imagick.blurimage.php                              30-Sep-2022 11:03                5503
imagick.borderimage.php                            30-Sep-2022 11:03                5966
imagick.brightnesscontrastimage.php                30-Sep-2022 11:03                5457
imagick.charcoalimage.php                          30-Sep-2022 11:03                4872
imagick.chopimage.php                              30-Sep-2022 11:03                6826
imagick.clampimage.php                             30-Sep-2022 11:03                2421
imagick.clear.php                                  30-Sep-2022 11:03                2098
imagick.clipimage.php                              30-Sep-2022 11:03                2333
imagick.clipimagepath.php                          30-Sep-2022 11:03                2878
imagick.clippathimage.php                          30-Sep-2022 11:03                3189
imagick.clone.php                                  30-Sep-2022 11:03                4201
imagick.clutimage.php                              30-Sep-2022 11:03                5891
imagick.coalesceimages.php                         30-Sep-2022 11:03                2744
imagick.colorfloodfillimage.php                    30-Sep-2022 11:03                5183
imagick.colorizeimage.php                          30-Sep-2022 11:03                6906
imagick.colormatriximage.php                       30-Sep-2022 11:03                8364
imagick.combineimages.php                          30-Sep-2022 11:03                3198
imagick.commentimage.php                           30-Sep-2022 11:03                4901
imagick.compareimagechannels.php                   30-Sep-2022 11:03                3737
imagick.compareimagelayers.php                     30-Sep-2022 11:03                5424
imagick.compareimages.php                          30-Sep-2022 11:03                5553
imagick.compositeimage.php                         30-Sep-2022 11:03                4279
imagick.configuration.php                          30-Sep-2022 11:03                3893
imagick.constants.php                              30-Sep-2022 11:03              107773
imagick.construct.php                              30-Sep-2022 11:03                2586
imagick.contrastimage.php                          30-Sep-2022 11:03                5023
imagick.contraststretchimage.php                   30-Sep-2022 11:03                3545
imagick.convolveimage.php                          30-Sep-2022 11:03                5931
imagick.count.php                                  30-Sep-2022 11:03                2557
imagick.cropimage.php                              30-Sep-2022 11:03                5898
imagick.cropthumbnailimage.php                     30-Sep-2022 11:03                2873
imagick.current.php                                30-Sep-2022 11:03                2405
imagick.cyclecolormapimage.php                     30-Sep-2022 11:03                2778
imagick.decipherimage.php                          30-Sep-2022 11:03                3030
imagick.deconstructimages.php                      30-Sep-2022 11:03                2560
imagick.deleteimageartifact.php                    30-Sep-2022 11:03                3441
imagick.deleteimageproperty.php                    30-Sep-2022 11:03                2422
imagick.deskewimage.php                            30-Sep-2022 11:03               11601
imagick.despeckleimage.php                         30-Sep-2022 11:03                4203
imagick.destroy.php                                30-Sep-2022 11:03                2236
imagick.displayimage.php                           30-Sep-2022 11:03                2577
imagick.displayimages.php                          30-Sep-2022 11:03                2621
imagick.distortimage.php                           30-Sep-2022 11:03               12817
imagick.drawimage.php                              30-Sep-2022 11:03                2500
imagick.edgeimage.php                              30-Sep-2022 11:03                4582
imagick.embossimage.php                            30-Sep-2022 11:03                5235
imagick.encipherimage.php                          30-Sep-2022 11:03                3026
imagick.enhanceimage.php                           30-Sep-2022 11:03                4170
imagick.equalizeimage.php                          30-Sep-2022 11:03                4137
imagick.evaluateimage.php                          30-Sep-2022 11:03                5713
imagick.examples-1.php                             30-Sep-2022 11:03               32492
imagick.examples.php                               30-Sep-2022 11:03                1319
imagick.exportimagepixels.php                      30-Sep-2022 11:03                7585
imagick.extentimage.php                            30-Sep-2022 11:03                4892
imagick.filter.php                                 30-Sep-2022 11:03                7740
imagick.flattenimages.php                          30-Sep-2022 11:03                2697
imagick.flipimage.php                              30-Sep-2022 11:03                4479
imagick.floodfillpaintimage.php                    30-Sep-2022 11:03               11491
imagick.flopimage.php                              30-Sep-2022 11:03                4511
imagick.forwardfouriertransformimage.php           30-Sep-2022 11:03               12958
imagick.frameimage.php                             30-Sep-2022 11:03                8448
imagick.functionimage.php                          30-Sep-2022 11:03               13585
imagick.fximage.php                                30-Sep-2022 11:03                6063
imagick.gammaimage.php                             30-Sep-2022 11:03                5577
imagick.gaussianblurimage.php                      30-Sep-2022 11:03                6069
imagick.getcolorspace.php                          30-Sep-2022 11:03                2310
imagick.getcompression.php                         30-Sep-2022 11:03                2164
imagick.getcompressionquality.php                  30-Sep-2022 11:03                2238
imagick.getcopyright.php                           30-Sep-2022 11:03                2265
imagick.getfilename.php                            30-Sep-2022 11:03                2322
imagick.getfont.php                                30-Sep-2022 11:03                2927
imagick.getformat.php                              30-Sep-2022 11:03                2284
imagick.getgravity.php                             30-Sep-2022 11:03                2289
imagick.gethomeurl.php                             30-Sep-2022 11:03                2142
imagick.getimage.php                               30-Sep-2022 11:03                2386
imagick.getimagealphachannel.php                   30-Sep-2022 11:03                2555
imagick.getimageartifact.php                       30-Sep-2022 11:03                3391
imagick.getimageattribute.php                      30-Sep-2022 11:03                2643
imagick.getimagebackgroundcolor.php                30-Sep-2022 11:03                2552
imagick.getimageblob.php                           30-Sep-2022 11:03                2578
imagick.getimageblueprimary.php                    30-Sep-2022 11:03                2795
imagick.getimagebordercolor.php                    30-Sep-2022 11:03                2508
imagick.getimagechanneldepth.php                   30-Sep-2022 11:03                2916
imagick.getimagechanneldistortion.php              30-Sep-2022 11:03                3820
imagick.getimagechanneldistortions.php             30-Sep-2022 11:03                4098
imagick.getimagechannelextrema.php                 30-Sep-2022 11:03                3410
imagick.getimagechannelkurtosis.php                30-Sep-2022 11:03                3341
imagick.getimagechannelmean.php                    30-Sep-2022 11:03                3099
imagick.getimagechannelrange.php                   30-Sep-2022 11:03                3194
imagick.getimagechannelstatistics.php              30-Sep-2022 11:03                2442
imagick.getimageclipmask.php                       30-Sep-2022 11:03                2868
imagick.getimagecolormapcolor.php                  30-Sep-2022 11:03                2805
imagick.getimagecolors.php                         30-Sep-2022 11:03                2250
imagick.getimagecolorspace.php                     30-Sep-2022 11:03                2291
imagick.getimagecompose.php                        30-Sep-2022 11:03                2248
imagick.getimagecompression.php                    30-Sep-2022 11:03                2252
imagick.getimagecompressionquality.php             30-Sep-2022 11:03                2346
imagick.getimagedelay.php                          30-Sep-2022 11:03                2317
imagick.getimagedepth.php                          30-Sep-2022 11:03                2097
imagick.getimagedispose.php                        30-Sep-2022 11:03                2357
imagick.getimagedistortion.php                     30-Sep-2022 11:03                3145
imagick.getimageextrema.php                        30-Sep-2022 11:03                2749
imagick.getimagefilename.php                       30-Sep-2022 11:03                2429
imagick.getimageformat.php                         30-Sep-2022 11:03                2411
imagick.getimagegamma.php                          30-Sep-2022 11:03                2312
imagick.getimagegeometry.php                       30-Sep-2022 11:03                4032
imagick.getimagegravity.php                        30-Sep-2022 11:03                2582
imagick.getimagegreenprimary.php                   30-Sep-2022 11:03                2582
imagick.getimageheight.php                         30-Sep-2022 11:03                2343
imagick.getimagehistogram.php                      30-Sep-2022 11:03               19671
imagick.getimageindex.php                          30-Sep-2022 11:03                2856
imagick.getimageinterlacescheme.php                30-Sep-2022 11:03                2389
imagick.getimageinterpolatemethod.php              30-Sep-2022 11:03                2616
imagick.getimageiterations.php                     30-Sep-2022 11:03                2405
imagick.getimagelength.php                         30-Sep-2022 11:03                3315
imagick.getimagematte.php                          30-Sep-2022 11:03                2570
imagick.getimagemattecolor.php                     30-Sep-2022 11:03                2722
imagick.getimagemimetype.php                       30-Sep-2022 11:03                2144
imagick.getimageorientation.php                    30-Sep-2022 11:03                2509
imagick.getimagepage.php                           30-Sep-2022 11:03                2574
imagick.getimagepixelcolor.php                     30-Sep-2022 11:03                3003
imagick.getimageprofile.php                        30-Sep-2022 11:03                2639
imagick.getimageprofiles.php                       30-Sep-2022 11:03                3160
imagick.getimageproperties.php                     30-Sep-2022 11:03                5586
imagick.getimageproperty.php                       30-Sep-2022 11:03                4816
imagick.getimageredprimary.php                     30-Sep-2022 11:03                2650
imagick.getimageregion.php                         30-Sep-2022 11:03                3695
imagick.getimagerenderingintent.php                30-Sep-2022 11:03                2533
imagick.getimageresolution.php                     30-Sep-2022 11:03                2181
imagick.getimagesblob.php                          30-Sep-2022 11:03                2420
imagick.getimagescene.php                          30-Sep-2022 11:03                2299
imagick.getimagesignature.php                      30-Sep-2022 11:03                2426
imagick.getimagesize.php                           30-Sep-2022 11:03                2534
imagick.getimagetickspersecond.php                 30-Sep-2022 11:03                2445
imagick.getimagetotalinkdensity.php                30-Sep-2022 11:03                2375
imagick.getimagetype.php                           30-Sep-2022 11:03                3935
imagick.getimageunits.php                          30-Sep-2022 11:03                2133
imagick.getimagevirtualpixelmethod.php             30-Sep-2022 11:03                2512
imagick.getimagewhitepoint.php                     30-Sep-2022 11:03                2562
imagick.getimagewidth.php                          30-Sep-2022 11:03                2317
imagick.getinterlacescheme.php                     30-Sep-2022 11:03                2463
imagick.getiteratorindex.php                       30-Sep-2022 11:03                6055
imagick.getnumberimages.php                        30-Sep-2022 11:03                2412
imagick.getoption.php                              30-Sep-2022 11:03                2613
imagick.getpackagename.php                         30-Sep-2022 11:03                2383
imagick.getpage.php                                30-Sep-2022 11:03                2398
imagick.getpixeliterator.php                       30-Sep-2022 11:03                6765
imagick.getpixelregioniterator.php                 30-Sep-2022 11:03                6732
imagick.getpointsize.php                           30-Sep-2022 11:03                2609
imagick.getquantum.php                             30-Sep-2022 11:03                2111
imagick.getquantumdepth.php                        30-Sep-2022 11:03                2496
imagick.getquantumrange.php                        30-Sep-2022 11:03                2640
imagick.getregistry.php                            30-Sep-2022 11:03                2347
imagick.getreleasedate.php                         30-Sep-2022 11:03                2407
imagick.getresource.php                            30-Sep-2022 11:03                2774
imagick.getresourcelimit.php                       30-Sep-2022 11:03                3200
imagick.getsamplingfactors.php                     30-Sep-2022 11:03                2473
imagick.getsize.php                                30-Sep-2022 11:03                5783
imagick.getsizeoffset.php                          30-Sep-2022 11:03                2430
imagick.getversion.php                             30-Sep-2022 11:03                2395
imagick.haldclutimage.php                          30-Sep-2022 11:03                5979
imagick.hasnextimage.php                           30-Sep-2022 11:03                2385
imagick.haspreviousimage.php                       30-Sep-2022 11:03                2423
imagick.identifyformat.php                         30-Sep-2022 11:03                4469
imagick.identifyimage.php                          30-Sep-2022 11:03                3812
imagick.implodeimage.php                           30-Sep-2022 11:03                4567
imagick.importimagepixels.php                      30-Sep-2022 11:03               11609
imagick.installation.php                           30-Sep-2022 11:03                2865
imagick.inversefouriertransformimage.php           30-Sep-2022 11:03                3209
imagick.labelimage.php                             30-Sep-2022 11:03                2380
imagick.levelimage.php                             30-Sep-2022 11:03                7655
imagick.linearstretchimage.php                     30-Sep-2022 11:03                5615
imagick.liquidrescaleimage.php                     30-Sep-2022 11:03                4129
imagick.listregistry.php                           30-Sep-2022 11:03                2230
imagick.magnifyimage.php                           30-Sep-2022 11:03                4169
imagick.mapimage.php                               30-Sep-2022 11:03                3019
imagick.mattefloodfillimage.php                    30-Sep-2022 11:03                5421
imagick.medianfilterimage.php                      30-Sep-2022 11:03                5038
imagick.mergeimagelayers.php                       30-Sep-2022 11:03                6550
imagick.minifyimage.php                            30-Sep-2022 11:03                2216
imagick.modulateimage.php                          30-Sep-2022 11:03                5459
imagick.montageimage.php                           30-Sep-2022 11:03                4306
imagick.morphimages.php                            30-Sep-2022 11:03                2702
imagick.morphology.php                             30-Sep-2022 11:03               75710
imagick.mosaicimages.php                           30-Sep-2022 11:03                2602
imagick.motionblurimage.php                        30-Sep-2022 11:03                6586
imagick.negateimage.php                            30-Sep-2022 11:03                5426
imagick.newimage.php                               30-Sep-2022 11:03                7242
imagick.newpseudoimage.php                         30-Sep-2022 11:03                5659
imagick.nextimage.php                              30-Sep-2022 11:03                2148
imagick.normalizeimage.php                         30-Sep-2022 11:03                6435
imagick.oilpaintimage.php                          30-Sep-2022 11:03                4525
imagick.opaquepaintimage.php                       30-Sep-2022 11:03                4621
imagick.optimizeimagelayers.php                    30-Sep-2022 11:03                5245
imagick.orderedposterizeimage.php                  30-Sep-2022 11:03                6712
imagick.paintfloodfillimage.php                    30-Sep-2022 11:03                5382
imagick.paintopaqueimage.php                       30-Sep-2022 11:03                5185
imagick.painttransparentimage.php                  30-Sep-2022 11:03                4405
imagick.pingimage.php                              30-Sep-2022 11:03                2502
imagick.pingimageblob.php                          30-Sep-2022 11:03                5971
imagick.pingimagefile.php                          30-Sep-2022 11:03                5683
imagick.polaroidimage.php                          30-Sep-2022 11:03                4623
imagick.posterizeimage.php                         30-Sep-2022 11:03                5543
imagick.previewimages.php                          30-Sep-2022 11:03                2901
imagick.previousimage.php                          30-Sep-2022 11:03                2203
imagick.profileimage.php                           30-Sep-2022 11:03                2990
imagick.quantizeimage.php                          30-Sep-2022 11:03                6448
imagick.quantizeimages.php                         30-Sep-2022 11:03                3600
imagick.queryfontmetrics.php                       30-Sep-2022 11:03                5529
imagick.queryfonts.php                             30-Sep-2022 11:03                4971
imagick.queryformats.php                           30-Sep-2022 11:03                8196
imagick.radialblurimage.php                        30-Sep-2022 11:03                5471
imagick.raiseimage.php                             30-Sep-2022 11:03                6305
imagick.randomthresholdimage.php                   30-Sep-2022 11:03                6388
imagick.readimage.php                              30-Sep-2022 11:03                2344
imagick.readimageblob.php                          30-Sep-2022 11:03                5724
imagick.readimagefile.php                          30-Sep-2022 11:03                2874
imagick.readimages.php                             30-Sep-2022 11:03                2366
imagick.recolorimage.php                           30-Sep-2022 11:03                6543
imagick.reducenoiseimage.php                       30-Sep-2022 11:03                5088
imagick.remapimage.php                             30-Sep-2022 11:03                3209
imagick.removeimage.php                            30-Sep-2022 11:03                2339
imagick.removeimageprofile.php                     30-Sep-2022 11:03                2634
imagick.render.php                                 30-Sep-2022 11:03                2111
imagick.requirements.php                           30-Sep-2022 11:03                1481
imagick.resampleimage.php                          30-Sep-2022 11:03                5399
imagick.resetimagepage.php                         30-Sep-2022 11:03                2571
imagick.resizeimage.php                            30-Sep-2022 11:03               11704
imagick.resources.php                              30-Sep-2022 11:03                1133
imagick.rollimage.php                              30-Sep-2022 11:03                4679
imagick.rotateimage.php                            30-Sep-2022 11:03                5650
imagick.rotationalblurimage.php                    30-Sep-2022 11:03                5547
imagick.roundcorners.php                           30-Sep-2022 11:03                6264
imagick.sampleimage.php                            30-Sep-2022 11:03                2715
imagick.scaleimage.php                             30-Sep-2022 11:03                6549
imagick.segmentimage.php                           30-Sep-2022 11:03                6537
imagick.selectiveblurimage.php                     30-Sep-2022 11:03                6269
imagick.separateimagechannel.php                   30-Sep-2022 11:03                5312
