Index of /php.ihc-ru.net/manual/tr/


../
feeds/                                             30-Sep-2022 11:11                   -
images/                                            30-Sep-2022 11:11                   -
styles/                                            30-Sep-2022 11:10                   -
toc/                                               30-Sep-2022 11:11                   -
about.formats.php                                  30-Sep-2022 11:11                4112
about.generate.php                                 30-Sep-2022 11:11                2657
about.howtohelp.php                                30-Sep-2022 11:11                3374
about.more.php                                     30-Sep-2022 11:11                1794
about.notes.php                                    30-Sep-2022 11:11                2384
about.php                                          30-Sep-2022 11:11                1820
about.phpversions.php                              30-Sep-2022 11:11                3322
about.prototypes.php                               30-Sep-2022 11:11                7206
about.translations.php                             30-Sep-2022 11:11                3135
aliases.php                                        30-Sep-2022 11:11               28946
apache.configuration.php                           30-Sep-2022 11:11                5079
apache.constants.php                               30-Sep-2022 11:11                1142
apache.installation.php                            30-Sep-2022 11:11                1251
apache.requirements.php                            30-Sep-2022 11:11                1164
apache.resources.php                               30-Sep-2022 11:11                1208
apache.setup.php                                   30-Sep-2022 11:11                1572
apcu.configuration.php                             30-Sep-2022 11:10               14449
apcu.constants.php                                 30-Sep-2022 11:10                5267
apcu.installation.php                              30-Sep-2022 11:10                3179
apcu.requirements.php                              30-Sep-2022 11:10                1150
apcu.resources.php                                 30-Sep-2022 11:10                1194
apcu.setup.php                                     30-Sep-2022 11:10                1528
apcuiterator.construct.php                         30-Sep-2022 11:10                6405
apcuiterator.current.php                           30-Sep-2022 11:10                2988
apcuiterator.gettotalcount.php                     30-Sep-2022 11:10                3113
apcuiterator.gettotalhits.php                      30-Sep-2022 11:10                3197
apcuiterator.gettotalsize.php                      30-Sep-2022 11:10                2990
apcuiterator.key.php                               30-Sep-2022 11:10                2689
apcuiterator.next.php                              30-Sep-2022 11:10                2913
apcuiterator.rewind.php                            30-Sep-2022 11:10                2681
apcuiterator.valid.php                             30-Sep-2022 11:10                2767
appendices.php                                     30-Sep-2022 11:11               11758
appenditerator.append.php                          30-Sep-2022 11:10                5515
appenditerator.construct.php                       30-Sep-2022 11:10               10544
appenditerator.current.php                         30-Sep-2022 11:10                3495
appenditerator.getarrayiterator.php                30-Sep-2022 11:10                3155
appenditerator.getinneriterator.php                30-Sep-2022 11:10                6832
appenditerator.getiteratorindex.php                30-Sep-2022 11:10                6773
appenditerator.key.php                             30-Sep-2022 11:10                8209
appenditerator.next.php                            30-Sep-2022 11:10                3365
appenditerator.rewind.php                          30-Sep-2022 11:10                3357
appenditerator.valid.php                           30-Sep-2022 11:10                3202
array.configuration.php                            30-Sep-2022 11:11                1250
array.constants.php                                30-Sep-2022 11:11                8590
array.installation.php                             30-Sep-2022 11:11                1213
array.requirements.php                             30-Sep-2022 11:11                1157
array.resources.php                                30-Sep-2022 11:11                1201
array.setup.php                                    30-Sep-2022 11:11                1536
array.sorting.php                                  30-Sep-2022 11:11                7075
arrayaccess.offsetexists.php                       30-Sep-2022 11:10                9830
arrayaccess.offsetget.php                          30-Sep-2022 11:10                4916
arrayaccess.offsetset.php                          30-Sep-2022 11:10                5152
arrayaccess.offsetunset.php                        30-Sep-2022 11:10                2816
arrayiterator.append.php                           30-Sep-2022 11:10                3455
arrayiterator.asort.php                            30-Sep-2022 11:10                6161
arrayiterator.construct.php                        30-Sep-2022 11:10                3520
arrayiterator.count.php                            30-Sep-2022 11:10                2912
arrayiterator.current.php                          30-Sep-2022 11:10                5386
arrayiterator.getarraycopy.php                     30-Sep-2022 11:10                2877
arrayiterator.getflags.php                         30-Sep-2022 11:10                3011
arrayiterator.key.php                              30-Sep-2022 11:10                3796
arrayiterator.ksort.php                            30-Sep-2022 11:10                6125
arrayiterator.natcasesort.php                      30-Sep-2022 11:10                4057
arrayiterator.natsort.php                          30-Sep-2022 11:10                3840
arrayiterator.next.php                             30-Sep-2022 11:10                4678
arrayiterator.offsetexists.php                     30-Sep-2022 11:10                3181
arrayiterator.offsetget.php                        30-Sep-2022 11:10                3427
arrayiterator.offsetset.php                        30-Sep-2022 11:10                3671
arrayiterator.offsetunset.php                      30-Sep-2022 11:10                3774
arrayiterator.rewind.php                           30-Sep-2022 11:10                4653
arrayiterator.seek.php                             30-Sep-2022 11:10                2485
arrayiterator.serialize.php                        30-Sep-2022 11:10                2788
arrayiterator.setflags.php                         30-Sep-2022 11:10                4025
arrayiterator.uasort.php                           30-Sep-2022 11:10                5128
arrayiterator.uksort.php                           30-Sep-2022 11:10                4882
arrayiterator.unserialize.php                      30-Sep-2022 11:10                3013
arrayiterator.valid.php                            30-Sep-2022 11:10                4548
arrayobject.append.php                             30-Sep-2022 11:11                5483
arrayobject.asort.php                              30-Sep-2022 11:11                9185
arrayobject.construct.php                          30-Sep-2022 11:11                6026
arrayobject.count.php                              30-Sep-2022 11:11                5439
arrayobject.exchangearray.php                      30-Sep-2022 11:11                6093
arrayobject.getarraycopy.php                       30-Sep-2022 11:11                5318
arrayobject.getflags.php                           30-Sep-2022 11:11                6190
arrayobject.getiterator.php                        30-Sep-2022 11:11                5525
arrayobject.getiteratorclass.php                   30-Sep-2022 11:11                6734
arrayobject.ksort.php                              30-Sep-2022 11:11                8860
arrayobject.natcasesort.php                        30-Sep-2022 11:11                7672
arrayobject.natsort.php                            30-Sep-2022 11:11                7355
arrayobject.offsetexists.php                       30-Sep-2022 11:11                4811
arrayobject.offsetget.php                          30-Sep-2022 11:11                5112
arrayobject.offsetset.php                          30-Sep-2022 11:11                6893
arrayobject.offsetunset.php                        30-Sep-2022 11:11                4241
arrayobject.serialize.php                          30-Sep-2022 11:11                5060
arrayobject.setflags.php                           30-Sep-2022 11:11                6798
arrayobject.setiteratorclass.php                   30-Sep-2022 11:11                5921
arrayobject.uasort.php                             30-Sep-2022 11:11                9995
arrayobject.uksort.php                             30-Sep-2022 11:11                9315
arrayobject.unserialize.php                        30-Sep-2022 11:11                3469
backedenum.from.php                                30-Sep-2022 11:10                6118
backedenum.tryfrom.php                             30-Sep-2022 11:10                6416
bc.configuration.php                               30-Sep-2022 11:10                2476
bc.constants.php                                   30-Sep-2022 11:10                1111
bc.installation.php                                30-Sep-2022 11:10                1413
bc.requirements.php                                30-Sep-2022 11:10                1136
bc.resources.php                                   30-Sep-2022 11:10                1180
bc.setup.php                                       30-Sep-2022 11:10                1525
book.apache.php                                    30-Sep-2022 11:11                3335
book.apcu.php                                      30-Sep-2022 11:10                4359
book.array.php                                     30-Sep-2022 11:11               13390
book.bc.php                                        30-Sep-2022 11:10                3099
book.bson.php                                      30-Sep-2022 11:10               19853
book.bzip2.php                                     30-Sep-2022 11:10                3028
book.calendar.php                                  30-Sep-2022 11:10                4421
book.classobj.php                                  30-Sep-2022 11:11                4710
book.cmark.php                                     30-Sep-2022 11:11                8647
book.com.php                                       30-Sep-2022 11:11                8359
book.componere.php                                 30-Sep-2022 11:10                6121