imagick.sepiatoneimage.php                         30-Sep-2022 11:03                4803
imagick.setbackgroundcolor.php                     30-Sep-2022 11:03                3144
imagick.setcolorspace.php                          30-Sep-2022 11:03                2762
imagick.setcompression.php                         30-Sep-2022 11:03                2563
imagick.setcompressionquality.php                  30-Sep-2022 11:03                7240
imagick.setfilename.php                            30-Sep-2022 11:03                2431
imagick.setfirstiterator.php                       30-Sep-2022 11:03                2197
imagick.setfont.php                                30-Sep-2022 11:03                5468
imagick.setformat.php                              30-Sep-2022 11:03                2333
imagick.setgravity.php                             30-Sep-2022 11:03                2545
imagick.setimage.php                               30-Sep-2022 11:03                4662
imagick.setimagealphachannel.php                   30-Sep-2022 11:03                3450
imagick.setimageartifact.php                       30-Sep-2022 11:03                7305
imagick.setimageattribute.php                      30-Sep-2022 11:03                2987
imagick.setimagebackgroundcolor.php                30-Sep-2022 11:03                3373
imagick.setimagebias.php                           30-Sep-2022 11:03                6966
imagick.setimagebiasquantum.php                    30-Sep-2022 11:03                2744
imagick.setimageblueprimary.php                    30-Sep-2022 11:03                2894
imagick.setimagebordercolor.php                    30-Sep-2022 11:03                3351
imagick.setimagechanneldepth.php                   30-Sep-2022 11:03                2911
imagick.setimageclipmask.php                       30-Sep-2022 11:03                9305
imagick.setimagecolormapcolor.php                  30-Sep-2022 11:03                2992
imagick.setimagecolorspace.php                     30-Sep-2022 11:03                3009
imagick.setimagecompose.php                        30-Sep-2022 11:03                2728
imagick.setimagecompression.php                    30-Sep-2022 11:03                2662
imagick.setimagecompressionquality.php             30-Sep-2022 11:03                2713
imagick.setimagedelay.php                          30-Sep-2022 11:03                6256
imagick.setimagedepth.php                          30-Sep-2022 11:03                2546
imagick.setimagedispose.php                        30-Sep-2022 11:03                2590
imagick.setimageextent.php                         30-Sep-2022 11:03                2811
imagick.setimagefilename.php                       30-Sep-2022 11:03                2640
imagick.setimageformat.php                         30-Sep-2022 11:03                2451
imagick.setimagegamma.php                          30-Sep-2022 11:03                2550
imagick.setimagegravity.php                        30-Sep-2022 11:03                2710
imagick.setimagegreenprimary.php                   30-Sep-2022 11:03                2887
imagick.setimageindex.php                          30-Sep-2022 11:03                3136
imagick.setimageinterlacescheme.php                30-Sep-2022 11:03                2710
imagick.setimageinterpolatemethod.php              30-Sep-2022 11:03                2637
imagick.setimageiterations.php                     30-Sep-2022 11:03                4842
imagick.setimagematte.php                          30-Sep-2022 11:03                2530
imagick.setimagemattecolor.php                     30-Sep-2022 11:03                3552
imagick.setimageopacity.php                        30-Sep-2022 11:03                4875
imagick.setimageorientation.php                    30-Sep-2022 11:03                4654
imagick.setimagepage.php                           30-Sep-2022 11:03                3342
imagick.setimageprofile.php                        30-Sep-2022 11:03                3026
imagick.setimageproperty.php                       30-Sep-2022 11:03                4927
imagick.setimageredprimary.php                     30-Sep-2022 11:03                2883
imagick.setimagerenderingintent.php                30-Sep-2022 11:03                2716
imagick.setimageresolution.php                     30-Sep-2022 11:03                4882
imagick.setimagescene.php                          30-Sep-2022 11:03                2570
imagick.setimagetickspersecond.php                 30-Sep-2022 11:03                8249
imagick.setimagetype.php                           30-Sep-2022 11:03                2368
imagick.setimageunits.php                          30-Sep-2022 11:03                2404
imagick.setimagevirtualpixelmethod.php             30-Sep-2022 11:03                2524
imagick.setimagewhitepoint.php                     30-Sep-2022 11:03                2881
imagick.setinterlacescheme.php                     30-Sep-2022 11:03                2452
imagick.setiteratorindex.php                       30-Sep-2022 11:03                6122
imagick.setlastiterator.php                        30-Sep-2022 11:03                2211
imagick.setoption.php                              30-Sep-2022 11:03               12853
imagick.setpage.php                                30-Sep-2022 11:03                3095
imagick.setpointsize.php                           30-Sep-2022 11:03                5168
imagick.setprogressmonitor.php                     30-Sep-2022 11:03               12702
imagick.setregistry.php                            30-Sep-2022 11:03                2749
imagick.setresolution.php                          30-Sep-2022 11:03                3517
imagick.setresourcelimit.php                       30-Sep-2022 11:03                3424
imagick.setsamplingfactors.php                     30-Sep-2022 11:03                7088
imagick.setsize.php                                30-Sep-2022 11:03                2629
imagick.setsizeoffset.php                          30-Sep-2022 11:03                3059
imagick.settype.php                                30-Sep-2022 11:03                2314
imagick.setup.php                                  30-Sep-2022 11:03                1505
imagick.shadeimage.php                             30-Sep-2022 11:03                5433
imagick.shadowimage.php                            30-Sep-2022 11:03                5210
imagick.sharpenimage.php                           30-Sep-2022 11:03                5444
imagick.shaveimage.php                             30-Sep-2022 11:03                4611
imagick.shearimage.php                             30-Sep-2022 11:03                6386
imagick.sigmoidalcontrastimage.php                 30-Sep-2022 11:03                7757
imagick.sketchimage.php                            30-Sep-2022 11:03                5653
imagick.smushimages.php                            30-Sep-2022 11:03                5780
imagick.solarizeimage.php                          30-Sep-2022 11:03                4778
imagick.sparsecolorimage.php                       30-Sep-2022 11:03               31195
imagick.spliceimage.php                            30-Sep-2022 11:03                5598
imagick.spreadimage.php                            30-Sep-2022 11:03                4578
imagick.statisticimage.php                         30-Sep-2022 11:03                6674
imagick.steganoimage.php                           30-Sep-2022 11:03                2898
imagick.stereoimage.php                            30-Sep-2022 11:03                2679
imagick.stripimage.php                             30-Sep-2022 11:03                2117
imagick.subimagematch.php                          30-Sep-2022 11:03                7626
imagick.swirlimage.php                             30-Sep-2022 11:03                4630
imagick.textureimage.php                           30-Sep-2022 11:03                6353
imagick.thresholdimage.php                         30-Sep-2022 11:03                5150
imagick.thumbnailimage.php                         30-Sep-2022 11:03                6999
imagick.tintimage.php                              30-Sep-2022 11:03                7945
imagick.tostring.php                               30-Sep-2022 11:03                2844
imagick.transformimage.php                         30-Sep-2022 11:03                5913
imagick.transformimagecolorspace.php               30-Sep-2022 11:03                5768
imagick.transparentpaintimage.php                  30-Sep-2022 11:03                7248
imagick.transposeimage.php                         30-Sep-2022 11:03                4529
imagick.transverseimage.php                        30-Sep-2022 11:03                4517
imagick.trimimage.php                              30-Sep-2022 11:03                5644
imagick.uniqueimagecolors.php                      30-Sep-2022 11:03                5577
imagick.unsharpmaskimage.php                       30-Sep-2022 11:03                6434
imagick.valid.php                                  30-Sep-2022 11:03                2091
imagick.vignetteimage.php                          30-Sep-2022 11:03                6384
imagick.waveimage.php                              30-Sep-2022 11:03                6238
imagick.whitethresholdimage.php                    30-Sep-2022 11:03                5216
imagick.writeimage.php                             30-Sep-2022 11:03                2747
imagick.writeimagefile.php                         30-Sep-2022 11:03                3479
imagick.writeimages.php                            30-Sep-2022 11:03                2610
imagick.writeimagesfile.php                        30-Sep-2022 11:03                3529
imagickdraw.affine.php                             30-Sep-2022 11:03               18629
imagickdraw.annotation.php                         30-Sep-2022 11:03                3015
imagickdraw.arc.php                                30-Sep-2022 11:03                9811
imagickdraw.bezier.php                             30-Sep-2022 11:03               19549
imagickdraw.circle.php                             30-Sep-2022 11:03                9174
imagickdraw.clear.php                              30-Sep-2022 11:03                2215
imagickdraw.clone.php                              30-Sep-2022 11:03                2367
imagickdraw.color.php                              30-Sep-2022 11:03                3177
imagickdraw.comment.php                            30-Sep-2022 11:03                2509
imagickdraw.composite.php                          30-Sep-2022 11:03               12198
imagickdraw.construct.php                          30-Sep-2022 11:03                2142
imagickdraw.destroy.php                            30-Sep-2022 11:03                2184
imagickdraw.ellipse.php                            30-Sep-2022 11:03               12407
imagickdraw.getclippath.php                        30-Sep-2022 11:03                2182
imagickdraw.getcliprule.php                        30-Sep-2022 11:03                2305
imagickdraw.getclipunits.php                       30-Sep-2022 11:03                2191
imagickdraw.getfillcolor.php                       30-Sep-2022 11:03                2316
imagickdraw.getfillopacity.php                     30-Sep-2022 11:03                2218
imagickdraw.getfillrule.php                        30-Sep-2022 11:03                2267
imagickdraw.getfont.php                            30-Sep-2022 11:03                2149
imagickdraw.getfontfamily.php                      30-Sep-2022 11:03                2209
imagickdraw.getfontsize.php                        30-Sep-2022 11:03                2287
imagickdraw.getfontstretch.php                     30-Sep-2022 11:03                2214
imagickdraw.getfontstyle.php                       30-Sep-2022 11:03                2430
imagickdraw.getfontweight.php                      30-Sep-2022 11:03                2211
imagickdraw.getgravity.php                         30-Sep-2022 11:03                2335
imagickdraw.getstrokeantialias.php                 30-Sep-2022 11:03                2503
imagickdraw.getstrokecolor.php                     30-Sep-2022 11:03                2710
imagickdraw.getstrokedasharray.php                 30-Sep-2022 11:03                2345
imagickdraw.getstrokedashoffset.php                30-Sep-2022 11:03                2319
imagickdraw.getstrokelinecap.php                   30-Sep-2022 11:03                2460
imagickdraw.getstrokelinejoin.php                  30-Sep-2022 11:03                2489
imagickdraw.getstrokemiterlimit.php                30-Sep-2022 11:03                2581
imagickdraw.getstrokeopacity.php                   30-Sep-2022 11:03                2264
imagickdraw.getstrokewidth.php                     30-Sep-2022 11:03                2273
imagickdraw.gettextalignment.php                   30-Sep-2022 11:03                2351
imagickdraw.gettextantialias.php                   30-Sep-2022 11:03                2384
imagickdraw.gettextdecoration.php                  30-Sep-2022 11:03                2388
imagickdraw.gettextencoding.php                    30-Sep-2022 11:03                2311
imagickdraw.gettextinterlinespacing.php            30-Sep-2022 11:03                2274
imagickdraw.gettextinterwordspacing.php            30-Sep-2022 11:03                2298
imagickdraw.gettextkerning.php                     30-Sep-2022 11:03                2203
imagickdraw.gettextundercolor.php                  30-Sep-2022 11:03                2419
imagickdraw.getvectorgraphics.php                  30-Sep-2022 11:03                2409
imagickdraw.line.php                               30-Sep-2022 11:03                8348
imagickdraw.matte.php                              30-Sep-2022 11:03                8347
imagickdraw.pathclose.php                          30-Sep-2022 11:03                2307
imagickdraw.pathcurvetoabsolute.php                30-Sep-2022 11:03                4439
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-Sep-2022 11:03               12163
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-Sep-2022 11:03                3928
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-Sep-2022 11:03               10780
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-Sep-2022 11:03               10882
imagickdraw.pathcurvetorelative.php                30-Sep-2022 11:03                4455
imagickdraw.pathcurvetosmoothabsolute.php          30-Sep-2022 11:03                4300
imagickdraw.pathcurvetosmoothrelative.php          30-Sep-2022 11:03                4307
imagickdraw.pathellipticarcabsolute.php            30-Sep-2022 11:03                5105
imagickdraw.pathellipticarcrelative.php            30-Sep-2022 11:03                5075
imagickdraw.pathfinish.php                         30-Sep-2022 11:03                2140
imagickdraw.pathlinetoabsolute.php                 30-Sep-2022 11:03                2961
imagickdraw.pathlinetohorizontalabsolute.php       30-Sep-2022 11:03                2865
imagickdraw.pathlinetohorizontalrelative.php       30-Sep-2022 11:03                2860
imagickdraw.pathlinetorelative.php                 30-Sep-2022 11:03                3011
imagickdraw.pathlinetoverticalabsolute.php         30-Sep-2022 11:03                2829
imagickdraw.pathlinetoverticalrelative.php         30-Sep-2022 11:03                2834
imagickdraw.pathmovetoabsolute.php                 30-Sep-2022 11:03                3008
imagickdraw.pathmovetorelative.php                 30-Sep-2022 11:03                2944
imagickdraw.pathstart.php                          30-Sep-2022 11:03               12402
imagickdraw.point.php                              30-Sep-2022 11:03                6990
imagickdraw.polygon.php                            30-Sep-2022 11:03                9426
imagickdraw.polyline.php                           30-Sep-2022 11:03                9420
imagickdraw.pop.php                                30-Sep-2022 11:03                2454
imagickdraw.popclippath.php                        30-Sep-2022 11:03                2099
imagickdraw.popdefs.php                            30-Sep-2022 11:03                8032
imagickdraw.poppattern.php                         30-Sep-2022 11:03                2187
imagickdraw.push.php                               30-Sep-2022 11:03                8665
imagickdraw.pushclippath.php                       30-Sep-2022 11:03                2736
imagickdraw.pushdefs.php                           30-Sep-2022 11:03                2398
imagickdraw.pushpattern.php                        30-Sep-2022 11:03               15145
imagickdraw.rectangle.php                          30-Sep-2022 11:03                8589
imagickdraw.render.php                             30-Sep-2022 11:03                2229
imagickdraw.resetvectorgraphics.php                30-Sep-2022 11:03                2234
imagickdraw.rotate.php                             30-Sep-2022 11:03                7936
imagickdraw.roundrectangle.php                     30-Sep-2022 11:03                9301
imagickdraw.scale.php                              30-Sep-2022 11:03                8233
imagickdraw.setclippath.php                        30-Sep-2022 11:03                8676
imagickdraw.setcliprule.php                        30-Sep-2022 11:03                9784
imagickdraw.setclipunits.php                       30-Sep-2022 11:03                9126
imagickdraw.setfillalpha.php                       30-Sep-2022 11:03                7952
imagickdraw.setfillcolor.php                       30-Sep-2022 11:03                8022
imagickdraw.setfillopacity.php                     30-Sep-2022 11:03                8010
imagickdraw.setfillpatternurl.php                  30-Sep-2022 11:03                2961
imagickdraw.setfillrule.php                        30-Sep-2022 11:03               14731
imagickdraw.setfont.php                            30-Sep-2022 11:03                9539
imagickdraw.setfontfamily.php                      30-Sep-2022 11:03               10241
imagickdraw.setfontsize.php                        30-Sep-2022 11:03                8613
imagickdraw.setfontstretch.php                     30-Sep-2022 11:03               10445
imagickdraw.setfontstyle.php                       30-Sep-2022 11:03                9250
imagickdraw.setfontweight.php                      30-Sep-2022 11:03                9456
imagickdraw.setgravity.php                         30-Sep-2022 11:03               11352
imagickdraw.setresolution.php                      30-Sep-2022 11:03                2630
imagickdraw.setstrokealpha.php                     30-Sep-2022 11:03                8662
imagickdraw.setstrokeantialias.php                 30-Sep-2022 11:03                9220
imagickdraw.setstrokecolor.php                     30-Sep-2022 11:03                8779
imagickdraw.setstrokedasharray.php                 30-Sep-2022 11:03               13886
imagickdraw.setstrokedashoffset.php                30-Sep-2022 11:03               10293
imagickdraw.setstrokelinecap.php                   30-Sep-2022 11:03                8944
imagickdraw.setstrokelinejoin.php                  30-Sep-2022 11:03               12525
imagickdraw.setstrokemiterlimit.php                30-Sep-2022 11:03               12117
imagickdraw.setstrokeopacity.php                   30-Sep-2022 11:03               10588
imagickdraw.setstrokepatternurl.php                30-Sep-2022 11:03                2709
imagickdraw.setstrokewidth.php                     30-Sep-2022 11:03                8693
imagickdraw.settextalignment.php                   30-Sep-2022 11:03                9734
imagickdraw.settextantialias.php                   30-Sep-2022 11:03                9197
imagickdraw.settextdecoration.php                  30-Sep-2022 11:03                7630
imagickdraw.settextencoding.php                    30-Sep-2022 11:03                2943
imagickdraw.settextinterlinespacing.php            30-Sep-2022 11:03                2666
imagickdraw.settextinterwordspacing.php            30-Sep-2022 11:03                2536
imagickdraw.settextkerning.php                     30-Sep-2022 11:03                2585
imagickdraw.settextundercolor.php                  30-Sep-2022 11:03                8039
imagickdraw.setvectorgraphics.php                  30-Sep-2022 11:03                9430
imagickdraw.setviewbox.php                         30-Sep-2022 11:03               10829
imagickdraw.skewx.php                              30-Sep-2022 11:03                8447
imagickdraw.skewy.php                              30-Sep-2022 11:03                8436
imagickdraw.translate.php                          30-Sep-2022 11:03                8730
imagickpixel.clear.php                             30-Sep-2022 11:03                2194
imagickpixel.construct.php                         30-Sep-2022 11:03               13767
imagickpixel.destroy.php                           30-Sep-2022 11:03                2283
imagickpixel.getcolor.php                          30-Sep-2022 11:03                7608
imagickpixel.getcolorasstring.php                  30-Sep-2022 11:03                4783
imagickpixel.getcolorcount.php                     30-Sep-2022 11:03                4953
imagickpixel.getcolorquantum.php                   30-Sep-2022 11:03                2688
imagickpixel.getcolorvalue.php                     30-Sep-2022 11:03                8679
imagickpixel.getcolorvaluequantum.php              30-Sep-2022 11:03                6519
imagickpixel.gethsl.php                            30-Sep-2022 11:03                4248
imagickpixel.getindex.php                          30-Sep-2022 11:03                2130
imagickpixel.ispixelsimilar.php                    30-Sep-2022 11:03                3417
imagickpixel.ispixelsimilarquantum.php             30-Sep-2022 11:03                2954
imagickpixel.issimilar.php                         30-Sep-2022 11:03               22752
imagickpixel.setcolor.php                          30-Sep-2022 11:03                7603
imagickpixel.setcolorcount.php                     30-Sep-2022 11:03                2429
imagickpixel.setcolorvalue.php                     30-Sep-2022 11:03                4896
imagickpixel.setcolorvaluequantum.php              30-Sep-2022 11:03                8459
imagickpixel.sethsl.php                            30-Sep-2022 11:03                7443
imagickpixel.setindex.php                          30-Sep-2022 11:03                2364
imagickpixeliterator.clear.php                     30-Sep-2022 11:03                7135
imagickpixeliterator.construct.php                 30-Sep-2022 11:03                6852
imagickpixeliterator.destroy.php                   30-Sep-2022 11:03                2324
imagickpixeliterator.getcurrentiteratorrow.php     30-Sep-2022 11:03                2484
imagickpixeliterator.getiteratorrow.php            30-Sep-2022 11:03                2409
imagickpixeliterator.getnextiteratorrow.php        30-Sep-2022 11:03                7944
imagickpixeliterator.getpreviousiteratorrow.php    30-Sep-2022 11:03                2553
imagickpixeliterator.newpixeliterator.php          30-Sep-2022 11:03                2577
imagickpixeliterator.newpixelregioniterator.php    30-Sep-2022 11:03                3930
imagickpixeliterator.resetiterator.php             30-Sep-2022 11:03               10428
imagickpixeliterator.setiteratorfirstrow.php       30-Sep-2022 11:03                2418
imagickpixeliterator.setiteratorlastrow.php        30-Sep-2022 11:03                2411
imagickpixeliterator.setiteratorrow.php            30-Sep-2022 11:03                7808
imagickpixeliterator.synciterator.php              30-Sep-2022 11:03                2268
imap.configuration.php                             30-Sep-2022 11:03                3018
imap.constants.php                                 30-Sep-2022 11:03               17402
imap.installation.php                              30-Sep-2022 11:03                2502
imap.requirements.php                              30-Sep-2022 11:03                2958
imap.resources.php                                 30-Sep-2022 11:03                1328
imap.setup.php                                     30-Sep-2022 11:03                1477
index.php                                          30-Sep-2022 11:04               12604
indexes.examples.php                               30-Sep-2022 11:04              675388
indexes.functions.php                              30-Sep-2022 11:04             1108976
indexes.php                                        30-Sep-2022 11:04                1356
infiniteiterator.construct.php                     30-Sep-2022 11:03                5100
infiniteiterator.next.php                          30-Sep-2022 11:03                3212
info.configuration.php                             30-Sep-2022 11:03               17707
info.constants.php                                 30-Sep-2022 11:03               14716
info.installation.php                              30-Sep-2022 11:03                1134
info.requirements.php                              30-Sep-2022 11:03                1092
info.resources.php                                 30-Sep-2022 11:03                1112
info.setup.php                                     30-Sep-2022 11:03                1465
ini.core.php                                       30-Sep-2022 11:04               66474
ini.list.php                                       30-Sep-2022 11:04               89270
ini.php                                            30-Sep-2022 11:04                1483
ini.sections.php                                   30-Sep-2022 11:04                3940
inotify.configuration.php                          30-Sep-2022 11:03                1178
inotify.constants.php                              30-Sep-2022 11:03                7696
inotify.install.php                                30-Sep-2022 11:03                1613
inotify.requirements.php                           30-Sep-2022 11:03                1148
inotify.resources.php                              30-Sep-2022 11:03                1262
inotify.setup.php                                  30-Sep-2022 11:03                1502
install.cloud.azure.php                            30-Sep-2022 11:03                3726
install.cloud.ec2.php                              30-Sep-2022 11:03                1364
install.cloud.php                                  30-Sep-2022 11:03                1536
install.fpm.configuration.php                      30-Sep-2022 11:03               31266
install.fpm.install.php                            30-Sep-2022 11:03                3247
install.fpm.php                                    30-Sep-2022 11:03                3549
install.general.php                                30-Sep-2022 11:03                3874
install.macosx.bundled.php                         30-Sep-2022 11:03                9926
install.macosx.compile.php                         30-Sep-2022 11:03                1282
install.macosx.packages.php                        30-Sep-2022 11:03                2778
install.macosx.php                                 30-Sep-2022 11:03                1809
install.pecl.downloads.php                         30-Sep-2022 11:03                3253
install.pecl.intro.php                             30-Sep-2022 11:03                2672
install.pecl.pear.php                              30-Sep-2022 11:03                2754
install.pecl.php                                   30-Sep-2022 11:03                1813
install.pecl.php-config.php                        30-Sep-2022 11:03                3530
install.pecl.phpize.php                            30-Sep-2022 11:03                2686
install.pecl.static.php                            30-Sep-2022 11:03                2897
install.pecl.windows.php                           30-Sep-2022 11:03                8399
install.php                                        30-Sep-2022 11:03                5214
install.problems.bugs.php                          30-Sep-2022 11:03                1790
install.problems.faq.php                           30-Sep-2022 11:03                1263
install.problems.php                               30-Sep-2022 11:03                1489
install.problems.support.php                       30-Sep-2022 11:03                2125
install.unix.apache2.php                           30-Sep-2022 11:03               11756
install.unix.commandline.php                       30-Sep-2022 11:03                3566
install.unix.debian.php                            30-Sep-2022 11:03                6219
install.unix.lighttpd-14.php                       30-Sep-2022 11:03                5697
install.unix.litespeed.php                         30-Sep-2022 11:03                8386
install.unix.nginx.php                             30-Sep-2022 11:03                7940
install.unix.openbsd.php                           30-Sep-2022 11:03                5424
install.unix.php                                   30-Sep-2022 11:03                6226
install.unix.solaris.php                           30-Sep-2022 11:03                3632
install.windows.apache2.php                        30-Sep-2022 11:03                6396
install.windows.building.php                       30-Sep-2022 11:03                1599
install.windows.commandline.php                    30-Sep-2022 11:03                7608
install.windows.manual.php                         30-Sep-2022 11:03                5384
install.windows.pecl.php                           30-Sep-2022 11:03                1542
install.windows.php                                30-Sep-2022 11:03                2999
install.windows.recommended.php                    30-Sep-2022 11:03                4524
install.windows.requirements.php                   30-Sep-2022 11:03                2150
install.windows.tools.php                          30-Sep-2022 11:03                1710
install.windows.troubleshooting.php                30-Sep-2022 11:03                1604
internaliterator.construct.php                     30-Sep-2022 11:03                1907
internaliterator.current.php                       30-Sep-2022 11:03                2240
internaliterator.key.php                           30-Sep-2022 11:03                2214
internaliterator.next.php                          30-Sep-2022 11:03                2160
internaliterator.rewind.php                        30-Sep-2022 11:03                2180
internaliterator.valid.php                         30-Sep-2022 11:03                2131
intl.configuration.php                             30-Sep-2022 11:03                4917
intl.constants.php                                 30-Sep-2022 11:03                7272
intl.examples.basic.php                            30-Sep-2022 11:03                4426
intl.examples.php                                  30-Sep-2022 11:03                1331
intl.installation.php                              30-Sep-2022 11:03                2274
intl.requirements.php                              30-Sep-2022 11:03                1508
intl.resources.php                                 30-Sep-2022 11:03                1112
intl.setup.php                                     30-Sep-2022 11:03                1473
intlbreakiterator.construct.php                    30-Sep-2022 11:03                2340
intlbreakiterator.createcharacterinstance.php      30-Sep-2022 11:03                3061
intlbreakiterator.createcodepointinstance.php      30-Sep-2022 11:03                2683
intlbreakiterator.createlineinstance.php           30-Sep-2022 11:03                3022
intlbreakiterator.createsentenceinstance.php       30-Sep-2022 11:03                3024
intlbreakiterator.createtitleinstance.php          30-Sep-2022 11:03                3004
intlbreakiterator.createwordinstance.php           30-Sep-2022 11:03                2958
intlbreakiterator.current.php                      30-Sep-2022 11:03                2314
intlbreakiterator.first.php                        30-Sep-2022 11:03                2298
intlbreakiterator.following.php                    30-Sep-2022 11:03                2560
intlbreakiterator.geterrorcode.php                 30-Sep-2022 11:03                2779
intlbreakiterator.geterrormessage.php              30-Sep-2022 11:03                2914
intlbreakiterator.getlocale.php                    30-Sep-2022 11:03                2552
intlbreakiterator.getpartsiterator.php             30-Sep-2022 11:03                3354
intlbreakiterator.gettext.php                      30-Sep-2022 11:03                2373
intlbreakiterator.isboundary.php                   30-Sep-2022 11:03                2529
intlbreakiterator.last.php                         30-Sep-2022 11:03                2297
intlbreakiterator.next.php                         30-Sep-2022 11:03                2613
intlbreakiterator.preceding.php                    30-Sep-2022 11:03                2538
intlbreakiterator.previous.php                     30-Sep-2022 11:03                2353
intlbreakiterator.settext.php                      30-Sep-2022 11:03                2546
intlcalendar.add.php                               30-Sep-2022 11:03                8316
intlcalendar.after.php                             30-Sep-2022 11:03                6643
intlcalendar.before.php                            30-Sep-2022 11:03                3886
intlcalendar.clear.php                             30-Sep-2022 11:03               20663
intlcalendar.construct.php                         30-Sep-2022 11:03                2278
intlcalendar.createinstance.php                    30-Sep-2022 11:03               12800
intlcalendar.equals.php                            30-Sep-2022 11:03               10883
intlcalendar.fielddifference.php                   30-Sep-2022 11:03               11256
intlcalendar.fromdatetime.php                      30-Sep-2022 11:03                7402
intlcalendar.get.php                               30-Sep-2022 11:03                8808
intlcalendar.getactualmaximum.php                  30-Sep-2022 11:03                8359
intlcalendar.getactualminimum.php                  30-Sep-2022 11:03                5537
intlcalendar.getavailablelocales.php               30-Sep-2022 11:03                4121
intlcalendar.getdayofweektype.php                  30-Sep-2022 11:03                9772
intlcalendar.geterrorcode.php                      30-Sep-2022 11:03                8984
intlcalendar.geterrormessage.php                   30-Sep-2022 11:03                5904
intlcalendar.getfirstdayofweek.php                 30-Sep-2022 11:03                8422
intlcalendar.getgreatestminimum.php                30-Sep-2022 11:03                4381
intlcalendar.getkeywordvaluesforlocale.php         30-Sep-2022 11:03                7496
intlcalendar.getleastmaximum.php                   30-Sep-2022 11:03                8156
intlcalendar.getlocale.php                         30-Sep-2022 11:03                5874
intlcalendar.getmaximum.php                        30-Sep-2022 11:03                5070
intlcalendar.getminimaldaysinfirstweek.php         30-Sep-2022 11:03                8968
intlcalendar.getminimum.php                        30-Sep-2022 11:03                4325
intlcalendar.getnow.php                            30-Sep-2022 11:03                5258
intlcalendar.getrepeatedwalltimeoption.php         30-Sep-2022 11:03               10251
intlcalendar.getskippedwalltimeoption.php          30-Sep-2022 11:03               12660
intlcalendar.gettime.php                           30-Sep-2022 11:03                6387
intlcalendar.gettimezone.php                       30-Sep-2022 11:03                7478
intlcalendar.gettype.php                           30-Sep-2022 11:03                5542
intlcalendar.getweekendtransition.php              30-Sep-2022 11:03                4663
intlcalendar.indaylighttime.php                    30-Sep-2022 11:03                8703
intlcalendar.isequivalentto.php                    30-Sep-2022 11:03                8436
intlcalendar.islenient.php                         30-Sep-2022 11:03                8276
intlcalendar.isset.php                             30-Sep-2022 11:03                4556
intlcalendar.isweekend.php                         30-Sep-2022 11:03                8634
intlcalendar.roll.php                              30-Sep-2022 11:03                8971
intlcalendar.set.php                               30-Sep-2022 11:03               14014
intlcalendar.setfirstdayofweek.php                 30-Sep-2022 11:03                7827
intlcalendar.setlenient.php                        30-Sep-2022 11:03                4032
intlcalendar.setminimaldaysinfirstweek.php         30-Sep-2022 11:03                4035
intlcalendar.setrepeatedwalltimeoption.php         30-Sep-2022 11:03                5330
intlcalendar.setskippedwalltimeoption.php          30-Sep-2022 11:03                6039
intlcalendar.settime.php                           30-Sep-2022 11:03                8529
intlcalendar.settimezone.php                       30-Sep-2022 11:03               10811
intlcalendar.todatetime.php                        30-Sep-2022 11:03                7102
intlchar.charage.php                               30-Sep-2022 11:03                5439
intlchar.chardigitvalue.php                        30-Sep-2022 11:03                5111
intlchar.chardirection.php                         30-Sep-2022 11:03                8560
intlchar.charfromname.php                          30-Sep-2022 11:03                6645
intlchar.charmirror.php                            30-Sep-2022 11:03                5865
intlchar.charname.php                              30-Sep-2022 11:03                6904
intlchar.chartype.php                              30-Sep-2022 11:03                9099
intlchar.chr.php                                   30-Sep-2022 11:03                5273
intlchar.digit.php                                 30-Sep-2022 11:03                7756
intlchar.enumcharnames.php                         30-Sep-2022 11:03                7627
intlchar.enumchartypes.php                         30-Sep-2022 11:03                5691
intlchar.foldcase.php                              30-Sep-2022 11:03                3415
intlchar.fordigit.php                              30-Sep-2022 11:03                6798
intlchar.getbidipairedbracket.php                  30-Sep-2022 11:03                5463
intlchar.getblockcode.php                          30-Sep-2022 11:03                5191
intlchar.getcombiningclass.php                     30-Sep-2022 11:03                4505
intlchar.getfc-nfkc-closure.php                    30-Sep-2022 11:03                4446
intlchar.getintpropertymaxvalue.php                30-Sep-2022 11:03                6273
intlchar.getintpropertyminvalue.php                30-Sep-2022 11:03                6266
intlchar.getintpropertyvalue.php                   30-Sep-2022 11:03                7577
intlchar.getnumericvalue.php                       30-Sep-2022 11:03                5015
intlchar.getpropertyenum.php                       30-Sep-2022 11:03                6446
intlchar.getpropertyname.php                       30-Sep-2022 11:03                8114
intlchar.getpropertyvalueenum.php                  30-Sep-2022 11:03                7782
intlchar.getpropertyvaluename.php                  30-Sep-2022 11:03                9860
intlchar.getunicodeversion.php                     30-Sep-2022 11:03                3836
intlchar.hasbinaryproperty.php                     30-Sep-2022 11:03                8440
intlchar.isalnum.php                               30-Sep-2022 11:03                5233
intlchar.isalpha.php                               30-Sep-2022 11:03                5121
intlchar.isbase.php                                30-Sep-2022 11:03                5600
intlchar.isblank.php                               30-Sep-2022 11:03                6310
intlchar.iscntrl.php                               30-Sep-2022 11:03                5910
intlchar.isdefined.php                             30-Sep-2022 11:03                6342
intlchar.isdigit.php                               30-Sep-2022 11:03                5459
intlchar.isgraph.php                               30-Sep-2022 11:03                5155
intlchar.isidignorable.php                         30-Sep-2022 11:03                5739
intlchar.isidpart.php                              30-Sep-2022 11:03                6319
intlchar.isidstart.php                             30-Sep-2022 11:03                5824
intlchar.isisocontrol.php                          30-Sep-2022 11:03                5076
intlchar.isjavaidpart.php                          30-Sep-2022 11:03                6416
intlchar.isjavaidstart.php                         30-Sep-2022 11:03                6116
intlchar.isjavaspacechar.php                       30-Sep-2022 11:03                6354
intlchar.islower.php                               30-Sep-2022 11:03                6622
intlchar.ismirrored.php                            30-Sep-2022 11:03                5186
intlchar.isprint.php                               30-Sep-2022 11:03                5430
intlchar.ispunct.php                               30-Sep-2022 11:03                4902
intlchar.isspace.php                               30-Sep-2022 11:03                5997
intlchar.istitle.php                               30-Sep-2022 11:03                6058
intlchar.isualphabetic.php                         30-Sep-2022 11:03                5417
intlchar.isulowercase.php                          30-Sep-2022 11:03                6399
intlchar.isupper.php                               30-Sep-2022 11:03                6620
intlchar.isuuppercase.php                          30-Sep-2022 11:03                6437
intlchar.isuwhitespace.php                         30-Sep-2022 11:03                6943
intlchar.iswhitespace.php                          30-Sep-2022 11:03                7069
intlchar.isxdigit.php                              30-Sep-2022 11:03                6503
intlchar.ord.php                                   30-Sep-2022 11:03                5118
intlchar.tolower.php                               30-Sep-2022 11:03                7036