book.csprng.php                                    30-Sep-2022 11:10                2123
book.ctype.php                                     30-Sep-2022 11:11                3344
book.cubrid.php                                    30-Sep-2022 11:10               13834
book.curl.php                                      30-Sep-2022 11:11                7592
book.datetime.php                                  30-Sep-2022 11:10               16923
book.dba.php                                       30-Sep-2022 11:10                3385
book.dbase.php                                     30-Sep-2022 11:10                3193
book.dio.php                                       30-Sep-2022 11:10                3098
book.dir.php                                       30-Sep-2022 11:10                3196
book.dom.php                                       30-Sep-2022 11:11               19922
book.ds.php                                        30-Sep-2022 11:11               25036
book.eio.php                                       30-Sep-2022 11:10                7919
book.enchant.php                                   30-Sep-2022 11:10                5317
book.errorfunc.php                                 30-Sep-2022 11:10                3514
book.ev.php                                        30-Sep-2022 11:10               13344
book.event.php                                     30-Sep-2022 11:11               23013
book.exec.php                                      30-Sep-2022 11:10                3522
book.exif.php                                      30-Sep-2022 11:10                2680
book.expect.php                                    30-Sep-2022 11:10                2459
book.fann.php                                      30-Sep-2022 11:10               23074
book.fdf.php                                       30-Sep-2022 11:10                5611
book.ffi.php                                       30-Sep-2022 11:10                5616
book.fileinfo.php                                  30-Sep-2022 11:10                3199
book.filesystem.php                                30-Sep-2022 11:10               11097
book.filter.php                                    30-Sep-2022 11:11                3400
book.fpm.php                                       30-Sep-2022 11:11                1913
book.ftp.php                                       30-Sep-2022 11:11                6407
book.funchand.php                                  30-Sep-2022 11:11                3919
book.gearman.php                                   30-Sep-2022 11:11               14778
book.gender.php                                    30-Sep-2022 11:10                2516
book.geoip.php                                     30-Sep-2022 11:10                4320
book.gettext.php                                   30-Sep-2022 11:10                3079
book.gmagick.php                                   30-Sep-2022 11:10               22540
book.gmp.php                                       30-Sep-2022 11:10                6408
book.gnupg.php                                     30-Sep-2022 11:10                4849
book.hash.php                                      30-Sep-2022 11:10                4371
book.hrtime.php                                    30-Sep-2022 11:10                3419
book.ibase.php                                     30-Sep-2022 11:10               12146
book.ibm-db2.php                                   30-Sep-2022 11:10                8609
book.iconv.php                                     30-Sep-2022 11:10                3404
book.igbinary.php                                  30-Sep-2022 11:10                2084
book.image.php                                     30-Sep-2022 11:10               18488
book.imagick.php                                   30-Sep-2022 11:10               73969
book.imap.php                                      30-Sep-2022 11:10               11431
book.info.php                                      30-Sep-2022 11:10                9302
book.inotify.php                                   30-Sep-2022 11:10                2518
book.intl.php                                      30-Sep-2022 11:10               46213
book.json.php                                      30-Sep-2022 11:10                2837
book.ldap.php                                      30-Sep-2022 11:11                8904
book.libxml.php                                    30-Sep-2022 11:11                3041
book.lua.php                                       30-Sep-2022 11:10                2601
book.luasandbox.php                                30-Sep-2022 11:10                5526
book.lzf.php                                       30-Sep-2022 11:10                2236
book.mail.php                                      30-Sep-2022 11:10                2070
book.mailparse.php                                 30-Sep-2022 11:10                3875
book.math.php                                      30-Sep-2022 11:10                6013
book.mbstring.php                                  30-Sep-2022 11:10               11830
book.mcrypt.php                                    30-Sep-2022 11:10                6830
book.memcache.php                                  30-Sep-2022 11:11                4187
book.memcached.php                                 30-Sep-2022 11:11                8036
book.mhash.php                                     30-Sep-2022 11:10                2546
book.misc.php                                      30-Sep-2022 11:10                5791
book.mongodb.php                                   30-Sep-2022 11:10               25588
book.mqseries.php                                  30-Sep-2022 11:11                3140
book.mysql-xdevapi.php                             30-Sep-2022 11:10               28964
book.mysql.php                                     30-Sep-2022 11:10                7943
book.mysqli.php                                    30-Sep-2022 11:10               17892
book.mysqlnd.php                                   30-Sep-2022 11:10                2417
book.network.php                                   30-Sep-2022 11:11                6325
book.oauth.php                                     30-Sep-2022 11:11                7152
book.oci8.php                                      30-Sep-2022 11:10               16893
book.opcache.php                                   30-Sep-2022 11:10                2654
book.openal.php                                    30-Sep-2022 11:10                4401
book.openssl.php                                   30-Sep-2022 11:10               11898
book.outcontrol.php                                30-Sep-2022 11:10                4547
book.parallel.php                                  30-Sep-2022 11:10                5679
book.parle.php                                     30-Sep-2022 11:11                8753
book.password.php                                  30-Sep-2022 11:10                2587
book.pcntl.php                                     30-Sep-2022 11:10                5519
book.pcre.php                                      30-Sep-2022 11:11                4015
book.pdo.php                                       30-Sep-2022 11:10                8592
book.pgsql.php                                     30-Sep-2022 11:10               12205
book.phar.php                                      30-Sep-2022 11:10               15677
book.phpdbg.php                                    30-Sep-2022 11:10                2886
book.posix.php                                     30-Sep-2022 11:10                7086
book.ps.php                                        30-Sep-2022 11:10                9158
book.pspell.php                                    30-Sep-2022 11:10                4397
book.pthreads.php                                  30-Sep-2022 11:10                5408
book.quickhash.php                                 30-Sep-2022 11:11                8874
book.radius.php                                    30-Sep-2022 11:10                5505
book.rar.php                                       30-Sep-2022 11:10                5223
book.readline.php                                  30-Sep-2022 11:10                3638
book.recode.php                                    30-Sep-2022 11:10                2291
book.reflection.php                                30-Sep-2022 11:11               39815
book.rpminfo.php                                   30-Sep-2022 11:10                2390
book.rrd.php                                       30-Sep-2022 11:11                5066
book.runkit7.php                                   30-Sep-2022 11:10                4191
book.scoutapm.php                                  30-Sep-2022 11:11                2143
book.seaslog.php                                   30-Sep-2022 11:10                5139
book.sem.php                                       30-Sep-2022 11:10                4118
book.session.php                                   30-Sep-2022 11:11                8414
book.shmop.php                                     30-Sep-2022 11:10                2767
book.simplexml.php                                 30-Sep-2022 11:11                5823
book.snmp.php                                      30-Sep-2022 11:11                5801
book.soap.php                                      30-Sep-2022 11:11                6051
book.sockets.php                                   30-Sep-2022 11:11                7254
book.sodium.php                                    30-Sep-2022 11:10               17287
book.solr.php                                      30-Sep-2022 11:11               53100
book.spl.php                                       30-Sep-2022 11:11                9975
book.sqlite3.php                                   30-Sep-2022 11:10                7526
book.sqlsrv.php                                    30-Sep-2022 11:10                5300
book.ssdeep.php                                    30-Sep-2022 11:11                2276
book.ssh2.php                                      30-Sep-2022 11:11                5806
book.stats.php                                     30-Sep-2022 11:10               11768
book.stomp.php                                     30-Sep-2022 11:11                4099
book.stream.php                                    30-Sep-2022 11:11               12646
book.strings.php                                   30-Sep-2022 11:11               14494
book.svm.php                                       30-Sep-2022 11:11                3632
book.svn.php                                       30-Sep-2022 11:11                7556
book.swoole.php                                    30-Sep-2022 11:11               37277
book.sync.php                                      30-Sep-2022 11:10                4731
book.taint.php                                     30-Sep-2022 11:11                2472
book.tcpwrap.php                                   30-Sep-2022 11:11                2015