intlchar.totitle.php                               30-Sep-2022 11:03                7063
intlchar.toupper.php                               30-Sep-2022 11:03                6979
intlcodepointbreakiterator.getlastcodepoint.php    30-Sep-2022 11:03                2556
intldateformatter.create.php                       30-Sep-2022 11:03               27078
intldateformatter.format.php                       30-Sep-2022 11:03               27533
intldateformatter.formatobject.php                 30-Sep-2022 11:03               13934
intldateformatter.getcalendar.php                  30-Sep-2022 11:03                9395
intldateformatter.getcalendarobject.php            30-Sep-2022 11:03                7530
intldateformatter.getdatetype.php                  30-Sep-2022 11:03               12159
intldateformatter.geterrorcode.php                 30-Sep-2022 11:03                9192
intldateformatter.geterrormessage.php              30-Sep-2022 11:03                9100
intldateformatter.getlocale.php                    30-Sep-2022 11:03               12425
intldateformatter.getpattern.php                   30-Sep-2022 11:03               10715
intldateformatter.gettimetype.php                  30-Sep-2022 11:03               12153
intldateformatter.gettimezone.php                  30-Sep-2022 11:03                8676
intldateformatter.gettimezoneid.php                30-Sep-2022 11:03                9047
intldateformatter.islenient.php                    30-Sep-2022 11:03               15825
intldateformatter.localtime.php                    30-Sep-2022 11:03               11671
intldateformatter.parse.php                        30-Sep-2022 11:03               12414
intldateformatter.setcalendar.php                  30-Sep-2022 11:03               14465
intldateformatter.setlenient.php                   30-Sep-2022 11:03               16580
intldateformatter.setpattern.php                   30-Sep-2022 11:03               11793
intldateformatter.settimezone.php                  30-Sep-2022 11:03               11492
intldatepatterngenerator.create.php                30-Sep-2022 11:03                3754
intldatepatterngenerator.getbestpattern.php        30-Sep-2022 11:03                6779
intlgregoriancalendar.construct.php                30-Sep-2022 11:03                5033
intlgregoriancalendar.getgregorianchange.php       30-Sep-2022 11:03                2520
intlgregoriancalendar.isleapyear.php               30-Sep-2022 11:03                2758
intlgregoriancalendar.setgregorianchange.php       30-Sep-2022 11:03                2780
intliterator.current.php                           30-Sep-2022 11:03                2287
intliterator.key.php                               30-Sep-2022 11:03                2256
intliterator.next.php                              30-Sep-2022 11:03                2206
intliterator.rewind.php                            30-Sep-2022 11:03                2234
intliterator.valid.php                             30-Sep-2022 11:03                2173
intlpartsiterator.getbreakiterator.php             30-Sep-2022 11:03                2457
intlrulebasedbreakiterator.construct.php           30-Sep-2022 11:03                2945
intlrulebasedbreakiterator.getbinaryrules.php      30-Sep-2022 11:03                2628
intlrulebasedbreakiterator.getrules.php            30-Sep-2022 11:03                2592
intlrulebasedbreakiterator.getrulestatus.php       30-Sep-2022 11:03                2592
intlrulebasedbreakiterator.getrulestatusvec.php    30-Sep-2022 11:03                2688
intltimezone.construct.php                         30-Sep-2022 11:03                1919
intltimezone.countequivalentids.php                30-Sep-2022 11:03                3306
intltimezone.createdefault.php                     30-Sep-2022 11:03                2902
intltimezone.createenumeration.php                 30-Sep-2022 11:03                4062
intltimezone.createtimezone.php                    30-Sep-2022 11:03                3338
intltimezone.createtimezoneidenumeration.php       30-Sep-2022 11:03                4983
intltimezone.fromdatetimezone.php                  30-Sep-2022 11:03                3579
intltimezone.getcanonicalid.php                    30-Sep-2022 11:03                3809
intltimezone.getdisplayname.php                    30-Sep-2022 11:03                4714
intltimezone.getdstsavings.php                     30-Sep-2022 11:03                2918
intltimezone.getequivalentid.php                   30-Sep-2022 11:03                3596
intltimezone.geterrorcode.php                      30-Sep-2022 11:03                3038
intltimezone.geterrormessage.php                   30-Sep-2022 11:03                3062
intltimezone.getgmt.php                            30-Sep-2022 11:03                2751
intltimezone.getid.php                             30-Sep-2022 11:03                2914
intltimezone.getidforwindowsid.php                 30-Sep-2022 11:03                5141
intltimezone.getoffset.php                         30-Sep-2022 11:03                4446
intltimezone.getrawoffset.php                      30-Sep-2022 11:03                2869
intltimezone.getregion.php                         30-Sep-2022 11:03                3252
intltimezone.gettzdataversion.php                  30-Sep-2022 11:03                2953
intltimezone.getunknown.php                        30-Sep-2022 11:03                2966
intltimezone.getwindowsid.php                      30-Sep-2022 11:03                4004
intltimezone.hassamerules.php                      30-Sep-2022 11:03                3314
intltimezone.todatetimezone.php                    30-Sep-2022 11:03                3283
intltimezone.usedaylighttime.php                   30-Sep-2022 11:03                2893
intro-whatcando.php                                30-Sep-2022 11:03                7442
intro-whatis.php                                   30-Sep-2022 11:03                4231
intro.apache.php                                   30-Sep-2022 11:03                1100
intro.apcu.php                                     30-Sep-2022 11:03                1499
intro.array.php                                    30-Sep-2022 11:03                1735
intro.bc.php                                       30-Sep-2022 11:03                4289
intro.bzip2.php                                    30-Sep-2022 11:03                1097
intro.calendar.php                                 30-Sep-2022 11:03                1866
intro.classobj.php                                 30-Sep-2022 11:03                1554
intro.cmark.php                                    30-Sep-2022 11:03                6319
intro.com.php                                      30-Sep-2022 11:03                3021
intro.componere.php                                30-Sep-2022 11:03                6082
intro.csprng.php                                   30-Sep-2022 11:03                1600
intro.ctype.php                                    30-Sep-2022 11:03                3193
intro.cubrid.php                                   30-Sep-2022 11:03                1403
intro.curl.php                                     30-Sep-2022 11:03                1414
intro.datetime.php                                 30-Sep-2022 11:03                1922
intro.dba.php                                      30-Sep-2022 11:03                1429
intro.dbase.php                                    30-Sep-2022 11:03                6141
intro.dio.php                                      30-Sep-2022 11:03                1628
intro.dom.php                                      30-Sep-2022 11:03                1601
intro.ds.php                                       30-Sep-2022 11:03                1294
intro.eio.php                                      30-Sep-2022 11:03               15514
intro.enchant.php                                  30-Sep-2022 11:03                2542
intro.errorfunc.php                                30-Sep-2022 11:03                1679
intro.ev.php                                       30-Sep-2022 11:03                2210
intro.event.php                                    30-Sep-2022 11:03                1913
intro.exec.php                                     30-Sep-2022 11:03                1656
intro.exif.php                                     30-Sep-2022 11:03                1361
intro.expect.php                                   30-Sep-2022 11:03                1363
intro.fann.php                                     30-Sep-2022 11:03                1283
intro.fdf.php                                      30-Sep-2022 11:03                3758
intro.ffi.php                                      30-Sep-2022 11:03                2477
intro.fileinfo.php                                 30-Sep-2022 11:03                1315
intro.filesystem.php                               30-Sep-2022 11:03                1321
intro.filter.php                                   30-Sep-2022 11:03                2601
intro.fpm.php                                      30-Sep-2022 11:03                1227
intro.ftp.php                                      30-Sep-2022 11:03                1612
intro.funchand.php                                 30-Sep-2022 11:03                1110
intro.gearman.php                                  30-Sep-2022 11:03                1593
intro.gender.php                                   30-Sep-2022 11:03                1261
intro.geoip.php                                    30-Sep-2022 11:03                1218
intro.gettext.php                                  30-Sep-2022 11:03                1425
intro.gmagick.php                                  30-Sep-2022 11:03                1623
intro.gmp.php                                      30-Sep-2022 11:03                2934
intro.gnupg.php                                    30-Sep-2022 11:03                1150
intro.hash.php                                     30-Sep-2022 11:03                1133
intro.hrtime.php                                   30-Sep-2022 11:03                1596
intro.ibase.php                                    30-Sep-2022 11:03                3077
intro.ibm-db2.php                                  30-Sep-2022 11:03                1210
intro.iconv.php                                    30-Sep-2022 11:03                1816
intro.igbinary.php                                 30-Sep-2022 11:03                1605
intro.image.php                                    30-Sep-2022 11:03                5994
intro.imagick.php                                  30-Sep-2022 11:03                1642
intro.imap.php                                     30-Sep-2022 11:03                1372
intro.info.php                                     30-Sep-2022 11:03                1381
intro.inotify.php                                  30-Sep-2022 11:03                2313
intro.intl.php                                     30-Sep-2022 11:03                4948
intro.json.php                                     30-Sep-2022 11:03                1513
intro.ldap.php                                     30-Sep-2022 11:03                4011
intro.libxml.php                                   30-Sep-2022 11:03                1702
intro.lua.php                                      30-Sep-2022 11:03                1190
intro.luasandbox.php                               30-Sep-2022 11:03                2295
intro.lzf.php                                      30-Sep-2022 11:03                1351
intro.mail.php                                     30-Sep-2022 11:03                1143
intro.mailparse.php                                30-Sep-2022 11:03                1869
intro.math.php                                     30-Sep-2022 11:03                1861
intro.mbstring.php                                 30-Sep-2022 11:03                2523
intro.mcrypt.php                                   30-Sep-2022 11:03                2203
intro.memcache.php                                 30-Sep-2022 11:03                1588
intro.memcached.php                                30-Sep-2022 11:03                1812
intro.mhash.php                                    30-Sep-2022 11:03                2717
intro.misc.php                                     30-Sep-2022 11:03                1089
intro.mqseries.php                                 30-Sep-2022 11:03                1674
intro.mysql-xdevapi.php                            30-Sep-2022 11:03                1810
intro.mysql.php                                    30-Sep-2022 11:03                1825
intro.mysqli.php                                   30-Sep-2022 11:03                2179
intro.mysqlnd.php                                  30-Sep-2022 11:03                1885
intro.network.php                                  30-Sep-2022 11:03                1079
intro.oauth.php                                    30-Sep-2022 11:03                1226
intro.oci8.php                                     30-Sep-2022 11:03                1406
intro.opcache.php                                  30-Sep-2022 11:03                1518
intro.openal.php                                   30-Sep-2022 11:03                1183
intro.openssl.php                                  30-Sep-2022 11:03                1417
intro.outcontrol.php                               30-Sep-2022 11:03                2157
intro.parallel.php                                 30-Sep-2022 11:03                6801
intro.parle.php                                    30-Sep-2022 11:03                3369
intro.password.php                                 30-Sep-2022 11:03                1502
intro.pcntl.php                                    30-Sep-2022 11:03                2610
intro.pcre.php                                     30-Sep-2022 11:03                2405
intro.pdo.php                                      30-Sep-2022 11:03                1914
intro.pgsql.php                                    30-Sep-2022 11:03                1508
intro.phar.php                                     30-Sep-2022 11:03               10044
intro.phpdbg.php                                   30-Sep-2022 11:03                5971
intro.posix.php                                    30-Sep-2022 11:03                1641
intro.ps.php                                       30-Sep-2022 11:03                1692
intro.pspell.php                                   30-Sep-2022 11:03                1125
intro.pthreads.php                                 30-Sep-2022 11:03                9419
intro.quickhash.php                                30-Sep-2022 11:03                1197
intro.radius.php                                   30-Sep-2022 11:03                2097
intro.rar.php                                      30-Sep-2022 11:03                1471
intro.readline.php                                 30-Sep-2022 11:03                1822
intro.recode.php                                   30-Sep-2022 11:03                2185
intro.reflection.php                               30-Sep-2022 11:03                1595
intro.rpminfo.php                                  30-Sep-2022 11:03                1156
intro.rrd.php                                      30-Sep-2022 11:03                1366
intro.runkit7.php                                  30-Sep-2022 11:03                1409
intro.scoutapm.php                                 30-Sep-2022 11:03                1386
intro.seaslog.php                                  30-Sep-2022 11:03                3598
intro.sem.php                                      30-Sep-2022 11:03                3155
intro.session.php                                  30-Sep-2022 11:03                5324
intro.shmop.php                                    30-Sep-2022 11:03                1171
intro.simplexml.php                                30-Sep-2022 11:03                1225
intro.snmp.php                                     30-Sep-2022 11:03                1589
intro.soap.php                                     30-Sep-2022 11:03                1394
intro.sockets.php                                  30-Sep-2022 11:03                2304
intro.sodium.php                                   30-Sep-2022 11:03                1260
intro.solr.php                                     30-Sep-2022 11:03                1715
intro.spl.php                                      30-Sep-2022 11:03                1430
intro.sqlite3.php                                  30-Sep-2022 11:03                1092
intro.sqlsrv.php                                   30-Sep-2022 11:03                2096
intro.ssdeep.php                                   30-Sep-2022 11:03                1689
intro.ssh2.php                                     30-Sep-2022 11:03                1271
intro.stats.php                                    30-Sep-2022 11:03                1441
intro.stomp.php                                    30-Sep-2022 11:03                1274
intro.stream.php                                   30-Sep-2022 11:03                3800
intro.strings.php                                  30-Sep-2022 11:03                1520
intro.svm.php                                      30-Sep-2022 11:03                1157
intro.svn.php                                      30-Sep-2022 11:03                1691
intro.swoole.php                                   30-Sep-2022 11:03                1565
intro.sync.php                                     30-Sep-2022 11:03                2284
intro.taint.php                                    30-Sep-2022 11:03                4447
intro.tcpwrap.php                                  30-Sep-2022 11:03                1203
intro.tidy.php                                     30-Sep-2022 11:03                1339
intro.tokenizer.php                                30-Sep-2022 11:03                1443
intro.trader.php                                   30-Sep-2022 11:03                2318
intro.ui.php                                       30-Sep-2022 11:03                1141
intro.uodbc.php                                    30-Sep-2022 11:03                2688
intro.uopz.php                                     30-Sep-2022 11:03                2333
intro.url.php                                      30-Sep-2022 11:03                1064
intro.v8js.php                                     30-Sep-2022 11:03                1158
intro.var.php                                      30-Sep-2022 11:03                1252
intro.var_representation.php                       30-Sep-2022 11:03                1359
intro.varnish.php                                  30-Sep-2022 11:03                1248
intro.wddx.php                                     30-Sep-2022 11:03                2109
intro.win32service.php                             30-Sep-2022 11:03                1331
intro.wincache.php                                 30-Sep-2022 11:03                4905
intro.wkhtmltox.php                                30-Sep-2022 11:03                1207
intro.xattr.php                                    30-Sep-2022 11:03                1120
intro.xdiff.php                                    30-Sep-2022 11:03                2542
intro.xhprof.php                                   30-Sep-2022 11:03                2471
intro.xlswriter.php                                30-Sep-2022 11:03                1120
intro.xml.php                                      30-Sep-2022 11:03                2172
intro.xmldiff.php                                  30-Sep-2022 11:03                1341
intro.xmlreader.php                                30-Sep-2022 11:03                1518
intro.xmlrpc.php                                   30-Sep-2022 11:03                1773
intro.xmlwriter.php                                30-Sep-2022 11:03                1479
intro.xsl.php                                      30-Sep-2022 11:03                1268
intro.yac.php                                      30-Sep-2022 11:03                1132
intro.yaconf.php                                   30-Sep-2022 11:03                2500
intro.yaf.php                                      30-Sep-2022 11:03                1526
intro.yaml.php                                     30-Sep-2022 11:03                1311
intro.yar.php                                      30-Sep-2022 11:03                1262
intro.yaz.php                                      30-Sep-2022 11:03                2425
intro.zip.php                                      30-Sep-2022 11:03                1095
intro.zlib.php                                     30-Sep-2022 11:03                1626
intro.zmq.php                                      30-Sep-2022 11:03                1296
intro.zookeeper.php                                30-Sep-2022 11:03                1378
introduction.php                                   30-Sep-2022 11:03                1366
iterator.current.php                               30-Sep-2022 11:03                2109
iterator.key.php                                   30-Sep-2022 11:03                2412
iterator.next.php                                  30-Sep-2022 11:03                2305
iterator.rewind.php                                30-Sep-2022 11:03                2517
iterator.valid.php                                 30-Sep-2022 11:03                2439
iteratoraggregate.getiterator.php                  30-Sep-2022 11:03                2765
iteratoriterator.construct.php                     30-Sep-2022 11:03                2925
iteratoriterator.current.php                       30-Sep-2022 11:03                2703
iteratoriterator.getinneriterator.php              30-Sep-2022 11:03                3017
iteratoriterator.key.php                           30-Sep-2022 11:03                2651
iteratoriterator.next.php                          30-Sep-2022 11:03                2747
iteratoriterator.rewind.php                        30-Sep-2022 11:03                2766
iteratoriterator.valid.php                         30-Sep-2022 11:03                2808
json.configuration.php                             30-Sep-2022 11:03                1155
json.constants.php                                 30-Sep-2022 11:03               12198
json.installation.php                              30-Sep-2022 11:03                1626
json.requirements.php                              30-Sep-2022 11:03                1124
json.resources.php                                 30-Sep-2022 11:03                1112
json.setup.php                                     30-Sep-2022 11:03                1445
jsonserializable.jsonserialize.php                 30-Sep-2022 11:03               12761
langref.php                                        30-Sep-2022 11:03               17975
language.attributes.classes.php                    30-Sep-2022 11:03                5209
language.attributes.overview.php                   30-Sep-2022 11:03               11166
language.attributes.php                            30-Sep-2022 11:03                1608
language.attributes.reflection.php                 30-Sep-2022 11:03                8310
language.attributes.syntax.php                     30-Sep-2022 11:03                4885
language.basic-syntax.comments.php                 30-Sep-2022 11:03                4029
language.basic-syntax.instruction-separation.php   30-Sep-2022 11:03                4004
language.basic-syntax.php                          30-Sep-2022 11:03                1575
language.basic-syntax.phpmode.php                  30-Sep-2022 11:03                4475
language.basic-syntax.phptags.php                  30-Sep-2022 11:03                5005
language.constants.magic.php                       30-Sep-2022 11:03                4622
language.constants.php                             30-Sep-2022 11:03                5988
language.constants.predefined.php                  30-Sep-2022 11:03                1428
language.constants.syntax.php                      30-Sep-2022 11:03                9785
language.control-structures.php                    30-Sep-2022 11:03                2681
language.enumerations.backed.php                   30-Sep-2022 11:03                9747
language.enumerations.basics.php                   30-Sep-2022 11:03                7371
language.enumerations.constants.php                30-Sep-2022 11:03                2328
language.enumerations.examples.php                 30-Sep-2022 11:03                7694
language.enumerations.expressions.php              30-Sep-2022 11:03                5537
language.enumerations.listing.php                  30-Sep-2022 11:03                2191
language.enumerations.methods.php                  30-Sep-2022 11:03               15632
language.enumerations.object-differences.php       30-Sep-2022 11:03                4635
language.enumerations.overview.php                 30-Sep-2022 11:03                2047
language.enumerations.php                          30-Sep-2022 11:03                2213
language.enumerations.serialization.php            30-Sep-2022 11:03                4735
language.enumerations.static-methods.php           30-Sep-2022 11:03                3595
language.enumerations.traits.php                   30-Sep-2022 11:03                4871
language.errors.basics.php                         30-Sep-2022 11:03                4394
language.errors.php                                30-Sep-2022 11:03                1749
language.errors.php7.php                           30-Sep-2022 11:03                5763
language.exceptions.extending.php                  30-Sep-2022 11:03               24232
language.exceptions.php                            30-Sep-2022 11:03               29516
language.expressions.php                           30-Sep-2022 11:03               13774
language.fibers.php                                30-Sep-2022 11:03                6187
language.functions.php                             30-Sep-2022 11:03                1831
language.generators.comparison.php                 30-Sep-2022 11:03               10285
language.generators.overview.php                   30-Sep-2022 11:03                9879
language.generators.php                            30-Sep-2022 11:03                1506
language.generators.syntax.php                     30-Sep-2022 11:03               26104
language.namespaces.basics.php                     30-Sep-2022 11:03               12454
language.namespaces.definition.php                 30-Sep-2022 11:03                4198
language.namespaces.definitionmultiple.php         30-Sep-2022 11:03                9829
language.namespaces.dynamic.php                    30-Sep-2022 11:03                8586
language.namespaces.fallback.php                   30-Sep-2022 11:03                6518
language.namespaces.faq.php                        30-Sep-2022 11:03               32831
language.namespaces.global.php                     30-Sep-2022 11:03                2969
language.namespaces.importing.php                  30-Sep-2022 11:03               18078
language.namespaces.nested.php                     30-Sep-2022 11:03                2947
language.namespaces.nsconstants.php                30-Sep-2022 11:03                9559
language.namespaces.php                            30-Sep-2022 11:03                2336
language.namespaces.rationale.php                  30-Sep-2022 11:03                6394
language.namespaces.rules.php                      30-Sep-2022 11:03               14108
language.oop5.abstract.php                         30-Sep-2022 11:03               12025
language.oop5.anonymous.php                        30-Sep-2022 11:03               11824
language.oop5.autoload.php                         30-Sep-2022 11:03                6340
language.oop5.basic.php                            30-Sep-2022 11:03               46922
language.oop5.changelog.php                        30-Sep-2022 11:03               11906
language.oop5.cloning.php                          30-Sep-2022 11:03                9207
language.oop5.constants.php                        30-Sep-2022 11:03                9296
language.oop5.decon.php                            30-Sep-2022 11:03               28176
language.oop5.final.php                            30-Sep-2022 11:03                6705
language.oop5.inheritance.php                      30-Sep-2022 11:03               13600
language.oop5.interfaces.php                       30-Sep-2022 11:03               22393
language.oop5.iterations.php                       30-Sep-2022 11:03                6264
language.oop5.late-static-bindings.php             30-Sep-2022 11:03               15597
language.oop5.magic.php                            30-Sep-2022 11:03               45630
language.oop5.object-comparison.php                30-Sep-2022 11:03                9505
language.oop5.overloading.php                      30-Sep-2022 11:03               25163
language.oop5.paamayim-nekudotayim.php             30-Sep-2022 11:03                8572
language.oop5.php                                  30-Sep-2022 11:03                3159
language.oop5.properties.php                       30-Sep-2022 11:03               28096
language.oop5.references.php                       30-Sep-2022 11:03                6023
language.oop5.serialization.php                    30-Sep-2022 11:03                6990
language.oop5.static.php                           30-Sep-2022 11:03                9249
language.oop5.traits.php                           30-Sep-2022 11:03               34255
language.oop5.variance.php                         30-Sep-2022 11:03               16719
language.oop5.visibility.php                       30-Sep-2022 11:03               28308
language.operators.arithmetic.php                  30-Sep-2022 11:03                5822
language.operators.array.php                       30-Sep-2022 11:03                9032
language.operators.assignment.php                  30-Sep-2022 11:03               11118
language.operators.bitwise.php                     30-Sep-2022 11:03               46081
language.operators.comparison.php                  30-Sep-2022 11:03               41198
language.operators.errorcontrol.php                30-Sep-2022 11:03                5702
language.operators.execution.php                   30-Sep-2022 11:03                3248
language.operators.increment.php                   30-Sep-2022 11:03               11014
language.operators.logical.php                     30-Sep-2022 11:03                7468
language.operators.php                             30-Sep-2022 11:03                3585
language.operators.precedence.php                  30-Sep-2022 11:03               19822
language.operators.string.php                      30-Sep-2022 11:03                3143
language.operators.type.php                        30-Sep-2022 11:03               18552
language.references.arent.php                      30-Sep-2022 11:03                3034
language.references.pass.php                       30-Sep-2022 11:03                6686
language.references.php                            30-Sep-2022 11:03                1785
language.references.return.php                     30-Sep-2022 11:03                7099
language.references.spot.php                       30-Sep-2022 11:03                2537
language.references.unset.php                      30-Sep-2022 11:03                2153
language.references.whatare.php                    30-Sep-2022 11:03                1789
language.references.whatdo.php                     30-Sep-2022 11:03               18451
language.types.array.php                           30-Sep-2022 11:03              105578
language.types.boolean.php                         30-Sep-2022 11:03                9033
language.types.callable.php                        30-Sep-2022 11:03               12086
language.types.declarations.php                    30-Sep-2022 11:03               51216
language.types.enumerations.php                    30-Sep-2022 11:03                3477
language.types.float.php                           30-Sep-2022 11:03                8184
language.types.integer.php                         30-Sep-2022 11:03               19462
language.types.intro.php                           30-Sep-2022 11:03                7355
language.types.iterable.php                        30-Sep-2022 11:03                6647
language.types.null.php                            30-Sep-2022 11:03                3386
language.types.numeric-strings.php                 30-Sep-2022 11:03               10415
language.types.object.php                          30-Sep-2022 11:03                5317
language.types.php                                 30-Sep-2022 11:03                2359
language.types.resource.php                        30-Sep-2022 11:03                2570
language.types.string.php                          30-Sep-2022 11:03               78274
language.types.type-juggling.php                   30-Sep-2022 11:03               17396
language.variables.basics.php                      30-Sep-2022 11:03               13741
language.variables.external.php                    30-Sep-2022 11:03               18410
language.variables.php                             30-Sep-2022 11:03                1626
language.variables.predefined.php                  30-Sep-2022 11:03                2588
language.variables.scope.php                       30-Sep-2022 11:03               28321
language.variables.superglobals.php                30-Sep-2022 11:03                4245
language.variables.variable.php                    30-Sep-2022 11:03               10013
ldap.configuration.php                             30-Sep-2022 11:03                2181
ldap.constants.php                                 30-Sep-2022 11:03               24456
ldap.controls.php                                  30-Sep-2022 11:03                8677
ldap.examples-basic.php                            30-Sep-2022 11:03                9401
ldap.examples-controls.php                         30-Sep-2022 11:03               18975
ldap.examples.php                                  30-Sep-2022 11:03                1355
ldap.installation.php                              30-Sep-2022 11:03                2606
ldap.requirements.php                              30-Sep-2022 11:03                1440
ldap.resources.php                                 30-Sep-2022 11:03                1341
ldap.setup.php                                     30-Sep-2022 11:03                1472
ldap.using.php                                     30-Sep-2022 11:03                2170
libxml.configuration.php                           30-Sep-2022 11:03                1169
libxml.constants.php                               30-Sep-2022 11:03                9905
libxml.installation.php                            30-Sep-2022 11:03                2438
libxml.requirements.php                            30-Sep-2022 11:03                1193
libxml.resources.php                               30-Sep-2022 11:03                1126
libxml.setup.php                                   30-Sep-2022 11:03                1487
limititerator.construct.php                        30-Sep-2022 11:03                7245
limititerator.current.php                          30-Sep-2022 11:03                3555
limititerator.getinneriterator.php                 30-Sep-2022 11:03                3086
limititerator.getposition.php                      30-Sep-2022 11:03                5892
limititerator.key.php                              30-Sep-2022 11:03                3661
limititerator.next.php                             30-Sep-2022 11:03                3257
limititerator.rewind.php                           30-Sep-2022 11:03                3425
limititerator.seek.php                             30-Sep-2022 11:03                4018
limititerator.valid.php                            30-Sep-2022 11:03                3350
locale.acceptfromhttp.php                          30-Sep-2022 11:03                5781
locale.canonicalize.php                            30-Sep-2022 11:03                2795
locale.composelocale.php                           30-Sep-2022 11:03               13707
locale.filtermatches.php                           30-Sep-2022 11:03                8492
locale.getallvariants.php                          30-Sep-2022 11:03                6120
locale.getdefault.php                              30-Sep-2022 11:03                5715
locale.getdisplaylanguage.php                      30-Sep-2022 11:03                9265
locale.getdisplayname.php                          30-Sep-2022 11:03                9249
locale.getdisplayregion.php                        30-Sep-2022 11:03                9213
locale.getdisplayscript.php                        30-Sep-2022 11:03                9220
locale.getdisplayvariant.php                       30-Sep-2022 11:03                9261
locale.getkeywords.php                             30-Sep-2022 11:03                6941
locale.getprimarylanguage.php                      30-Sep-2022 11:03                5586
locale.getregion.php                               30-Sep-2022 11:03                5476
locale.getscript.php                               30-Sep-2022 11:03                5270
locale.lookup.php                                  30-Sep-2022 11:03                9184
locale.parselocale.php                             30-Sep-2022 11:03                7185
locale.setdefault.php                              30-Sep-2022 11:03                5021
lua.assign.php                                     30-Sep-2022 11:03                4465
lua.call.php                                       30-Sep-2022 11:03                7301
lua.configuration.php                              30-Sep-2022 11:03                1148
lua.construct.php                                  30-Sep-2022 11:03                2260
lua.eval.php                                       30-Sep-2022 11:03                3559
lua.getversion.php                                 30-Sep-2022 11:03                2111
lua.include.php                                    30-Sep-2022 11:03                2497
lua.installation.php                               30-Sep-2022 11:03                1837
lua.registercallback.php                           30-Sep-2022 11:03                4412
lua.requirements.php                               30-Sep-2022 11:03                1173
lua.resources.php                                  30-Sep-2022 11:03                1115
lua.setup.php                                      30-Sep-2022 11:03                1432
luaclosure.invoke.php                              30-Sep-2022 11:03                4578
luasandbox.callfunction.php                        30-Sep-2022 11:03                4857
luasandbox.configuration.php                       30-Sep-2022 11:03                1197
luasandbox.disableprofiler.php                     30-Sep-2022 11:03                2798
luasandbox.enableprofiler.php                      30-Sep-2022 11:03                3367
luasandbox.examples-basic.php                      30-Sep-2022 11:03                7400
luasandbox.examples.php                            30-Sep-2022 11:03                1415
luasandbox.getcpuusage.php                         30-Sep-2022 11:03                3538
luasandbox.getmemoryusage.php                      30-Sep-2022 11:03                3116
luasandbox.getpeakmemoryusage.php                  30-Sep-2022 11:03                3166
luasandbox.getprofilerfunctionreport.php           30-Sep-2022 11:03                5625
luasandbox.getversioninfo.php                      30-Sep-2022 11:03                2868
luasandbox.installation.php                        30-Sep-2022 11:03                1977
luasandbox.loadbinary.php                          30-Sep-2022 11:03                3482
luasandbox.loadstring.php                          30-Sep-2022 11:03                5583
luasandbox.pauseusagetimer.php                     30-Sep-2022 11:03               10229
luasandbox.registerlibrary.php                     30-Sep-2022 11:03                6846
luasandbox.requirements.php                        30-Sep-2022 11:03                1689
luasandbox.resources.php                           30-Sep-2022 11:03                1180
luasandbox.setcpulimit.php                         30-Sep-2022 11:03                5935
luasandbox.setmemorylimit.php                      30-Sep-2022 11:03                5588
luasandbox.setup.php                               30-Sep-2022 11:03                1523
luasandbox.unpauseusagetimer.php                   30-Sep-2022 11:03                3094
luasandbox.wrapphpfunction.php                     30-Sep-2022 11:03                4300
luasandboxfunction.call.php                        30-Sep-2022 11:03                6831
luasandboxfunction.construct.php                   30-Sep-2022 11:03                2631
luasandboxfunction.dump.php                        30-Sep-2022 11:03                2327
lzf.configuration.php                              30-Sep-2022 11:03                1148
lzf.constants.php                                  30-Sep-2022 11:03                1064
lzf.installation.php                               30-Sep-2022 11:03                2289
lzf.requirements.php                               30-Sep-2022 11:03                1085
lzf.resources.php                                  30-Sep-2022 11:03                1105
lzf.setup.php                                      30-Sep-2022 11:03                1453
mail.configuration.php                             30-Sep-2022 11:03                5994
mail.constants.php                                 30-Sep-2022 11:03                1073
mail.installation.php                              30-Sep-2022 11:03                1134
mail.requirements.php                              30-Sep-2022 11:03                1776
mail.resources.php                                 30-Sep-2022 11:03                1112
mail.setup.php                                     30-Sep-2022 11:03                1468
mailparse.configuration.php                        30-Sep-2022 11:03                2293
mailparse.constants.php                            30-Sep-2022 11:03                1860
mailparse.installation.php                         30-Sep-2022 11:03                2356
mailparse.requirements.php                         30-Sep-2022 11:03                1127