book.tidy.php                                      30-Sep-2022 11:11                7422
book.tokenizer.php                                 30-Sep-2022 11:11                3238
book.trader.php                                    30-Sep-2022 11:10               17454
book.ui.php                                        30-Sep-2022 11:11               27856
book.uodbc.php                                     30-Sep-2022 11:10                7425
book.uopz.php                                      30-Sep-2022 11:10                5059
book.url.php                                       30-Sep-2022 11:11                3084
book.v8js.php                                      30-Sep-2022 11:11                3048
book.var.php                                       30-Sep-2022 11:11                6227
book.var_representation.php                        30-Sep-2022 11:11                2067
book.varnish.php                                   30-Sep-2022 11:11                5324
book.wddx.php                                      30-Sep-2022 11:11                2815
book.win32service.php                              30-Sep-2022 11:11                5193
book.wincache.php                                  30-Sep-2022 11:10                5563
book.wkhtmltox.php                                 30-Sep-2022 11:10                3260
book.xattr.php                                     30-Sep-2022 11:10                2469
book.xdiff.php                                     30-Sep-2022 11:10                4329
book.xhprof.php                                    30-Sep-2022 11:10                2413
book.xlswriter.php                                 30-Sep-2022 11:10                4371
book.xml.php                                       30-Sep-2022 11:11                6064
book.xmldiff.php                                   30-Sep-2022 11:11                3040
book.xmlreader.php                                 30-Sep-2022 11:11                5378
book.xmlrpc.php                                    30-Sep-2022 11:11                4093
book.xmlwriter.php                                 30-Sep-2022 11:11                7247
book.xsl.php                                       30-Sep-2022 11:11                4001
book.yac.php                                       30-Sep-2022 11:10                2549
book.yaconf.php                                    30-Sep-2022 11:11                2090
book.yaf.php                                       30-Sep-2022 11:11               34606
book.yaml.php                                      30-Sep-2022 11:11                2722
book.yar.php                                       30-Sep-2022 11:11                3640
book.yaz.php                                       30-Sep-2022 11:11                4645
book.zip.php                                       30-Sep-2022 11:10               10280
book.zlib.php                                      30-Sep-2022 11:10                5469
book.zmq.php                                       30-Sep-2022 11:11                5427
book.zookeeper.php                                 30-Sep-2022 11:11                6605
bzip2.configuration.php                            30-Sep-2022 11:10                1250
bzip2.constants.php                                30-Sep-2022 11:10                1134
bzip2.examples.php                                 30-Sep-2022 11:10                4276
bzip2.installation.php                             30-Sep-2022 11:10                1371
bzip2.requirements.php                             30-Sep-2022 11:10                1347
bzip2.resources.php                                30-Sep-2022 11:10                1270
bzip2.setup.php                                    30-Sep-2022 11:10                1559
cachingiterator.construct.php                      30-Sep-2022 11:10                2721
cachingiterator.count.php                          30-Sep-2022 11:10                2395
cachingiterator.current.php                        30-Sep-2022 11:10                2835
cachingiterator.getcache.php                       30-Sep-2022 11:10                5606
cachingiterator.getflags.php                       30-Sep-2022 11:10                2407
cachingiterator.getinneriterator.php               30-Sep-2022 11:10                2546
cachingiterator.hasnext.php                        30-Sep-2022 11:10                2429
cachingiterator.key.php                            30-Sep-2022 11:10                2184
cachingiterator.next.php                           30-Sep-2022 11:10                2344
cachingiterator.offsetexists.php                   30-Sep-2022 11:10                2697
cachingiterator.offsetget.php                      30-Sep-2022 11:10                2648
cachingiterator.offsetset.php                      30-Sep-2022 11:10                2995
cachingiterator.offsetunset.php                    30-Sep-2022 11:10                2623
cachingiterator.rewind.php                         30-Sep-2022 11:10                2360
cachingiterator.setflags.php                       30-Sep-2022 11:10                2657
cachingiterator.tostring.php                       30-Sep-2022 11:10                2465
cachingiterator.valid.php                          30-Sep-2022 11:10                2460
calendar.configuration.php                         30-Sep-2022 11:10                1271
calendar.constants.php                             30-Sep-2022 11:10               10340
calendar.installation.php                          30-Sep-2022 11:10                1475
calendar.requirements.php                          30-Sep-2022 11:10                1178
calendar.resources.php                             30-Sep-2022 11:10                1222
calendar.setup.php                                 30-Sep-2022 11:10                1596
callbackfilteriterator.accept.php                  30-Sep-2022 11:10                3314
callbackfilteriterator.construct.php               30-Sep-2022 11:10                3842
cc.license.php                                     30-Sep-2022 11:11               21005
changelog.misc.php                                 30-Sep-2022 11:10                3864
changelog.mysql.php                                30-Sep-2022 11:10                2498
changelog.mysql_xdevapi.php                        30-Sep-2022 11:10                2296
changelog.mysqli.php                               30-Sep-2022 11:10                3481
changelog.strings.php                              30-Sep-2022 11:11               12347
class.addressinfo.php                              30-Sep-2022 11:11                1759
class.apcuiterator.php                             30-Sep-2022 11:10                6516
class.appenditerator.php                           30-Sep-2022 11:10                8109
class.argumentcounterror.php                       30-Sep-2022 11:10                6665
class.arithmeticerror.php                          30-Sep-2022 11:10                6914
class.arrayaccess.php                              30-Sep-2022 11:10               13135
class.arrayiterator.php                            30-Sep-2022 11:10               15358
class.arrayobject.php                              30-Sep-2022 11:11               14835
class.assertionerror.php                           30-Sep-2022 11:10                6651
class.backedenum.php                               30-Sep-2022 11:10                4117
class.badfunctioncallexception.php                 30-Sep-2022 11:11                6764
class.badmethodcallexception.php                   30-Sep-2022 11:11                6781
class.cachingiterator.php                          30-Sep-2022 11:10               16136
class.callbackfilteriterator.php                   30-Sep-2022 11:10               12184
class.closure.php                                  30-Sep-2022 11:10                6401
class.collator.php                                 30-Sep-2022 11:10               26381
class.collectable.php                              30-Sep-2022 11:10                2407
class.com-exception.php                            30-Sep-2022 11:11                6573
class.com.php                                      30-Sep-2022 11:11               12804
class.commonmark-cql.php                           30-Sep-2022 11:11                7561
class.commonmark-interfaces-ivisitable.php         30-Sep-2022 11:11                2881
class.commonmark-interfaces-ivisitor.php           30-Sep-2022 11:11                4248
class.commonmark-node-blockquote.php               30-Sep-2022 11:11                8250
class.commonmark-node-bulletlist.php               30-Sep-2022 11:11               10131
class.commonmark-node-code.php                     30-Sep-2022 11:11                9124
class.commonmark-node-codeblock.php                30-Sep-2022 11:11               10326
class.commonmark-node-customblock.php              30-Sep-2022 11:11                8879
class.commonmark-node-custominline.php             30-Sep-2022 11:11                8859
class.commonmark-node-document.php                 30-Sep-2022 11:11                8197
class.commonmark-node-heading.php                  30-Sep-2022 11:11                9487
class.commonmark-node-htmlblock.php                30-Sep-2022 11:11                9182
class.commonmark-node-htmlinline.php               30-Sep-2022 11:11                9158
class.commonmark-node-image.php                    30-Sep-2022 11:11               10211
class.commonmark-node-item.php                     30-Sep-2022 11:11                8217
class.commonmark-node-linebreak.php                30-Sep-2022 11:11                8231
class.commonmark-node-link.php                     30-Sep-2022 11:11               10204
class.commonmark-node-orderedlist.php              30-Sep-2022 11:11               10865
class.commonmark-node-paragraph.php                30-Sep-2022 11:11                8256
class.commonmark-node-softbreak.php                30-Sep-2022 11:11                8249
class.commonmark-node-text-emphasis.php            30-Sep-2022 11:11                8278
class.commonmark-node-text-strong.php              30-Sep-2022 11:11                8267
class.commonmark-node-text.php                     30-Sep-2022 11:11                9521
class.commonmark-node-thematicbreak.php            30-Sep-2022 11:11                8278
class.commonmark-node.php                          30-Sep-2022 11:11                9152
class.commonmark-parser.php                        30-Sep-2022 11:11                3618
class.compersisthelper.php                         30-Sep-2022 11:11                6505
class.compileerror.php                             30-Sep-2022 11:10                6584
class.componere-abstract-definition.php            30-Sep-2022 11:10                4587
class.componere-definition.php                     30-Sep-2022 11:10                9385
class.componere-method.php                         30-Sep-2022 11:10                4352
class.componere-patch.php                          30-Sep-2022 11:10                7771
class.componere-value.php                          30-Sep-2022 11:10                5216
class.countable.php                                30-Sep-2022 11:11                2514
class.curlfile.php                                 30-Sep-2022 11:11                7558
class.curlhandle.php                               30-Sep-2022 11:11                1794
class.curlmultihandle.php                          30-Sep-2022 11:11                1833
class.curlsharehandle.php                          30-Sep-2022 11:11                1829
class.curlstringfile.php                           30-Sep-2022 11:11                5244
class.dateinterval.php                             30-Sep-2022 11:10               13076
class.dateperiod.php                               30-Sep-2022 11:10               13150
class.datetime.php                                 30-Sep-2022 11:10               20955
class.datetimeimmutable.php                        30-Sep-2022 11:10               20301
class.datetimeinterface.php                        30-Sep-2022 11:10               16551
class.datetimezone.php                             30-Sep-2022 11:10               13274
class.deflatecontext.php                           30-Sep-2022 11:10                1824
class.directory.php                                30-Sep-2022 11:10                5287
class.directoryiterator.php                        30-Sep-2022 11:10               23354
class.divisionbyzeroerror.php                      30-Sep-2022 11:10                6623
class.domainexception.php                          30-Sep-2022 11:11                6696
class.domattr.php                                  30-Sep-2022 11:11               21509
class.domcdatasection.php                          30-Sep-2022 11:11               23065
class.domcharacterdata.php                         30-Sep-2022 11:11               24295
class.domchildnode.php                             30-Sep-2022 11:11                3949
class.domcomment.php                               30-Sep-2022 11:11               22066
class.domdocument.php                              30-Sep-2022 11:11               55828
class.domdocumentfragment.php                      30-Sep-2022 11:11               21069
class.domdocumenttype.php                          30-Sep-2022 11:11               21195
class.domelement.php                               30-Sep-2022 11:11               36912
class.domentity.php                                30-Sep-2022 11:11               21509
class.domentityreference.php                       30-Sep-2022 11:11               17588
class.domexception.php                             30-Sep-2022 11:11                7489
class.domimplementation.php                        30-Sep-2022 11:11                5247
class.domnamednodemap.php                          30-Sep-2022 11:11                6652
class.domnode.php                                  30-Sep-2022 11:11               25848
class.domnodelist.php                              30-Sep-2022 11:11                5447
class.domnotation.php                              30-Sep-2022 11:11               17842
class.domparentnode.php                            30-Sep-2022 11:11                3039
class.domprocessinginstruction.php                 30-Sep-2022 11:11               18947
class.domtext.php                                  30-Sep-2022 11:11               24793
class.domxpath.php                                 30-Sep-2022 11:11                7709
class.dotnet.php                                   30-Sep-2022 11:11                7005
class.ds-collection.php                            30-Sep-2022 11:11                5105
class.ds-deque.php                                 30-Sep-2022 11:11               21393
class.ds-hashable.php                              30-Sep-2022 11:11                4060
class.ds-map.php                                   30-Sep-2022 11:11               22571
class.ds-pair.php                                  30-Sep-2022 11:11                4462
class.ds-priorityqueue.php                         30-Sep-2022 11:11                7920
class.ds-queue.php                                 30-Sep-2022 11:11                7478
class.ds-sequence.php                              30-Sep-2022 11:11               19152
class.ds-set.php                                   30-Sep-2022 11:11               18003
class.ds-stack.php                                 30-Sep-2022 11:11                6912
class.ds-vector.php                                30-Sep-2022 11:11               20960
class.emptyiterator.php                            30-Sep-2022 11:10                3925
class.enchantbroker.php                            30-Sep-2022 11:10                1836
class.enchantdictionary.php                        30-Sep-2022 11:10                1826
class.error.php                                    30-Sep-2022 11:10                9957
class.errorexception.php                           30-Sep-2022 11:10               12501
class.ev.php                                       30-Sep-2022 11:10               37645
class.evcheck.php                                  30-Sep-2022 11:10               10081
class.evchild.php                                  30-Sep-2022 11:10               11531
class.evembed.php                                  30-Sep-2022 11:10                9244
class.event.php                                    30-Sep-2022 11:11               17108
class.eventbase.php                                30-Sep-2022 11:11               13323
class.eventbuffer.php                              30-Sep-2022 11:11               20222
class.eventbufferevent.php                         30-Sep-2022 11:11               33445
class.eventconfig.php                              30-Sep-2022 11:11                6828
class.eventdnsbase.php                             30-Sep-2022 11:11               10169
class.eventhttp.php                                30-Sep-2022 11:11                8486
class.eventhttpconnection.php                      30-Sep-2022 11:11                9458
class.eventhttprequest.php                         30-Sep-2022 11:11               19852
class.eventlistener.php                            30-Sep-2022 11:11               11601
class.eventsslcontext.php                          30-Sep-2022 11:11               16447
class.eventutil.php                                30-Sep-2022 11:11               22328
class.evfork.php                                   30-Sep-2022 11:10                8226
class.evidle.php                                   30-Sep-2022 11:10                9258
class.evio.php                                     30-Sep-2022 11:10               11932
class.evloop.php                                   30-Sep-2022 11:10               29218
class.evperiodic.php                               30-Sep-2022 11:10               13912
class.evprepare.php                                30-Sep-2022 11:10               10229
class.evsignal.php                                 30-Sep-2022 11:10               10955
class.evstat.php                                   30-Sep-2022 11:10               13344
class.evtimer.php                                  30-Sep-2022 11:10               13323
class.evwatcher.php                                30-Sep-2022 11:10                9191
class.exception.php                                30-Sep-2022 11:10               10110
class.fannconnection.php                           30-Sep-2022 11:10                6085
class.ffi-cdata.php                                30-Sep-2022 11:10                5465
class.ffi-ctype.php                                30-Sep-2022 11:10                7844
class.ffi-exception.php                            30-Sep-2022 11:10                6409
class.ffi-parserexception.php                      30-Sep-2022 11:10                6465
class.ffi.php                                      30-Sep-2022 11:10               17741
class.fiber.php                                    30-Sep-2022 11:10                7891
class.fibererror.php                               30-Sep-2022 11:10                7293
class.filesystemiterator.php                       30-Sep-2022 11:10               29996
class.filteriterator.php                           30-Sep-2022 11:10                7620
class.finfo.php                                    30-Sep-2022 11:10                5112
class.ftp-connection.php                           30-Sep-2022 11:11                1822
class.gdfont.php                                   30-Sep-2022 11:10                1745
class.gdimage.php                                  30-Sep-2022 11:10                1742
class.gearmanclient.php                            30-Sep-2022 11:11               29662
class.gearmanexception.php                         30-Sep-2022 11:11                6642
class.gearmanjob.php                               30-Sep-2022 11:11                9843
class.gearmantask.php                              30-Sep-2022 11:11                8158
class.gearmanworker.php                            30-Sep-2022 11:11               11340
class.gender.php                                   30-Sep-2022 11:10               33012
class.generator.php                                30-Sep-2022 11:10                6857
class.globiterator.php                             30-Sep-2022 11:10               26169
class.gmagick.php                                  30-Sep-2022 11:10               75799
class.gmagickdraw.php                              30-Sep-2022 11:10               21459
class.gmagickpixel.php                             30-Sep-2022 11:10                5261
class.gmp.php                                      30-Sep-2022 11:10                3256
class.hashcontext.php                              30-Sep-2022 11:10                3236
class.hrtime-performancecounter.php                30-Sep-2022 11:10                3523
class.hrtime-stopwatch.php                         30-Sep-2022 11:10                6288
class.hrtime-unit.php                              30-Sep-2022 11:10                3857
class.imagick.php                                  30-Sep-2022 11:10              250165
class.imagickdraw.php                              30-Sep-2022 11:10               69017
class.imagickkernel.php                            30-Sep-2022 11:10                5624
class.imagickpixel.php                             30-Sep-2022 11:10               11352
class.imagickpixeliterator.php                     30-Sep-2022 11:10                8854
class.imap-connection.php                          30-Sep-2022 11:10                1829
class.infiniteiterator.php                         30-Sep-2022 11:10                5244
class.inflatecontext.php                           30-Sep-2022 11:10                1806
class.internaliterator.php                         30-Sep-2022 11:10                4865