mailparse.resources.php                            30-Sep-2022 11:03                1484
mailparse.setup.php                                30-Sep-2022 11:03                1531
manual.php                                         30-Sep-2022 11:03                1227
math.configuration.php                             30-Sep-2022 11:03                1155
math.constants.php                                 30-Sep-2022 11:03                3396
math.installation.php                              30-Sep-2022 11:03                1134
math.requirements.php                              30-Sep-2022 11:03                1092
math.resources.php                                 30-Sep-2022 11:03                1112
math.setup.php                                     30-Sep-2022 11:03                1461
mbstring.configuration.php                         30-Sep-2022 11:03               13873
mbstring.constants.php                             30-Sep-2022 11:03                2476
mbstring.encodings.php                             30-Sep-2022 11:03               14724
mbstring.http.php                                  30-Sep-2022 11:03                4930
mbstring.installation.php                          30-Sep-2022 11:03                2430
mbstring.ja-basic.php                              30-Sep-2022 11:03                3460
mbstring.overload.php                              30-Sep-2022 11:03                6858
mbstring.php4.req.php                              30-Sep-2022 11:03                3675
mbstring.requirements.php                          30-Sep-2022 11:03                1120
mbstring.resources.php                             30-Sep-2022 11:03                1140
mbstring.setup.php                                 30-Sep-2022 11:03                1539
mbstring.supported-encodings.php                   30-Sep-2022 11:03                8099
mcrypt.ciphers.php                                 30-Sep-2022 11:03                6372
mcrypt.configuration.php                           30-Sep-2022 11:03                3215
mcrypt.constants.php                               30-Sep-2022 11:03                5681
mcrypt.installation.php                            30-Sep-2022 11:03                1595
mcrypt.requirements.php                            30-Sep-2022 11:03                2045
mcrypt.resources.php                               30-Sep-2022 11:03                1235
mcrypt.setup.php                                   30-Sep-2022 11:03                1498
memcache.add.php                                   30-Sep-2022 11:03                7006
memcache.addserver.php                             30-Sep-2022 11:03               12173
memcache.close.php                                 30-Sep-2022 11:03                4928
memcache.connect.php                               30-Sep-2022 11:03                6091
memcache.constants.php                             30-Sep-2022 11:03                2080
memcache.decrement.php                             30-Sep-2022 11:03                7034
memcache.delete.php                                30-Sep-2022 11:03                6734
memcache.examples-overview.php                     30-Sep-2022 11:03                6691
memcache.examples.php                              30-Sep-2022 11:03                1317
memcache.flush.php                                 30-Sep-2022 11:03                4315
memcache.get.php                                   30-Sep-2022 11:03                8622
memcache.getextendedstats.php                      30-Sep-2022 11:03                8007
memcache.getserverstatus.php                       30-Sep-2022 11:03                6035
memcache.getstats.php                              30-Sep-2022 11:03                4269
memcache.getversion.php                            30-Sep-2022 11:03                4688
memcache.increment.php                             30-Sep-2022 11:03                6855
memcache.ini.php                                   30-Sep-2022 11:03                9030
memcache.installation.php                          30-Sep-2022 11:03                1959
memcache.pconnect.php                              30-Sep-2022 11:03                6003
memcache.replace.php                               30-Sep-2022 11:03                7001
memcache.requirements.php                          30-Sep-2022 11:03                1349
memcache.resources.php                             30-Sep-2022 11:03                1209
memcache.set.php                                   30-Sep-2022 11:03                9289
memcache.setcompressthreshold.php                  30-Sep-2022 11:03                5633
memcache.setserverparams.php                       30-Sep-2022 11:03               10487
memcache.setup.php                                 30-Sep-2022 11:03                1520
memcached.add.php                                  30-Sep-2022 11:03                4333
memcached.addbykey.php                             30-Sep-2022 11:03                5432
memcached.addserver.php                            30-Sep-2022 11:03                6400
memcached.addservers.php                           30-Sep-2022 11:03                5073
memcached.append.php                               30-Sep-2022 11:03                6675
memcached.appendbykey.php                          30-Sep-2022 11:03                4446
memcached.callbacks.php                            30-Sep-2022 11:03                1434
memcached.callbacks.read-through.php               30-Sep-2022 11:03                4510
memcached.callbacks.result.php                     30-Sep-2022 11:03                4940
memcached.cas.php                                  30-Sep-2022 11:03                9530
memcached.casbykey.php                             30-Sep-2022 11:03                5274
memcached.configuration.php                        30-Sep-2022 11:03                9905
memcached.constants.php                            30-Sep-2022 11:03               18217
memcached.construct.php                            30-Sep-2022 11:03                4322
memcached.decrement.php                            30-Sep-2022 11:03                6434
memcached.decrementbykey.php                       30-Sep-2022 11:03                5513
memcached.delete.php                               30-Sep-2022 11:03                5518
memcached.deletebykey.php                          30-Sep-2022 11:03                4320
memcached.deletemulti.php                          30-Sep-2022 11:03                4816
memcached.deletemultibykey.php                     30-Sep-2022 11:03                4703
memcached.expiration.php                           30-Sep-2022 11:03                1835
memcached.fetch.php                                30-Sep-2022 11:03                6698
memcached.fetchall.php                             30-Sep-2022 11:03                6631
memcached.flush.php                                30-Sep-2022 11:03                4387
memcached.get.php                                  30-Sep-2022 11:03                9128
memcached.getallkeys.php                           30-Sep-2022 11:03                2661
memcached.getbykey.php                             30-Sep-2022 11:03                5180
memcached.getdelayed.php                           30-Sep-2022 11:03                8214
memcached.getdelayedbykey.php                      30-Sep-2022 11:03                5129
memcached.getmulti.php                             30-Sep-2022 11:03               20783
memcached.getmultibykey.php                        30-Sep-2022 11:03                5010
memcached.getoption.php                            30-Sep-2022 11:03                4984
memcached.getresultcode.php                        30-Sep-2022 11:03                4209
memcached.getresultmessage.php                     30-Sep-2022 11:03                4564
memcached.getserverbykey.php                       30-Sep-2022 11:03                7282
memcached.getserverlist.php                        30-Sep-2022 11:03                4512
memcached.getstats.php                             30-Sep-2022 11:03                4929
memcached.getversion.php                           30-Sep-2022 11:03                3854
memcached.increment.php                            30-Sep-2022 11:03                7619
memcached.incrementbykey.php                       30-Sep-2022 11:03                5446
memcached.installation.php                         30-Sep-2022 11:03                2215
memcached.ispersistent.php                         30-Sep-2022 11:03                2737
memcached.ispristine.php                           30-Sep-2022 11:03                2668
memcached.prepend.php                              30-Sep-2022 11:03                6689
memcached.prependbykey.php                         30-Sep-2022 11:03                4471
memcached.quit.php                                 30-Sep-2022 11:03                2223
memcached.replace.php                              30-Sep-2022 11:03                4370
memcached.replacebykey.php                         30-Sep-2022 11:03                5243
memcached.requirements.php                         30-Sep-2022 11:03                1445
memcached.resetserverlist.php                      30-Sep-2022 11:03                2978
memcached.resources.php                            30-Sep-2022 11:03                1147
memcached.sessions.php                             30-Sep-2022 11:03                2464
memcached.set.php                                  30-Sep-2022 11:03                8817
memcached.setbykey.php                             30-Sep-2022 11:03                6706
memcached.setmulti.php                             30-Sep-2022 11:03                6113
memcached.setmultibykey.php                        30-Sep-2022 11:03                4527
memcached.setoption.php                            30-Sep-2022 11:03                6369
memcached.setoptions.php                           30-Sep-2022 11:03                6792
memcached.setsaslauthdata.php                      30-Sep-2022 11:03                3144
memcached.setup.php                                30-Sep-2022 11:03                1533
memcached.touch.php                                30-Sep-2022 11:03                3394
memcached.touchbykey.php                           30-Sep-2022 11:03                4180
messageformatter.create.php                        30-Sep-2022 11:03               10748
messageformatter.format.php                        30-Sep-2022 11:03                9688
messageformatter.formatmessage.php                 30-Sep-2022 11:03                9840
messageformatter.geterrorcode.php                  30-Sep-2022 11:03                3852
messageformatter.geterrormessage.php               30-Sep-2022 11:03                7733
messageformatter.getlocale.php                     30-Sep-2022 11:03                5355
messageformatter.getpattern.php                    30-Sep-2022 11:03               10294
messageformatter.parse.php                         30-Sep-2022 11:03                9695
messageformatter.parsemessage.php                  30-Sep-2022 11:03               10284
messageformatter.setpattern.php                    30-Sep-2022 11:03               10715
mhash.configuration.php                            30-Sep-2022 11:03                1162
mhash.constants.php                                30-Sep-2022 11:03                4787
mhash.examples.php                                 30-Sep-2022 11:03                3396
mhash.installation.php                             30-Sep-2022 11:03                1534
mhash.requirements.php                             30-Sep-2022 11:03                1260
mhash.resources.php                                30-Sep-2022 11:03                1119
mhash.setup.php                                    30-Sep-2022 11:03                1479
migration56.changed-functions.php                  30-Sep-2022 11:04                6455
migration56.constants.php                          30-Sep-2022 11:04                5188
migration56.deprecated.php                         30-Sep-2022 11:04                6046
migration56.extensions.php                         30-Sep-2022 11:04                4273
migration56.incompatible.php                       30-Sep-2022 11:04                8509
migration56.new-features.php                       30-Sep-2022 11:04               30536
migration56.new-functions.php                      30-Sep-2022 11:04                7492
migration56.openssl.php                            30-Sep-2022 11:04               26195
migration56.php                                    30-Sep-2022 11:04                2331
migration70.changed-functions.php                  30-Sep-2022 11:04                4967
migration70.classes.php                            30-Sep-2022 11:04                3812
migration70.constants.php                          30-Sep-2022 11:04                7031
migration70.deprecated.php                         30-Sep-2022 11:04                5646
migration70.incompatible.php                       30-Sep-2022 11:04               61129
migration70.new-features.php                       30-Sep-2022 11:04               42807
migration70.new-functions.php                      30-Sep-2022 11:04                7346
migration70.other-changes.php                      30-Sep-2022 11:04                3268
migration70.php                                    30-Sep-2022 11:04                2697
migration70.removed-exts-sapis.php                 30-Sep-2022 11:04                3110
migration70.sapi-changes.php                       30-Sep-2022 11:04                1934
migration71.changed-functions.php                  30-Sep-2022 11:04                7308
migration71.constants.php                          30-Sep-2022 11:04                7186
migration71.deprecated.php                         30-Sep-2022 11:04                2163
migration71.incompatible.php                       30-Sep-2022 11:04               29830
migration71.new-features.php                       30-Sep-2022 11:04               27889
migration71.new-functions.php                      30-Sep-2022 11:04                5024
migration71.other-changes.php                      30-Sep-2022 11:04                7989
migration71.php                                    30-Sep-2022 11:04                2390
migration71.windows-support.php                    30-Sep-2022 11:04                7114
migration72.constants.php                          30-Sep-2022 11:04               24629
migration72.deprecated.php                         30-Sep-2022 11:04                9536
migration72.incompatible.php                       30-Sep-2022 11:04               19327
migration72.new-features.php                       30-Sep-2022 11:04               17881
migration72.new-functions.php                      30-Sep-2022 11:04               24356
migration72.other-changes.php                      30-Sep-2022 11:04                5490
migration72.php                                    30-Sep-2022 11:04                2280
migration73.constants.php                          30-Sep-2022 11:04               17683
migration73.deprecated.php                         30-Sep-2022 11:04                8379
migration73.incompatible.php                       30-Sep-2022 11:04               18423
migration73.new-features.php                       30-Sep-2022 11:04               15970
migration73.new-functions.php                      30-Sep-2022 11:04                7327
migration73.other-changes.php                      30-Sep-2022 11:04               15354
migration73.php                                    30-Sep-2022 11:04                2421
migration73.windows-support.php                    30-Sep-2022 11:04                1800
migration74.constants.php                          30-Sep-2022 11:04                5844
migration74.deprecated.php                         30-Sep-2022 11:04               15122
migration74.incompatible.php                       30-Sep-2022 11:04               16806
migration74.new-classes.php                        30-Sep-2022 11:04                1454
migration74.new-features.php                       30-Sep-2022 11:04               21787
migration74.new-functions.php                      30-Sep-2022 11:04                3697
migration74.other-changes.php                      30-Sep-2022 11:04               20869
migration74.php                                    30-Sep-2022 11:04                2626
migration74.removed-extensions.php                 30-Sep-2022 11:04                1856
migration74.windows-support.php                    30-Sep-2022 11:04                3714
migration80.deprecated.php                         30-Sep-2022 11:04               18749
migration80.incompatible.php                       30-Sep-2022 11:04               96759
migration80.new-features.php                       30-Sep-2022 11:04               32621
migration80.other-changes.php                      30-Sep-2022 11:04               14643
migration80.php                                    30-Sep-2022 11:04                2268
migration81.constants.php                          30-Sep-2022 11:04                6094
migration81.deprecated.php                         30-Sep-2022 11:04               17459
migration81.incompatible.php                       30-Sep-2022 11:04               21957
migration81.new-classes.php                        30-Sep-2022 11:04                2067
migration81.new-features.php                       30-Sep-2022 11:04               22688
migration81.new-functions.php                      30-Sep-2022 11:04                8447
migration81.other-changes.php                      30-Sep-2022 11:04                9417
migration81.php                                    30-Sep-2022 11:04                2492
migration82.constants.php                          30-Sep-2022 11:04               16066
migration82.deprecated.php                         30-Sep-2022 11:04                5800
migration82.incompatible.php                       30-Sep-2022 11:04                7807
migration82.new-features.php                       30-Sep-2022 11:04                6384
migration82.new-functions.php                      30-Sep-2022 11:04                3381
migration82.other-changes.php                      30-Sep-2022 11:04               24807
migration82.php                                    30-Sep-2022 11:04                2490
migration82.windows-support.php                    30-Sep-2022 11:04                2282
misc.configuration.php                             30-Sep-2022 11:03                5330
misc.constants.php                                 30-Sep-2022 11:03                2040
misc.installation.php                              30-Sep-2022 11:03                1134
misc.requirements.php                              30-Sep-2022 11:03                1092
misc.resources.php                                 30-Sep-2022 11:03                1112
misc.setup.php                                     30-Sep-2022 11:03                1453
mongodb-bson-binary.construct.php                  30-Sep-2022 11:03                7033
mongodb-bson-binary.getdata.php                    30-Sep-2022 11:03                4598
mongodb-bson-binary.gettype.php                    30-Sep-2022 11:03                4582
mongodb-bson-binary.jsonserialize.php              30-Sep-2022 11:03                5441
mongodb-bson-binary.serialize.php                  30-Sep-2022 11:03                3413
mongodb-bson-binary.tostring.php                   30-Sep-2022 11:03                4383
mongodb-bson-binary.unserialize.php                30-Sep-2022 11:03                4271
mongodb-bson-binaryinterface.getdata.php           30-Sep-2022 11:03                2737
mongodb-bson-binaryinterface.gettype.php           30-Sep-2022 11:03                2749
mongodb-bson-binaryinterface.tostring.php          30-Sep-2022 11:03                3220
mongodb-bson-dbpointer.construct.php               30-Sep-2022 11:03                2628
mongodb-bson-dbpointer.jsonserialize.php           30-Sep-2022 11:03                5510
mongodb-bson-dbpointer.serialize.php               30-Sep-2022 11:03                3488
mongodb-bson-dbpointer.tostring.php                30-Sep-2022 11:03                2579
mongodb-bson-dbpointer.unserialize.php             30-Sep-2022 11:03                3740
mongodb-bson-decimal128.construct.php              30-Sep-2022 11:03                6091
mongodb-bson-decimal128.jsonserialize.php          30-Sep-2022 11:03                5531
mongodb-bson-decimal128.serialize.php              30-Sep-2022 11:03                3513
mongodb-bson-decimal128.tostring.php               30-Sep-2022 11:03                4880
mongodb-bson-decimal128.unserialize.php            30-Sep-2022 11:03                4363
mongodb-bson-decimal128interface.tostring.php      30-Sep-2022 11:03                2900
mongodb-bson-int64.construct.php                   30-Sep-2022 11:03                2576
mongodb-bson-int64.jsonserialize.php               30-Sep-2022 11:03                5185
mongodb-bson-int64.serialize.php                   30-Sep-2022 11:03                3390