class.intlbreakiterator.php                        30-Sep-2022 11:10               25900
class.intlcalendar.php                             30-Sep-2022 11:10               57648
class.intlchar.php                                 30-Sep-2022 11:10              340828
class.intlcodepointbreakiterator.php               30-Sep-2022 11:10               18401
class.intldateformatter.php                        30-Sep-2022 11:10               23908
class.intldatepatterngenerator.php                 30-Sep-2022 11:10                4092
class.intlexception.php                            30-Sep-2022 11:10                6815
class.intlgregoriancalendar.php                    30-Sep-2022 11:10               38873
class.intliterator.php                             30-Sep-2022 11:10                5070
class.intlpartsiterator.php                        30-Sep-2022 11:10                6738
class.intlrulebasedbreakiterator.php               30-Sep-2022 11:10               20876
class.intltimezone.php                             30-Sep-2022 11:10               18963
class.invalidargumentexception.php                 30-Sep-2022 11:11                6719
class.iterator.php                                 30-Sep-2022 11:10               12669
class.iteratoraggregate.php                        30-Sep-2022 11:10                7321
class.iteratoriterator.php                         30-Sep-2022 11:10                6117
class.jsonexception.php                            30-Sep-2022 11:10                7228
class.jsonserializable.php                         30-Sep-2022 11:10                2860
class.ldap-connection.php                          30-Sep-2022 11:11                1821
class.ldap-result-entry.php                        30-Sep-2022 11:11                1836
class.ldap-result.php                              30-Sep-2022 11:11                1813
class.lengthexception.php                          30-Sep-2022 11:11                6645
class.libxmlerror.php                              30-Sep-2022 11:11                5087
class.limititerator.php                            30-Sep-2022 11:11               11688
class.locale.php                                   30-Sep-2022 11:10               21172
class.logicexception.php                           30-Sep-2022 11:11                6705
class.lua.php                                      30-Sep-2022 11:10                7177
class.luaclosure.php                               30-Sep-2022 11:10                2621
class.luasandbox.php                               30-Sep-2022 11:10               12405
class.luasandboxerror.php                          30-Sep-2022 11:10                8678
class.luasandboxerrorerror.php                     30-Sep-2022 11:10                6717
class.luasandboxfatalerror.php                     30-Sep-2022 11:10                6839
class.luasandboxfunction.php                       30-Sep-2022 11:10                3627
class.luasandboxmemoryerror.php                    30-Sep-2022 11:10                7050
class.luasandboxruntimeerror.php                   30-Sep-2022 11:10                6859
class.luasandboxsyntaxerror.php                    30-Sep-2022 11:10                6721
class.luasandboxtimeouterror.php                   30-Sep-2022 11:10                7033
class.memcache.php                                 30-Sep-2022 11:11               15397
class.memcached.php                                30-Sep-2022 11:11               35708
class.memcachedexception.php                       30-Sep-2022 11:11                6600
class.messageformatter.php                         30-Sep-2022 11:10               11100
class.mongodb-bson-binary.php                      30-Sep-2022 11:10               13705
class.mongodb-bson-binaryinterface.php             30-Sep-2022 11:10                4478
class.mongodb-bson-dbpointer.php                   30-Sep-2022 11:10                5819
class.mongodb-bson-decimal128.php                  30-Sep-2022 11:10                7485
class.mongodb-bson-decimal128interface.php         30-Sep-2022 11:10                3723
class.mongodb-bson-int64.php                       30-Sep-2022 11:10                6550
class.mongodb-bson-javascript.php                  30-Sep-2022 11:10                8090
class.mongodb-bson-javascriptinterface.php         30-Sep-2022 11:10                4650
class.mongodb-bson-maxkey.php                      30-Sep-2022 11:10                5710
class.mongodb-bson-maxkeyinterface.php             30-Sep-2022 11:10                2144
class.mongodb-bson-minkey.php                      30-Sep-2022 11:10                5701
class.mongodb-bson-minkeyinterface.php             30-Sep-2022 11:10                2125
class.mongodb-bson-objectid.php                    30-Sep-2022 11:10                8811
class.mongodb-bson-objectidinterface.php           30-Sep-2022 11:10                4155
class.mongodb-bson-persistable.php                 30-Sep-2022 11:10                4524
class.mongodb-bson-regex.php                       30-Sep-2022 11:10                7742
class.mongodb-bson-regexinterface.php              30-Sep-2022 11:10                4495
class.mongodb-bson-serializable.php                30-Sep-2022 11:10                3765
class.mongodb-bson-symbol.php                      30-Sep-2022 11:10                5707
class.mongodb-bson-timestamp.php                   30-Sep-2022 11:10                7997
class.mongodb-bson-timestampinterface.php          30-Sep-2022 11:10                4657
class.mongodb-bson-type.php                        30-Sep-2022 11:10                1970
class.mongodb-bson-undefined.php                   30-Sep-2022 11:10                5795
class.mongodb-bson-unserializable.php              30-Sep-2022 11:10                3830
class.mongodb-bson-utcdatetime.php                 30-Sep-2022 11:10                7546
class.mongodb-bson-utcdatetimeinterface.php        30-Sep-2022 11:10                4286
class.mongodb-driver-bulkwrite.php                 30-Sep-2022 11:10               25907
class.mongodb-driver-clientencryption.php          30-Sep-2022 11:10               11824
class.mongodb-driver-command.php                   30-Sep-2022 11:10               15954
class.mongodb-driver-cursor.php                    30-Sep-2022 11:10               27600
class.mongodb-driver-cursorid.php                  30-Sep-2022 11:10                5297
class.mongodb-driver-cursorinterface.php           30-Sep-2022 11:10                5934
class.mongodb-driver-exception-authenticationex..> 30-Sep-2022 11:10                8094
class.mongodb-driver-exception-bulkwriteexcepti..> 30-Sep-2022 11:10                8948
class.mongodb-driver-exception-commandexception..> 30-Sep-2022 11:10                9734
class.mongodb-driver-exception-connectionexcept..> 30-Sep-2022 11:10                8163
class.mongodb-driver-exception-connectiontimeou..> 30-Sep-2022 11:10                8551
class.mongodb-driver-exception-encryptionexcept..> 30-Sep-2022 11:10                8097
class.mongodb-driver-exception-exception.php       30-Sep-2022 11:10                2139
class.mongodb-driver-exception-executiontimeout..> 30-Sep-2022 11:10                9208
class.mongodb-driver-exception-invalidargumente..> 30-Sep-2022 11:10                7300
class.mongodb-driver-exception-logicexception.php  30-Sep-2022 11:10                7184
class.mongodb-driver-exception-runtimeexception..> 30-Sep-2022 11:10               10609
class.mongodb-driver-exception-serverexception.php 30-Sep-2022 11:10                8174
class.mongodb-driver-exception-sslconnectionexc..> 30-Sep-2022 11:10                8440
class.mongodb-driver-exception-unexpectedvaluee..> 30-Sep-2022 11:10                7317
class.mongodb-driver-exception-writeexception.php  30-Sep-2022 11:10               11127
class.mongodb-driver-manager.php                   30-Sep-2022 11:10               19669
class.mongodb-driver-monitoring-commandfailedev..> 30-Sep-2022 11:10                7534
class.mongodb-driver-monitoring-commandstartede..> 30-Sep-2022 11:10                7036
class.mongodb-driver-monitoring-commandsubscrib..> 30-Sep-2022 11:10                6144
class.mongodb-driver-monitoring-commandsucceede..> 30-Sep-2022 11:10                7116
class.mongodb-driver-monitoring-sdamsubscriber.php 30-Sep-2022 11:10               11378
class.mongodb-driver-monitoring-serverchangedev..> 30-Sep-2022 11:10                5578
class.mongodb-driver-monitoring-serverclosedeve..> 30-Sep-2022 11:10                4225
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:10                5459
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:10                4344
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:10                5471
class.mongodb-driver-monitoring-serveropeningev..> 30-Sep-2022 11:10                4245
class.mongodb-driver-monitoring-subscriber.php     30-Sep-2022 11:10                2585
class.mongodb-driver-monitoring-topologychanged..> 30-Sep-2022 11:10                4691
class.mongodb-driver-monitoring-topologyclosede..> 30-Sep-2022 11:10                3302
class.mongodb-driver-monitoring-topologyopening..> 30-Sep-2022 11:10                3316
class.mongodb-driver-query.php                     30-Sep-2022 11:10                3118
class.mongodb-driver-readconcern.php               30-Sep-2022 11:10               16014
class.mongodb-driver-readpreference.php            30-Sep-2022 11:10               18162
class.mongodb-driver-server.php                    30-Sep-2022 11:10               23569
class.mongodb-driver-serverapi.php                 30-Sep-2022 11:10               15128
class.mongodb-driver-serverdescription.php         30-Sep-2022 11:10               14693
class.mongodb-driver-session.php                   30-Sep-2022 11:10               13712
class.mongodb-driver-topologydescription.php       30-Sep-2022 11:10               10197
class.mongodb-driver-writeconcern.php              30-Sep-2022 11:10                9097
class.mongodb-driver-writeconcernerror.php         30-Sep-2022 11:10                4100
class.mongodb-driver-writeerror.php                30-Sep-2022 11:10                4366
class.mongodb-driver-writeresult.php               30-Sep-2022 11:10                7835
class.multipleiterator.php                         30-Sep-2022 11:11               10222
class.mysql-xdevapi-baseresult.php                 30-Sep-2022 11:10                2883
class.mysql-xdevapi-client.php                     30-Sep-2022 11:10                3022
class.mysql-xdevapi-collection.php                 30-Sep-2022 11:10                9936
class.mysql-xdevapi-collectionadd.php              30-Sep-2022 11:10                2900
class.mysql-xdevapi-collectionfind.php             30-Sep-2022 11:10                8258
class.mysql-xdevapi-collectionmodify.php           30-Sep-2022 11:10                9415
class.mysql-xdevapi-collectionremove.php           30-Sep-2022 11:10                4998
class.mysql-xdevapi-columnresult.php               30-Sep-2022 11:10                6014
class.mysql-xdevapi-crudoperationbindable.php      30-Sep-2022 11:10                2878
class.mysql-xdevapi-crudoperationlimitable.php     30-Sep-2022 11:10                2884
class.mysql-xdevapi-crudoperationskippable.php     30-Sep-2022 11:10                2895
class.mysql-xdevapi-crudoperationsortable.php      30-Sep-2022 11:10                2869
class.mysql-xdevapi-databaseobject.php             30-Sep-2022 11:10                3381
class.mysql-xdevapi-docresult.php                  30-Sep-2022 11:10                3770
class.mysql-xdevapi-exception.php                  30-Sep-2022 11:10                2155
class.mysql-xdevapi-executable.php                 30-Sep-2022 11:10                2578
class.mysql-xdevapi-executionstatus.php            30-Sep-2022 11:10                4832
class.mysql-xdevapi-expression.php                 30-Sep-2022 11:10                3153
class.mysql-xdevapi-result.php                     30-Sep-2022 11:10                4096
class.mysql-xdevapi-rowresult.php                  30-Sep-2022 11:10                4693
class.mysql-xdevapi-schema.php                     30-Sep-2022 11:10                7163
class.mysql-xdevapi-schemaobject.php               30-Sep-2022 11:10                2763
class.mysql-xdevapi-session.php                    30-Sep-2022 11:10                8492
class.mysql-xdevapi-sqlstatement.php               30-Sep-2022 11:10                6207
class.mysql-xdevapi-sqlstatementresult.php         30-Sep-2022 11:10                6640
class.mysql-xdevapi-statement.php                  30-Sep-2022 11:10                4633
class.mysql-xdevapi-table.php                      30-Sep-2022 11:10                7316
class.mysql-xdevapi-tabledelete.php                30-Sep-2022 11:10                4903
class.mysql-xdevapi-tableinsert.php                30-Sep-2022 11:10                3402
class.mysql-xdevapi-tableselect.php                30-Sep-2022 11:10                7997
class.mysql-xdevapi-tableupdate.php                30-Sep-2022 11:10                5860
class.mysql-xdevapi-warning.php                    30-Sep-2022 11:10                3716
class.mysqli-driver.php                            30-Sep-2022 11:10                7612
class.mysqli-result.php                            30-Sep-2022 11:10               13601
class.mysqli-sql-exception.php                     30-Sep-2022 11:10                8138
class.mysqli-stmt.php                              30-Sep-2022 11:10               16362
class.mysqli-warning.php                           30-Sep-2022 11:10                4202
class.mysqli.php                                   30-Sep-2022 11:10               33129
class.norewinditerator.php                         30-Sep-2022 11:11                7114
class.normalizer.php                               30-Sep-2022 11:10                8463
class.numberformatter.php                          30-Sep-2022 11:10               40337
class.oauth.php                                    30-Sep-2022 11:11               17203
class.oauthexception.php                           30-Sep-2022 11:11                7654
class.oauthprovider.php                            30-Sep-2022 11:11               11559
class.ocicollection.php                            30-Sep-2022 11:10                6191
class.ocilob.php                                   30-Sep-2022 11:10               12472
class.opensslasymmetrickey.php                     30-Sep-2022 11:10                1912
class.opensslcertificate.php                       30-Sep-2022 11:10                1928
class.opensslcertificatesigningrequest.php         30-Sep-2022 11:10                2015
class.outeriterator.php                            30-Sep-2022 11:11                4329
class.outofboundsexception.php                     30-Sep-2022 11:11                6754
class.outofrangeexception.php                      30-Sep-2022 11:11                6756
class.overflowexception.php                        30-Sep-2022 11:11                6675
class.parallel-channel.php                         30-Sep-2022 11:10                7996
class.parallel-events-event-type.php               30-Sep-2022 11:10                3321
class.parallel-events-event.php                    30-Sep-2022 11:10                3296
class.parallel-events-input.php                    30-Sep-2022 11:10                4555
class.parallel-events.php                          30-Sep-2022 11:10                6667
class.parallel-future.php                          30-Sep-2022 11:10                8215
class.parallel-runtime.php                         30-Sep-2022 11:10                6144
class.parallel-sync.php                            30-Sep-2022 11:10                5219
class.parentiterator.php                           30-Sep-2022 11:11                9538
class.parle-errorinfo.php                          30-Sep-2022 11:11                3689
class.parle-lexer.php                              30-Sep-2022 11:11               11764
class.parle-lexerexception.php                     30-Sep-2022 11:11                6856
class.parle-parser.php                             30-Sep-2022 11:11               14703
class.parle-parserexception.php                    30-Sep-2022 11:11                6838
class.parle-rlexer.php                             30-Sep-2022 11:11               13405
class.parle-rparser.php                            30-Sep-2022 11:11               14854
class.parle-stack.php                              30-Sep-2022 11:11                4643
class.parle-token.php                              30-Sep-2022 11:11                4411
class.parseerror.php                               30-Sep-2022 11:10                7164
class.pdo.php                                      30-Sep-2022 11:10               13353
class.pdoexception.php                             30-Sep-2022 11:10                8524
class.pdostatement.php                             30-Sep-2022 11:10               20075
class.pgsql-connection.php                         30-Sep-2022 11:10                1844
class.pgsql-lob.php                                30-Sep-2022 11:10                1786
class.pgsql-result.php                             30-Sep-2022 11:10                1818
class.phar.php                                     30-Sep-2022 11:10               60253
class.phardata.php                                 30-Sep-2022 11:10               44398
class.pharexception.php                            30-Sep-2022 11:10                6644
class.pharfileinfo.php                             30-Sep-2022 11:10               18281
class.php-user-filter.php                          30-Sep-2022 11:11                6089
class.phptoken.php                                 30-Sep-2022 11:11                7991
class.pool.php                                     30-Sep-2022 11:10                7155
class.pspell-config.php                            30-Sep-2022 11:10                1820
class.pspell-dictionary.php                        30-Sep-2022 11:10                1857
class.quickhashinthash.php                         30-Sep-2022 11:11               12914
class.quickhashintset.php                          30-Sep-2022 11:11               11115
class.quickhashintstringhash.php                   30-Sep-2022 11:11               13728
class.quickhashstringinthash.php                   30-Sep-2022 11:11               11843
class.rangeexception.php                           30-Sep-2022 11:11                6884
class.rararchive.php                               30-Sep-2022 11:10                6940
class.rarentry.php                                 30-Sep-2022 11:10               41834
class.rarexception.php                             30-Sep-2022 11:10                7608
class.recursivearrayiterator.php                   30-Sep-2022 11:11               13695
class.recursivecachingiterator.php                 30-Sep-2022 11:11               13223
class.recursivecallbackfilteriterator.php          30-Sep-2022 11:11               14106
class.recursivedirectoryiterator.php               30-Sep-2022 11:11               29162
class.recursivefilteriterator.php                  30-Sep-2022 11:11                8363
class.recursiveiterator.php                        30-Sep-2022 11:11                4809
class.recursiveiteratoriterator.php                30-Sep-2022 11:11               13269
class.recursiveregexiterator.php                   30-Sep-2022 11:11               13255
class.recursivetreeiterator.php                    30-Sep-2022 11:11               22615
class.reflection.php                               30-Sep-2022 11:11                3259
class.reflectionattribute.php                      30-Sep-2022 11:11                6027
class.reflectionclass.php                          30-Sep-2022 11:11               32026
class.reflectionclassconstant.php                  30-Sep-2022 11:11               13452
class.reflectionenum.php                           30-Sep-2022 11:11               25898
class.reflectionenumbackedcase.php                 30-Sep-2022 11:11               11123
class.reflectionenumunitcase.php                   30-Sep-2022 11:11               10871
class.reflectionexception.php                      30-Sep-2022 11:11                6823
class.reflectionextension.php                      30-Sep-2022 11:11                9384
class.reflectionfiber.php                          30-Sep-2022 11:11                4757
class.reflectionfunction.php                       30-Sep-2022 11:11               17921
class.reflectionfunctionabstract.php               30-Sep-2022 11:11               17801
class.reflectiongenerator.php                      30-Sep-2022 11:11                6027
class.reflectionintersectiontype.php               30-Sep-2022 11:11                3332
class.reflectionmethod.php                         30-Sep-2022 11:11               27678
class.reflectionnamedtype.php                      30-Sep-2022 11:11                3588
class.reflectionobject.php                         30-Sep-2022 11:11               23573
class.reflectionparameter.php                      30-Sep-2022 11:11               14627
class.reflectionproperty.php                       30-Sep-2022 11:11               19263
class.reflectionreference.php                      30-Sep-2022 11:11                3874
class.reflectiontype.php                           30-Sep-2022 11:11                4481
class.reflectionuniontype.php                      30-Sep-2022 11:11                3218
class.reflectionzendextension.php                  30-Sep-2022 11:11                6721
class.reflector.php                                30-Sep-2022 11:11                3953
class.regexiterator.php                            30-Sep-2022 11:11               15439