mongodb-bson-int64.tostring.php                    30-Sep-2022 11:03                3784
mongodb-bson-int64.unserialize.php                 30-Sep-2022 11:03                4242
mongodb-bson-javascript.construct.php              30-Sep-2022 11:03                7133
mongodb-bson-javascript.getcode.php                30-Sep-2022 11:03                4446
mongodb-bson-javascript.getscope.php               30-Sep-2022 11:03                5514
mongodb-bson-javascript.jsonserialize.php          30-Sep-2022 11:03                5527
mongodb-bson-javascript.serialize.php              30-Sep-2022 11:03                3513
mongodb-bson-javascript.tostring.php               30-Sep-2022 11:03                4253
mongodb-bson-javascript.unserialize.php            30-Sep-2022 11:03                4355
mongodb-bson-javascriptinterface.getcode.php       30-Sep-2022 11:03                2831
mongodb-bson-javascriptinterface.getscope.php      30-Sep-2022 11:03                2940
mongodb-bson-javascriptinterface.tostring.php      30-Sep-2022 11:03                3318
mongodb-bson-maxkey.construct.php                  30-Sep-2022 11:03                3732
mongodb-bson-maxkey.jsonserialize.php              30-Sep-2022 11:03                5447
mongodb-bson-maxkey.serialize.php                  30-Sep-2022 11:03                3417
mongodb-bson-maxkey.unserialize.php                30-Sep-2022 11:03                3673
mongodb-bson-minkey.construct.php                  30-Sep-2022 11:03                3732
mongodb-bson-minkey.jsonserialize.php              30-Sep-2022 11:03                5447
mongodb-bson-minkey.serialize.php                  30-Sep-2022 11:03                3417
mongodb-bson-minkey.unserialize.php                30-Sep-2022 11:03                3677
mongodb-bson-objectid.construct.php                30-Sep-2022 11:03                5349
mongodb-bson-objectid.gettimestamp.php             30-Sep-2022 11:03                5674
mongodb-bson-objectid.jsonserialize.php            30-Sep-2022 11:03                5493
mongodb-bson-objectid.serialize.php                30-Sep-2022 11:03                3465
mongodb-bson-objectid.tostring.php                 30-Sep-2022 11:03                4372
mongodb-bson-objectid.unserialize.php              30-Sep-2022 11:03                4309
mongodb-bson-objectidinterface.gettimestamp.php    30-Sep-2022 11:03                2902
mongodb-bson-objectidinterface.tostring.php        30-Sep-2022 11:03                2884
mongodb-bson-regex.construct.php                   30-Sep-2022 11:03                6925
mongodb-bson-regex.getflags.php                    30-Sep-2022 11:03                4551
mongodb-bson-regex.getpattern.php                  30-Sep-2022 11:03                4398
mongodb-bson-regex.jsonserialize.php               30-Sep-2022 11:03                5426
mongodb-bson-regex.serialize.php                   30-Sep-2022 11:03                3388
mongodb-bson-regex.tostring.php                    30-Sep-2022 11:03                3926
mongodb-bson-regex.unserialize.php                 30-Sep-2022 11:03                4246
mongodb-bson-regexinterface.getflags.php           30-Sep-2022 11:03                2736
mongodb-bson-regexinterface.getpattern.php         30-Sep-2022 11:03                2779
mongodb-bson-regexinterface.tostring.php           30-Sep-2022 11:03                2810
mongodb-bson-serializable.bsonserialize.php        30-Sep-2022 11:03               16118
mongodb-bson-symbol.construct.php                  30-Sep-2022 11:03                2568
mongodb-bson-symbol.jsonserialize.php              30-Sep-2022 11:03                5447
mongodb-bson-symbol.serialize.php                  30-Sep-2022 11:03                3413
mongodb-bson-symbol.tostring.php                   30-Sep-2022 11:03                2557
mongodb-bson-symbol.unserialize.php                30-Sep-2022 11:03                3679
mongodb-bson-timestamp.construct.php               30-Sep-2022 11:03                4716
mongodb-bson-timestamp.getincrement.php            30-Sep-2022 11:03                4217
mongodb-bson-timestamp.gettimestamp.php            30-Sep-2022 11:03                4202
mongodb-bson-timestamp.jsonserialize.php           30-Sep-2022 11:03                5514
mongodb-bson-timestamp.serialize.php               30-Sep-2022 11:03                3488
mongodb-bson-timestamp.tostring.php                30-Sep-2022 11:03                4060
mongodb-bson-timestamp.unserialize.php             30-Sep-2022 11:03                4342
mongodb-bson-timestampinterface.getincrement.php   30-Sep-2022 11:03                3265
mongodb-bson-timestampinterface.gettimestamp.php   30-Sep-2022 11:03                3280
mongodb-bson-timestampinterface.tostring.php       30-Sep-2022 11:03                2902
mongodb-bson-undefined.construct.php               30-Sep-2022 11:03                2628
mongodb-bson-undefined.jsonserialize.php           30-Sep-2022 11:03                5510
mongodb-bson-undefined.serialize.php               30-Sep-2022 11:03                3488
mongodb-bson-undefined.tostring.php                30-Sep-2022 11:03                2579
mongodb-bson-undefined.unserialize.php             30-Sep-2022 11:03                3741
mongodb-bson-unserializable.bsonunserialize.php    30-Sep-2022 11:03                7516
mongodb-bson-utcdatetime.construct.php             30-Sep-2022 11:03                8071
mongodb-bson-utcdatetime.jsonserialize.php         30-Sep-2022 11:03                5552
mongodb-bson-utcdatetime.serialize.php             30-Sep-2022 11:03                3540
mongodb-bson-utcdatetime.todatetime.php            30-Sep-2022 11:03                5932
mongodb-bson-utcdatetime.tostring.php              30-Sep-2022 11:03                4019
mongodb-bson-utcdatetime.unserialize.php           30-Sep-2022 11:03                4374
mongodb-bson-utcdatetimeinterface.todatetime.php   30-Sep-2022 11:03                3239
mongodb-bson-utcdatetimeinterface.tostring.php     30-Sep-2022 11:03                2918
mongodb-driver-bulkwrite.construct.php             30-Sep-2022 11:03               20237
mongodb-driver-bulkwrite.count.php                 30-Sep-2022 11:03                7050
mongodb-driver-bulkwrite.delete.php                30-Sep-2022 11:03               11505
mongodb-driver-bulkwrite.insert.php                30-Sep-2022 11:03               10015
mongodb-driver-bulkwrite.update.php                30-Sep-2022 11:03               14772
mongodb-driver-command.construct.php               30-Sep-2022 11:03               15338
mongodb-driver-cursor.construct.php                30-Sep-2022 11:03                3347
mongodb-driver-cursor.current.php                  30-Sep-2022 11:03                2825
mongodb-driver-cursor.getid.php                    30-Sep-2022 11:03                8286
mongodb-driver-cursor.getserver.php                30-Sep-2022 11:03                7934
mongodb-driver-cursor.isdead.php                   30-Sep-2022 11:03               11063
mongodb-driver-cursor.key.php                      30-Sep-2022 11:03                2542
mongodb-driver-cursor.next.php                     30-Sep-2022 11:03                3482
mongodb-driver-cursor.rewind.php                   30-Sep-2022 11:03                3896
mongodb-driver-cursor.settypemap.php               30-Sep-2022 11:03                8359
mongodb-driver-cursor.toarray.php                  30-Sep-2022 11:03                8031
mongodb-driver-cursor.valid.php                    30-Sep-2022 11:03                2634
mongodb-driver-cursorid.construct.php              30-Sep-2022 11:03                2790
mongodb-driver-cursorid.serialize.php              30-Sep-2022 11:03                3511
mongodb-driver-cursorid.tostring.php               30-Sep-2022 11:03                7467
mongodb-driver-cursorid.unserialize.php            30-Sep-2022 11:03                4363
mongodb-driver-manager.addsubscriber.php           30-Sep-2022 11:03                5089
mongodb-driver-manager.construct.php               30-Sep-2022 11:03               73100
mongodb-driver-manager.createclientencryption.php  30-Sep-2022 11:03                9978
mongodb-driver-manager.executebulkwrite.php        30-Sep-2022 11:03               23945
mongodb-driver-manager.executecommand.php          30-Sep-2022 11:03               26268
mongodb-driver-manager.executequery.php            30-Sep-2022 11:03               17126
mongodb-driver-manager.executereadcommand.php      30-Sep-2022 11:03               10025
mongodb-driver-manager.executereadwritecommand.php 30-Sep-2022 11:03               11006
mongodb-driver-manager.executewritecommand.php     30-Sep-2022 11:03               11083
mongodb-driver-manager.getencryptedfieldsmap.php   30-Sep-2022 11:03                3658
mongodb-driver-manager.getreadconcern.php          30-Sep-2022 11:03                6164
mongodb-driver-manager.getreadpreference.php       30-Sep-2022 11:03                6759
mongodb-driver-manager.getservers.php              30-Sep-2022 11:03                8075
mongodb-driver-manager.getwriteconcern.php         30-Sep-2022 11:03                6217
mongodb-driver-manager.removesubscriber.php        30-Sep-2022 11:03                4949
mongodb-driver-manager.selectserver.php            30-Sep-2022 11:03                7027
mongodb-driver-manager.startsession.php            30-Sep-2022 11:03               11696
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                3627
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                3722
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                3611
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                4781
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                3921
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                4193
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                4179
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                3831
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:03                3673
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:03                3928
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:03                3659
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:03                3561
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:03                5105
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:03                4669
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:03                4485
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:03                3851
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:03                3693
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:03                4914
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:03                4964
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:03                4979
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:03                3684
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:03                3791
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:03                4868
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:03                3978
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:03                4256
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:03                4714
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:03                3891
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:03                3719
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:03                4782
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:03                4752
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:03                5319
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:03                5364
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:03                5395
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:03                4782
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:03                4857
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:03                4794
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:03                4777
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:03                3085
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:03                3377
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:03                3155
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:03                3454
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:03                3261
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:03                3047
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:03                3099
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:03                3217
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:03                3535
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:03                3445
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:03                3222
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:03                3253
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:03                3504
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:03                3227
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:03                3271
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:03                3524
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:03                3587
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:03                3294
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:03                3305
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:03                4115
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:03                3540
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:03                3065
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:03                3117
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:03                3249
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:03                3442
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:03                3520
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:03                3269
mongodb-driver-monitoring-topologyclosedevent.g..> 30-Sep-2022 11:03                3214
mongodb-driver-monitoring-topologyopeningevent...> 30-Sep-2022 11:03                3224
mongodb-driver-query.construct.php                 30-Sep-2022 11:03               31447
mongodb-driver-readconcern.bsonserialize.php       30-Sep-2022 11:03                7682
mongodb-driver-readconcern.construct.php           30-Sep-2022 11:03                6499
mongodb-driver-readconcern.getlevel.php            30-Sep-2022 11:03                6376
mongodb-driver-readconcern.isdefault.php           30-Sep-2022 11:03                8654
mongodb-driver-readconcern.serialize.php           30-Sep-2022 11:03                3588
mongodb-driver-readconcern.unserialize.php         30-Sep-2022 11:03                4432
mongodb-driver-readpreference.bsonserialize.php    30-Sep-2022 11:03               12308
mongodb-driver-readpreference.construct.php        30-Sep-2022 11:03               18233
mongodb-driver-readpreference.gethedge.php         30-Sep-2022 11:03                3279
mongodb-driver-readpreference.getmaxstalenessse..> 30-Sep-2022 11:03                9550
mongodb-driver-readpreference.getmode.php          30-Sep-2022 11:03                8895
mongodb-driver-readpreference.getmodestring.php    30-Sep-2022 11:03                9099
mongodb-driver-readpreference.gettagsets.php       30-Sep-2022 11:03                9096
mongodb-driver-readpreference.serialize.php        30-Sep-2022 11:03                3665
mongodb-driver-readpreference.unserialize.php      30-Sep-2022 11:03                4511
mongodb-driver-runtimeexception.haserrorlabel.php  30-Sep-2022 11:03                4059
mongodb-driver-server.construct.php                30-Sep-2022 11:03                3349
mongodb-driver-server.executebulkwrite.php         30-Sep-2022 11:03               10947
mongodb-driver-server.executecommand.php           30-Sep-2022 11:03               12926
mongodb-driver-server.executequery.php             30-Sep-2022 11:03                8243
mongodb-driver-server.executereadcommand.php       30-Sep-2022 11:03               10349
mongodb-driver-server.executereadwritecommand.php  30-Sep-2022 11:03               11520
mongodb-driver-server.executewritecommand.php      30-Sep-2022 11:03               11563
mongodb-driver-server.gethost.php                  30-Sep-2022 11:03                5701
mongodb-driver-server.getinfo.php                  30-Sep-2022 11:03               10681
mongodb-driver-server.getlatency.php               30-Sep-2022 11:03                7183
mongodb-driver-server.getport.php                  30-Sep-2022 11:03                5730
mongodb-driver-server.getserverdescription.php     30-Sep-2022 11:03                3261
mongodb-driver-server.gettags.php                  30-Sep-2022 11:03                3522
mongodb-driver-server.gettype.php                  30-Sep-2022 11:03                3503
mongodb-driver-server.isarbiter.php                30-Sep-2022 11:03                3447
mongodb-driver-server.ishidden.php                 30-Sep-2022 11:03                3441
mongodb-driver-server.ispassive.php                30-Sep-2022 11:03                3509
mongodb-driver-server.isprimary.php                30-Sep-2022 11:03                3454
mongodb-driver-server.issecondary.php              30-Sep-2022 11:03                3489
mongodb-driver-writeconcern.bsonserialize.php      30-Sep-2022 11:03                8137
mongodb-driver-writeconcern.construct.php          30-Sep-2022 11:03               10627
mongodb-driver-writeconcern.getjournal.php         30-Sep-2022 11:03                6295
mongodb-driver-writeconcern.getw.php               30-Sep-2022 11:03                5491
mongodb-driver-writeconcern.getwtimeout.php        30-Sep-2022 11:03                6230
mongodb-driver-writeconcern.isdefault.php          30-Sep-2022 11:03                8153
mongodb-driver-writeconcern.serialize.php          30-Sep-2022 11:03                3613
mongodb-driver-writeconcern.unserialize.php        30-Sep-2022 11:03                4471
mongodb-driver-writeconcernerror.getcode.php       30-Sep-2022 11:03                6961
mongodb-driver-writeconcernerror.getinfo.php       30-Sep-2022 11:03                7178
mongodb-driver-writeconcernerror.getmessage.php    30-Sep-2022 11:03                7050
mongodb-driver-writeerror.getcode.php              30-Sep-2022 11:03                6136
mongodb-driver-writeerror.getindex.php             30-Sep-2022 11:03                6673
mongodb-driver-writeerror.getinfo.php              30-Sep-2022 11:03                2925
mongodb-driver-writeerror.getmessage.php           30-Sep-2022 11:03                6270
mongodb-driver-writeexception.getwriteresult.php   30-Sep-2022 11:03                8664
mongodb-driver-writeresult.getdeletedcount.php     30-Sep-2022 11:03                8405
mongodb-driver-writeresult.getinsertedcount.php    30-Sep-2022 11:03                8487
mongodb-driver-writeresult.getmatchedcount.php     30-Sep-2022 11:03                9065
mongodb-driver-writeresult.getmodifiedcount.php    30-Sep-2022 11:03                9312
mongodb-driver-writeresult.getserver.php           30-Sep-2022 11:03                7113
mongodb-driver-writeresult.getupsertedcount.php    30-Sep-2022 11:03                8642
mongodb-driver-writeresult.getupsertedids.php      30-Sep-2022 11:03                9174
mongodb-driver-writeresult.getwriteconcernerror..> 30-Sep-2022 11:03                7805
mongodb-driver-writeresult.getwriteerrors.php      30-Sep-2022 11:03               14404
mongodb-driver-writeresult.isacknowledged.php      30-Sep-2022 11:03                8763
mongodb.architecture.php                           30-Sep-2022 11:03                1922
mongodb.configuration.php                          30-Sep-2022 11:03                3774
mongodb.connection-handling.php                    30-Sep-2022 11:03                9472
mongodb.constants.php                              30-Sep-2022 11:03                1752
mongodb.exceptions.php                             30-Sep-2022 11:03                4241
mongodb.installation.homebrew.php                  30-Sep-2022 11:03                1969
mongodb.installation.manual.php                    30-Sep-2022 11:03                6504
mongodb.installation.pecl.php                      30-Sep-2022 11:03                3559
mongodb.installation.php                           30-Sep-2022 11:03                1730
mongodb.installation.windows.php                   30-Sep-2022 11:03                2781
mongodb.monitoring.php                             30-Sep-2022 11:03               18561
mongodb.overview.php                               30-Sep-2022 11:03                7234
mongodb.persistence.deserialization.php            30-Sep-2022 11:03               20739