class.resourcebundle.php                           30-Sep-2022 11:10                9374
class.rrdcreator.php                               30-Sep-2022 11:11                4025
class.rrdgraph.php                                 30-Sep-2022 11:11                3595
class.rrdupdater.php                               30-Sep-2022 11:11                3003
class.runtimeexception.php                         30-Sep-2022 11:11                6662
class.seaslog.php                                  30-Sep-2022 11:10               17882
class.seekableiterator.php                         30-Sep-2022 11:11               12750
class.serializable.php                             30-Sep-2022 11:10                8709
class.sessionhandler.php                           30-Sep-2022 11:11               27353
class.sessionhandlerinterface.php                  30-Sep-2022 11:11               16660
class.sessionidinterface.php                       30-Sep-2022 11:11                3143
class.sessionupdatetimestamphandlerinterface.php   30-Sep-2022 11:11                4212
class.shmop.php                                    30-Sep-2022 11:10                1718
class.simplexmlelement.php                         30-Sep-2022 11:11               13063
class.simplexmliterator.php                        30-Sep-2022 11:11               12631
class.snmp.php                                     30-Sep-2022 11:11               23820
class.snmpexception.php                            30-Sep-2022 11:11                7584
class.soapclient.php                               30-Sep-2022 11:11               29665
class.soapfault.php                                30-Sep-2022 11:11               12743
class.soapheader.php                               30-Sep-2022 11:11                5533
class.soapparam.php                                30-Sep-2022 11:11                3711
class.soapserver.php                               30-Sep-2022 11:11                9112
class.soapvar.php                                  30-Sep-2022 11:11                7026
class.socket.php                                   30-Sep-2022 11:11                1782
class.sodiumexception.php                          30-Sep-2022 11:10                6593
class.solrclient.php                               30-Sep-2022 11:11               21125
class.solrclientexception.php                      30-Sep-2022 11:11                8504
class.solrcollapsefunction.php                     30-Sep-2022 11:11               10430
class.solrdismaxquery.php                          30-Sep-2022 11:11               94832
class.solrdocument.php                             30-Sep-2022 11:11               20075
class.solrdocumentfield.php                        30-Sep-2022 11:11                4414
class.solrexception.php                            30-Sep-2022 11:11                8960
class.solrgenericresponse.php                      30-Sep-2022 11:11               10937
class.solrillegalargumentexception.php             30-Sep-2022 11:11                8628
class.solrillegaloperationexception.php            30-Sep-2022 11:11                8666
class.solrinputdocument.php                        30-Sep-2022 11:11               16592
class.solrmissingmandatoryparameterexception.php   30-Sep-2022 11:11                7856
class.solrmodifiableparams.php                     30-Sep-2022 11:11                7932
class.solrobject.php                               30-Sep-2022 11:11                5344
class.solrparams.php                               30-Sep-2022 11:11                8089
class.solrpingresponse.php                         30-Sep-2022 11:11               10100
class.solrquery.php                                30-Sep-2022 11:11              104042
class.solrqueryresponse.php                        30-Sep-2022 11:11               10864
class.solrresponse.php                             30-Sep-2022 11:11               12770
class.solrserverexception.php                      30-Sep-2022 11:11                8510
class.solrupdateresponse.php                       30-Sep-2022 11:11               10908
class.solrutils.php                                30-Sep-2022 11:11                4431
class.spldoublylinkedlist.php                      30-Sep-2022 11:10               16279
class.splfileinfo.php                              30-Sep-2022 11:11               15504
class.splfileobject.php                            30-Sep-2022 11:11               30408
class.splfixedarray.php                            30-Sep-2022 11:10               17174
class.splheap.php                                  30-Sep-2022 11:10                7579
class.splmaxheap.php                               30-Sep-2022 11:10                7000
class.splminheap.php                               30-Sep-2022 11:10                7010
class.splobjectstorage.php                         30-Sep-2022 11:10               20105
class.splobserver.php                              30-Sep-2022 11:11                2816
class.splpriorityqueue.php                         30-Sep-2022 11:10                9388
class.splqueue.php                                 30-Sep-2022 11:10               12311
class.splstack.php                                 30-Sep-2022 11:10               11341
class.splsubject.php                               30-Sep-2022 11:11                3635
class.spltempfileobject.php                        30-Sep-2022 11:11               25468
class.spoofchecker.php                             30-Sep-2022 11:10               13184
class.sqlite3.php                                  30-Sep-2022 11:10               15837
class.sqlite3result.php                            30-Sep-2022 11:10                5285
class.sqlite3stmt.php                              30-Sep-2022 11:10                7204
class.stomp.php                                    30-Sep-2022 11:11               16981
class.stompexception.php                           30-Sep-2022 11:11                5247
class.stompframe.php                               30-Sep-2022 11:11                4053
class.streamwrapper.php                            30-Sep-2022 11:11               17643
class.stringable.php                               30-Sep-2022 11:10                8919
class.svm.php                                      30-Sep-2022 11:11               15548
class.svmmodel.php                                 30-Sep-2022 11:11                6032
class.swoole-async.php                             30-Sep-2022 11:11                7048
class.swoole-atomic.php                            30-Sep-2022 11:11                4393
class.swoole-buffer.php                            30-Sep-2022 11:11                6505
class.swoole-channel.php                           30-Sep-2022 11:11                3710
class.swoole-client.php                            30-Sep-2022 11:11               14249
class.swoole-connection-iterator.php               30-Sep-2022 11:11                7033
class.swoole-coroutine.php                         30-Sep-2022 11:11               20031
class.swoole-event.php                             30-Sep-2022 11:11                6595
class.swoole-exception.php                         30-Sep-2022 11:11                4128
class.swoole-http-client.php                       30-Sep-2022 11:11               12890
class.swoole-http-request.php                      30-Sep-2022 11:11                2851
class.swoole-http-response.php                     30-Sep-2022 11:11                9459
class.swoole-http-server.php                       30-Sep-2022 11:11               21512
class.swoole-lock.php                              30-Sep-2022 11:11                4431
class.swoole-mmap.php                              30-Sep-2022 11:11                2839
class.swoole-mysql-exception.php                   30-Sep-2022 11:11                4169
class.swoole-mysql.php                             30-Sep-2022 11:11                5116
class.swoole-process.php                           30-Sep-2022 11:11               11852
class.swoole-redis-server.php                      30-Sep-2022 11:11               26083
class.swoole-serialize.php                         30-Sep-2022 11:11                3350
class.swoole-server.php                            30-Sep-2022 11:11               24755
class.swoole-table.php                             30-Sep-2022 11:11               10954
class.swoole-timer.php                             30-Sep-2022 11:11                4476
class.swoole-websocket-frame.php                   30-Sep-2022 11:11                1855
class.swoole-websocket-server.php                  30-Sep-2022 11:11                6990
class.syncevent.php                                30-Sep-2022 11:10                4283
class.syncmutex.php                                30-Sep-2022 11:10                3779
class.syncreaderwriter.php                         30-Sep-2022 11:10                4639
class.syncsemaphore.php                            30-Sep-2022 11:10                4095
class.syncsharedmemory.php                         30-Sep-2022 11:10                4938
class.sysvmessagequeue.php                         30-Sep-2022 11:10                1828
class.sysvsemaphore.php                            30-Sep-2022 11:10                1813
class.sysvsharedmemory.php                         30-Sep-2022 11:10                1816
class.thread.php                                   30-Sep-2022 11:10               10119
class.threaded.php                                 30-Sep-2022 11:10                8005
class.throwable.php                                30-Sep-2022 11:10                6946
class.tidy.php                                     30-Sep-2022 11:11               17873
class.tidynode.php                                 30-Sep-2022 11:11               10869
class.transliterator.php                           30-Sep-2022 11:10                8448
class.traversable.php                              30-Sep-2022 11:10                3812
class.typeerror.php                                30-Sep-2022 11:10                7652
class.uconverter.php                               30-Sep-2022 11:10               32281
class.ui-area.php                                  30-Sep-2022 11:11               11103
class.ui-control.php                               30-Sep-2022 11:11                5203
class.ui-controls-box.php                          30-Sep-2022 11:11                9123
class.ui-controls-button.php                       30-Sep-2022 11:11                6231
class.ui-controls-check.php                        30-Sep-2022 11:11                6957
class.ui-controls-colorbutton.php                  30-Sep-2022 11:11                6267
class.ui-controls-combo.php                        30-Sep-2022 11:11                6203
class.ui-controls-editablecombo.php                30-Sep-2022 11:11                6311
class.ui-controls-entry.php                        30-Sep-2022 11:11                8696