mongodb.persistence.php                            30-Sep-2022 11:03                1797
mongodb.persistence.serialization.php              30-Sep-2022 11:03               23894
mongodb.requirements.php                           30-Sep-2022 11:03                3071
mongodb.security.php                               30-Sep-2022 11:03                1484
mongodb.security.request_injection.php             30-Sep-2022 11:03                3004
mongodb.security.script_injection.php              30-Sep-2022 11:03               10544
mongodb.setup.php                                  30-Sep-2022 11:03                1961
mongodb.tutorial.apm.php                           30-Sep-2022 11:03               24275
mongodb.tutorial.library.php                       30-Sep-2022 11:03               11315
mongodb.tutorial.php                               30-Sep-2022 11:03                1689
mqseries.configure.php                             30-Sep-2022 11:03                2688
mqseries.constants.php                             30-Sep-2022 11:03                2097
mqseries.ini.php                                   30-Sep-2022 11:03                1229
mqseries.requirements.php                          30-Sep-2022 11:03                1546
mqseries.resources.php                             30-Sep-2022 11:03                1604
mqseries.setup.php                                 30-Sep-2022 11:03                1516
multipleiterator.attachiterator.php                30-Sep-2022 11:03                4111
multipleiterator.construct.php                     30-Sep-2022 11:03                8132
multipleiterator.containsiterator.php              30-Sep-2022 11:03                3262
multipleiterator.countiterators.php                30-Sep-2022 11:03                2925
multipleiterator.current.php                       30-Sep-2022 11:03                4189
multipleiterator.detachiterator.php                30-Sep-2022 11:03                3133
multipleiterator.getflags.php                      30-Sep-2022 11:03                3093
multipleiterator.key.php                           30-Sep-2022 11:03                4055
multipleiterator.next.php                          30-Sep-2022 11:03                2741
multipleiterator.rewind.php                        30-Sep-2022 11:03                2759
multipleiterator.setflags.php                      30-Sep-2022 11:03                3406
multipleiterator.valid.php                         30-Sep-2022 11:03                2837
mysql-xdevapi-baseresult.getwarnings.php           30-Sep-2022 11:03                6997
mysql-xdevapi-baseresult.getwarningscount.php      30-Sep-2022 11:03                6729
mysql-xdevapi-client.close.php                     30-Sep-2022 11:03                2290
mysql-xdevapi-client.construct.php                 30-Sep-2022 11:03                3577
mysql-xdevapi-client.getsession.php                30-Sep-2022 11:03                2356
mysql-xdevapi-collection.add.php                   30-Sep-2022 11:03                9890
mysql-xdevapi-collection.addorreplaceone.php       30-Sep-2022 11:03                8544
mysql-xdevapi-collection.construct.php             30-Sep-2022 11:03                6745
mysql-xdevapi-collection.count.php                 30-Sep-2022 11:03                6854
mysql-xdevapi-collection.createindex.php           30-Sep-2022 11:03               10031
mysql-xdevapi-collection.dropindex.php             30-Sep-2022 11:03                6892
mysql-xdevapi-collection.existsindatabase.php      30-Sep-2022 11:03                6134
mysql-xdevapi-collection.find.php                  30-Sep-2022 11:03               10165
mysql-xdevapi-collection.getname.php               30-Sep-2022 11:03                5178
mysql-xdevapi-collection.getone.php                30-Sep-2022 11:03                7427
mysql-xdevapi-collection.getschema.php             30-Sep-2022 11:03                5385
mysql-xdevapi-collection.getsession.php            30-Sep-2022 11:03                5660
mysql-xdevapi-collection.modify.php                30-Sep-2022 11:03                8513
mysql-xdevapi-collection.remove.php                30-Sep-2022 11:03                8843
mysql-xdevapi-collection.removeone.php             30-Sep-2022 11:03                8073
mysql-xdevapi-collection.replaceone.php            30-Sep-2022 11:03                8359
mysql-xdevapi-collectionadd.construct.php          30-Sep-2022 11:03                8351
mysql-xdevapi-collectionadd.execute.php            30-Sep-2022 11:03                8326
mysql-xdevapi-collectionfind.bind.php              30-Sep-2022 11:03                8231
mysql-xdevapi-collectionfind.construct.php         30-Sep-2022 11:03                7165
mysql-xdevapi-collectionfind.execute.php           30-Sep-2022 11:03                7395
mysql-xdevapi-collectionfind.fields.php            30-Sep-2022 11:03                7833
mysql-xdevapi-collectionfind.groupby.php           30-Sep-2022 11:03                4322
mysql-xdevapi-collectionfind.having.php            30-Sep-2022 11:03                4566
mysql-xdevapi-collectionfind.limit.php             30-Sep-2022 11:03                8498
mysql-xdevapi-collectionfind.lockexclusive.php     30-Sep-2022 11:03                6686
mysql-xdevapi-collectionfind.lockshared.php        30-Sep-2022 11:03                6489
mysql-xdevapi-collectionfind.offset.php            30-Sep-2022 11:03                8245
mysql-xdevapi-collectionfind.sort.php              30-Sep-2022 11:03                8355
mysql-xdevapi-collectionmodify.arrayappend.php     30-Sep-2022 11:03                8314
mysql-xdevapi-collectionmodify.arrayinsert.php     30-Sep-2022 11:03                8733
mysql-xdevapi-collectionmodify.bind.php            30-Sep-2022 11:03                8458
mysql-xdevapi-collectionmodify.construct.php       30-Sep-2022 11:03                7091
mysql-xdevapi-collectionmodify.execute.php         30-Sep-2022 11:03                3243
mysql-xdevapi-collectionmodify.limit.php           30-Sep-2022 11:03                8909
mysql-xdevapi-collectionmodify.patch.php           30-Sep-2022 11:03                4124
mysql-xdevapi-collectionmodify.replace.php         30-Sep-2022 11:03                8131
mysql-xdevapi-collectionmodify.set.php             30-Sep-2022 11:03                8073
mysql-xdevapi-collectionmodify.skip.php            30-Sep-2022 11:03                4793
mysql-xdevapi-collectionmodify.sort.php            30-Sep-2022 11:03                4836
mysql-xdevapi-collectionmodify.unset.php           30-Sep-2022 11:03                4424
mysql-xdevapi-collectionremove.bind.php            30-Sep-2022 11:03                5085
mysql-xdevapi-collectionremove.construct.php       30-Sep-2022 11:03                7620
mysql-xdevapi-collectionremove.execute.php         30-Sep-2022 11:03                3974
mysql-xdevapi-collectionremove.limit.php           30-Sep-2022 11:03                4425
mysql-xdevapi-collectionremove.sort.php            30-Sep-2022 11:03                4503
mysql-xdevapi-columnresult.construct.php           30-Sep-2022 11:03                9963
mysql-xdevapi-columnresult.getcharactersetname.php 30-Sep-2022 11:03                3174
mysql-xdevapi-columnresult.getcollationname.php    30-Sep-2022 11:03                3153
mysql-xdevapi-columnresult.getcolumnlabel.php      30-Sep-2022 11:03                3119
mysql-xdevapi-columnresult.getcolumnname.php       30-Sep-2022 11:03                3114
mysql-xdevapi-columnresult.getfractionaldigits.php 30-Sep-2022 11:03                3225
mysql-xdevapi-columnresult.getlength.php           30-Sep-2022 11:03                3069
mysql-xdevapi-columnresult.getschemaname.php       30-Sep-2022 11:03                3143
mysql-xdevapi-columnresult.gettablelabel.php       30-Sep-2022 11:03                3098
mysql-xdevapi-columnresult.gettablename.php        30-Sep-2022 11:03                3108
mysql-xdevapi-columnresult.gettype.php             30-Sep-2022 11:03                3025
mysql-xdevapi-columnresult.isnumbersigned.php      30-Sep-2022 11:03                3271
mysql-xdevapi-columnresult.ispadded.php            30-Sep-2022 11:03                3112
mysql-xdevapi-crudoperationbindable.bind.php       30-Sep-2022 11:03                5735
mysql-xdevapi-crudoperationlimitable.limit.php     30-Sep-2022 11:03                5826
mysql-xdevapi-crudoperationskippable.skip.php      30-Sep-2022 11:03                4497
mysql-xdevapi-crudoperationsortable.sort.php       30-Sep-2022 11:03                4533
mysql-xdevapi-databaseobject.existsindatabase.php  30-Sep-2022 11:03                3460
mysql-xdevapi-databaseobject.getname.php           30-Sep-2022 11:03                3345
mysql-xdevapi-databaseobject.getsession.php        30-Sep-2022 11:03                3448
mysql-xdevapi-docresult.construct.php              30-Sep-2022 11:03                7756
mysql-xdevapi-docresult.fetchall.php               30-Sep-2022 11:03                8201
mysql-xdevapi-docresult.fetchone.php               30-Sep-2022 11:03                7843
mysql-xdevapi-docresult.getwarnings.php            30-Sep-2022 11:03                8864
mysql-xdevapi-docresult.getwarningscount.php       30-Sep-2022 11:03                8676
mysql-xdevapi-executable.execute.php               30-Sep-2022 11:03                6703
mysql-xdevapi-executionstatus.construct.php        30-Sep-2022 11:03                2902
mysql-xdevapi-expression.construct.php             30-Sep-2022 11:03                3010
mysql-xdevapi-result.construct.php                 30-Sep-2022 11:03                7307
mysql-xdevapi-result.getaffecteditemscount.php     30-Sep-2022 11:03                6100
mysql-xdevapi-result.getautoincrementvalue.php     30-Sep-2022 11:03                7639
mysql-xdevapi-result.getgeneratedids.php           30-Sep-2022 11:03                6916
mysql-xdevapi-result.getwarnings.php               30-Sep-2022 11:03                6879
mysql-xdevapi-result.getwarningscount.php          30-Sep-2022 11:03                6575
mysql-xdevapi-rowresult.construct.php              30-Sep-2022 11:03                4959
mysql-xdevapi-rowresult.fetchall.php               30-Sep-2022 11:03                6649
mysql-xdevapi-rowresult.fetchone.php               30-Sep-2022 11:03                6782
mysql-xdevapi-rowresult.getcolumncount.php         30-Sep-2022 11:03                6123
mysql-xdevapi-rowresult.getcolumnnames.php         30-Sep-2022 11:03                6109
mysql-xdevapi-rowresult.getcolumns.php             30-Sep-2022 11:03                7070
mysql-xdevapi-rowresult.getwarnings.php            30-Sep-2022 11:03                6926
mysql-xdevapi-rowresult.getwarningscount.php       30-Sep-2022 11:03                6621
mysql-xdevapi-schema.construct.php                 30-Sep-2022 11:03                5484
mysql-xdevapi-schema.createcollection.php          30-Sep-2022 11:03               10274
mysql-xdevapi-schema.dropcollection.php            30-Sep-2022 11:03                6576
mysql-xdevapi-schema.existsindatabase.php          30-Sep-2022 11:03                6421
mysql-xdevapi-schema.getcollection.php             30-Sep-2022 11:03                5644
mysql-xdevapi-schema.getcollectionastable.php      30-Sep-2022 11:03                7276
mysql-xdevapi-schema.getcollections.php            30-Sep-2022 11:03                6363
mysql-xdevapi-schema.getname.php                   30-Sep-2022 11:03                4765
mysql-xdevapi-schema.getsession.php                30-Sep-2022 11:03                5263
mysql-xdevapi-schema.gettable.php                  30-Sep-2022 11:03                6843
mysql-xdevapi-schema.gettables.php                 30-Sep-2022 11:03                7011
mysql-xdevapi-schemaobject.getschema.php           30-Sep-2022 11:03                4032
mysql-xdevapi-session.close.php                    30-Sep-2022 11:03                3934
mysql-xdevapi-session.commit.php                   30-Sep-2022 11:03                4735
mysql-xdevapi-session.construct.php                30-Sep-2022 11:03                3102
mysql-xdevapi-session.createschema.php             30-Sep-2022 11:03                4946
mysql-xdevapi-session.dropschema.php               30-Sep-2022 11:03                4061
mysql-xdevapi-session.generateuuid.php             30-Sep-2022 11:03                3940
mysql-xdevapi-session.getdefaultschema.php         30-Sep-2022 11:03                4107
mysql-xdevapi-session.getschema.php                30-Sep-2022 11:03                4222
mysql-xdevapi-session.getschemas.php               30-Sep-2022 11:03                4033
mysql-xdevapi-session.getserverversion.php         30-Sep-2022 11:03                3876
mysql-xdevapi-session.listclients.php              30-Sep-2022 11:03                4200
mysql-xdevapi-session.quotename.php                30-Sep-2022 11:03                5323
mysql-xdevapi-session.releasesavepoint.php         30-Sep-2022 11:03                5676
mysql-xdevapi-session.rollback.php                 30-Sep-2022 11:03                5361
mysql-xdevapi-session.rollbackto.php               30-Sep-2022 11:03                5755
mysql-xdevapi-session.setsavepoint.php             30-Sep-2022 11:03                5938
mysql-xdevapi-session.sql.php                      30-Sep-2022 11:03                3919
mysql-xdevapi-session.starttransaction.php         30-Sep-2022 11:03                5437
mysql-xdevapi-sqlstatement.bind.php                30-Sep-2022 11:03                3291
mysql-xdevapi-sqlstatement.construct.php           30-Sep-2022 11:03                2840
mysql-xdevapi-sqlstatement.execute.php             30-Sep-2022 11:03                3123
mysql-xdevapi-sqlstatement.getnextresult.php       30-Sep-2022 11:03                3175
mysql-xdevapi-sqlstatement.getresult.php           30-Sep-2022 11:03                3144
mysql-xdevapi-sqlstatement.hasmoreresults.php      30-Sep-2022 11:03                3194
mysql-xdevapi-sqlstatementresult.construct.php     30-Sep-2022 11:03                2960
mysql-xdevapi-sqlstatementresult.fetchall.php      30-Sep-2022 11:03                7026
mysql-xdevapi-sqlstatementresult.fetchone.php      30-Sep-2022 11:03                6855
mysql-xdevapi-sqlstatementresult.getaffectedite..> 30-Sep-2022 11:03                3309
mysql-xdevapi-sqlstatementresult.getcolumncount..> 30-Sep-2022 11:03                3833
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 30-Sep-2022 11:03                3225
mysql-xdevapi-sqlstatementresult.getcolumns.php    30-Sep-2022 11:03                3181
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 30-Sep-2022 11:03                3339
mysql-xdevapi-sqlstatementresult.getlastinserti..> 30-Sep-2022 11:03                3282
mysql-xdevapi-sqlstatementresult.getwarningcoun..> 30-Sep-2022 11:03                3312
mysql-xdevapi-sqlstatementresult.getwarnings.php   30-Sep-2022 11:03                3433
mysql-xdevapi-sqlstatementresult.hasdata.php       30-Sep-2022 11:03                3214
mysql-xdevapi-sqlstatementresult.nextresult.php    30-Sep-2022 11:03                3280
mysql-xdevapi-statement.construct.php              30-Sep-2022 11:03                2808
mysql-xdevapi-statement.getnextresult.php          30-Sep-2022 11:03                3124
mysql-xdevapi-statement.getresult.php              30-Sep-2022 11:03                3087
mysql-xdevapi-statement.hasmoreresults.php         30-Sep-2022 11:03                3037
mysql-xdevapi-table.construct.php                  30-Sep-2022 11:03                3568
mysql-xdevapi-table.count.php                      30-Sep-2022 11:03                5764
mysql-xdevapi-table.delete.php                     30-Sep-2022 11:03                6536
mysql-xdevapi-table.existsindatabase.php           30-Sep-2022 11:03                6221
mysql-xdevapi-table.getname.php                    30-Sep-2022 11:03                5841
mysql-xdevapi-table.getschema.php                  30-Sep-2022 11:03                6004
mysql-xdevapi-table.getsession.php                 30-Sep-2022 11:03                5953
mysql-xdevapi-table.insert.php                     30-Sep-2022 11:03                7131
mysql-xdevapi-table.isview.php                     30-Sep-2022 11:03                6138
mysql-xdevapi-table.select.php                     30-Sep-2022 11:03                7377
mysql-xdevapi-table.update.php                     30-Sep-2022 11:03                6343
mysql-xdevapi-tabledelete.bind.php                 30-Sep-2022 11:03                6950
mysql-xdevapi-tabledelete.construct.php            30-Sep-2022 11:03                6400
mysql-xdevapi-tabledelete.execute.php              30-Sep-2022 11:03                6670
mysql-xdevapi-tabledelete.limit.php                30-Sep-2022 11:03                6933
mysql-xdevapi-tabledelete.orderby.php              30-Sep-2022 11:03                5332
mysql-xdevapi-tabledelete.where.php                30-Sep-2022 11:03                5158
mysql-xdevapi-tableinsert.construct.php            30-Sep-2022 11:03                6175
mysql-xdevapi-tableinsert.execute.php              30-Sep-2022 11:03                6433
mysql-xdevapi-tableinsert.values.php               30-Sep-2022 11:03                6690
mysql-xdevapi-tableselect.bind.php                 30-Sep-2022 11:03                6167
mysql-xdevapi-tableselect.construct.php            30-Sep-2022 11:03                7441
mysql-xdevapi-tableselect.execute.php              30-Sep-2022 11:03                5976
mysql-xdevapi-tableselect.groupby.php              30-Sep-2022 11:03                8021
mysql-xdevapi-tableselect.having.php               30-Sep-2022 11:03                8088
mysql-xdevapi-tableselect.limit.php                30-Sep-2022 11:03                5641
mysql-xdevapi-tableselect.lockexclusive.php        30-Sep-2022 11:03                6737
mysql-xdevapi-tableselect.lockshared.php           30-Sep-2022 11:03                6703
mysql-xdevapi-tableselect.offset.php               30-Sep-2022 11:03                7368
mysql-xdevapi-tableselect.orderby.php              30-Sep-2022 11:03                6288
mysql-xdevapi-tableselect.where.php                30-Sep-2022 11:03                6161
mysql-xdevapi-tableupdate.bind.php                 30-Sep-2022 11:03                5513
mysql-xdevapi-tableupdate.construct.php            30-Sep-2022 11:03                5013
mysql-xdevapi-tableupdate.execute.php              30-Sep-2022 11:03                5306
mysql-xdevapi-tableupdate.limit.php                30-Sep-2022 11:03                5546
mysql-xdevapi-tableupdate.orderby.php              30-Sep-2022 11:03                6073
mysql-xdevapi-tableupdate.set.php                  30-Sep-2022 11:03                5805
mysql-xdevapi-tableupdate.where.php                30-Sep-2022 11:03                5524
mysql-xdevapi-warning.construct.php                30-Sep-2022 11:03                2738
mysql-xdevapi.build.php                            30-Sep-2022 11:03                4098
mysql-xdevapi.configuration.php                    30-Sep-2022 11:03                4438
mysql-xdevapi.constants.php                        30-Sep-2022 11:03                9435
mysql-xdevapi.examples.php                         30-Sep-2022 11:03               10274
mysql-xdevapi.installation.php                     30-Sep-2022 11:03                2996
mysql-xdevapi.requirements.php                     30-Sep-2022 11:03                1345
mysql-xdevapi.setup.php                            30-Sep-2022 11:03                1588
mysql.configuration.php                            30-Sep-2022 11:03                8061
mysql.constants.php                                30-Sep-2022 11:03                3896
mysql.examples-basic.php                           30-Sep-2022 11:03                5505
mysql.examples.php                                 30-Sep-2022 11:03                1341
mysql.installation.php                             30-Sep-2022 11:03                7120
mysql.php                                          30-Sep-2022 11:03                2547
mysql.requirements.php                             30-Sep-2022 11:03                1604
mysql.resources.php                                30-Sep-2022 11:03                1241
mysql.setup.php                                    30-Sep-2022 11:03                1504
mysqli-driver.embedded-server-end.php              30-Sep-2022 11:03                2623
mysqli-driver.embedded-server-start.php            30-Sep-2022 11:03                3243
mysqli-driver.report-mode.php                      30-Sep-2022 11:03               15395
mysqli-result.construct.php                        30-Sep-2022 11:03                8287
mysqli-result.current-field.php                    30-Sep-2022 11:03               16524
mysqli-result.data-seek.php                        30-Sep-2022 11:03               18561
mysqli-result.fetch-all.php                        30-Sep-2022 11:03               11417
mysqli-result.fetch-array.php                      30-Sep-2022 11:03               17221
mysqli-result.fetch-assoc.php                      30-Sep-2022 11:03               17021
mysqli-result.fetch-column.php