class.ui-controls-form.php                         30-Sep-2022 11:11                7319
class.ui-controls-grid.php                         30-Sep-2022 11:11               11284
class.ui-controls-group.php                        30-Sep-2022 11:11                7793
class.ui-controls-label.php                        30-Sep-2022 11:11                5982
class.ui-controls-multilineentry.php               30-Sep-2022 11:11                8979
class.ui-controls-picker.php                       30-Sep-2022 11:11                6860
class.ui-controls-progress.php                     30-Sep-2022 11:11                5547
class.ui-controls-radio.php                        30-Sep-2022 11:11                6182
class.ui-controls-separator.php                    30-Sep-2022 11:11                6478
class.ui-controls-slider.php                       30-Sep-2022 11:11                6514
class.ui-controls-spin.php                         30-Sep-2022 11:11                6384
class.ui-controls-tab.php                          30-Sep-2022 11:11                8244
class.ui-draw-brush-gradient.php                   30-Sep-2022 11:11                6325
class.ui-draw-brush-lineargradient.php             30-Sep-2022 11:11                5683
class.ui-draw-brush-radialgradient.php             30-Sep-2022 11:11                5811
class.ui-draw-brush.php                            30-Sep-2022 11:11                4173
class.ui-draw-color.php                            30-Sep-2022 11:11                7706
class.ui-draw-line-cap.php                         30-Sep-2022 11:11                2394
class.ui-draw-line-join.php                        30-Sep-2022 11:11                2354
class.ui-draw-matrix.php                           30-Sep-2022 11:11                5412
class.ui-draw-path.php                             30-Sep-2022 11:11                9439
class.ui-draw-pen.php                              30-Sep-2022 11:11                7920
class.ui-draw-stroke.php                           30-Sep-2022 11:11                6091
class.ui-draw-text-font-descriptor.php             30-Sep-2022 11:11                5365
class.ui-draw-text-font-italic.php                 30-Sep-2022 11:11                2584
class.ui-draw-text-font-stretch.php                30-Sep-2022 11:11                3983
class.ui-draw-text-font-weight.php                 30-Sep-2022 11:11                3962
class.ui-draw-text-font.php                        30-Sep-2022 11:11                4488
class.ui-draw-text-layout.php                      30-Sep-2022 11:11                4722
class.ui-exception-invalidargumentexception.php    30-Sep-2022 11:11                6870
class.ui-exception-runtimeexception.php            30-Sep-2022 11:11                6793
class.ui-executor.php                              30-Sep-2022 11:11                4823
class.ui-key.php                                   30-Sep-2022 11:11                9126
class.ui-menu.php                                  30-Sep-2022 11:11                5717
class.ui-menuitem.php                              30-Sep-2022 11:11                3549
class.ui-point.php                                 30-Sep-2022 11:11                5808
class.ui-size.php                                  30-Sep-2022 11:11                5909
class.ui-window.php                                30-Sep-2022 11:11               11801
class.underflowexception.php                       30-Sep-2022 11:11                6746
class.unexpectedvalueexception.php                 30-Sep-2022 11:11                6908
class.unhandledmatcherror.php                      30-Sep-2022 11:10                6654
class.unitenum.php                                 30-Sep-2022 11:10                2742
class.v8js.php                                     30-Sep-2022 11:11                7745
class.v8jsexception.php                            30-Sep-2022 11:11               10203
class.valueerror.php                               30-Sep-2022 11:10                6726
class.variant.php                                  30-Sep-2022 11:11                5877
class.varnishadmin.php                             30-Sep-2022 11:11                9877
class.varnishlog.php                               30-Sep-2022 11:11               28008
class.varnishstat.php                              30-Sep-2022 11:11                2800
class.volatile.php                                 30-Sep-2022 11:10               11552
class.vtiful-kernel-excel.php                      30-Sep-2022 11:10               10227
class.vtiful-kernel-format.php                     30-Sep-2022 11:10               13130
class.weakmap.php                                  30-Sep-2022 11:10                9577
class.weakreference.php                            30-Sep-2022 11:10                5554
class.win32serviceexception.php                    30-Sep-2022 11:11                6926
class.wkhtmltox-image-converter.php                30-Sep-2022 11:10                3772
class.wkhtmltox-pdf-converter.php                  30-Sep-2022 11:10                4149
class.wkhtmltox-pdf-object.php                     30-Sep-2022 11:10                2784
class.worker.php                                   30-Sep-2022 11:10                7643
class.xmldiff-base.php                             30-Sep-2022 11:11                4209
class.xmldiff-dom.php                              30-Sep-2022 11:11                5236
class.xmldiff-file.php                             30-Sep-2022 11:11                4852
class.xmldiff-memory.php                           30-Sep-2022 11:11                4884
class.xmlparser.php                                30-Sep-2022 11:11                1842
class.xmlreader.php                                30-Sep-2022 11:11               33195
class.xmlwriter.php                                30-Sep-2022 11:11               25968
class.xsltprocessor.php                            30-Sep-2022 11:11                9281
class.yac.php                                      30-Sep-2022 11:10                8355
class.yaconf.php                                   30-Sep-2022 11:11                3301
class.yaf-action-abstract.php                      30-Sep-2022 11:11               11557
class.yaf-application.php                          30-Sep-2022 11:11               12358
class.yaf-bootstrap-abstract.php                   30-Sep-2022 11:11                6152
class.yaf-config-abstract.php                      30-Sep-2022 11:11                5045
class.yaf-config-ini.php                           30-Sep-2022 11:11               16560
class.yaf-config-simple.php                        30-Sep-2022 11:11               11996
class.yaf-controller-abstract.php                  30-Sep-2022 11:11               18679
class.yaf-dispatcher.php                           30-Sep-2022 11:11               19344
class.yaf-exception-dispatchfailed.php             30-Sep-2022 11:11                2547
class.yaf-exception-loadfailed-action.php          30-Sep-2022 11:11                2618
class.yaf-exception-loadfailed-controller.php      30-Sep-2022 11:11                2643
class.yaf-exception-loadfailed-module.php          30-Sep-2022 11:11                2607
class.yaf-exception-loadfailed-view.php            30-Sep-2022 11:11                2547
class.yaf-exception-loadfailed.php                 30-Sep-2022 11:11                2521
class.yaf-exception-routerfailed.php               30-Sep-2022 11:11                2532
class.yaf-exception-startuperror.php               30-Sep-2022 11:11                2530
class.yaf-exception-typeerror.php                  30-Sep-2022 11:11                2501
class.yaf-exception.php                            30-Sep-2022 11:11                7546
class.yaf-loader.php                               30-Sep-2022 11:11               17965
class.yaf-plugin-abstract.php                      30-Sep-2022 11:11               18326
class.yaf-registry.php                             30-Sep-2022 11:11                5550
class.yaf-request-abstract.php                     30-Sep-2022 11:11               21233
class.yaf-request-http.php                         30-Sep-2022 11:11               20492
class.yaf-request-simple.php                       30-Sep-2022 11:11               19735
class.yaf-response-abstract.php                    30-Sep-2022 11:11               10497
class.yaf-route-interface.php                      30-Sep-2022 11:11                3415
class.yaf-route-map.php                            30-Sep-2022 11:11                6021
class.yaf-route-regex.php                          30-Sep-2022 11:11                7514
class.yaf-route-rewrite.php                        30-Sep-2022 11:11                6789
class.yaf-route-simple.php                         30-Sep-2022 11:11                6038
class.yaf-route-static.php                         30-Sep-2022 11:11                4650
class.yaf-route-supervar.php                       30-Sep-2022 11:11                4368
class.yaf-router.php                               30-Sep-2022 11:11               11695
class.yaf-session.php                              30-Sep-2022 11:11               11400
class.yaf-view-interface.php                       30-Sep-2022 11:11                5335
class.yaf-view-simple.php                          30-Sep-2022 11:11                9883
class.yar-client-exception.php                     30-Sep-2022 11:11                6015
class.yar-client.php                               30-Sep-2022 11:11                5457
class.yar-concurrent-client.php                    30-Sep-2022 11:11                6146
class.yar-server-exception.php                     30-Sep-2022 11:11                6475
class.yar-server.php                               30-Sep-2022 11:11                3288
class.ziparchive.php                               30-Sep-2022 11:10               39414
class.zmq.php                                      30-Sep-2022 11:11               32609
class.zmqcontext.php                               30-Sep-2022 11:11                5040
class.zmqdevice.php                                30-Sep-2022 11:11                6797
class.zmqpoll.php                                  30-Sep-2022 11:11                4665
class.zmqsocket.php                                30-Sep-2022 11:11                9964
class.zookeeper.php                                30-Sep-2022 11:11               46807
class.zookeeperauthenticationexception.php         30-Sep-2022 11:11                6800
class.zookeeperconfig.php                          30-Sep-2022 11:11                5383
class.zookeeperconnectionexception.php             30-Sep-2022 11:11                6795
class.zookeeperexception.php                       30-Sep-2022 11:11                6661
class.zookeepermarshallingexception.php            30-Sep-2022 11:11                6816
class.zookeepernonodeexception.php                 30-Sep-2022 11:11                6783
class.zookeeperoperationtimeoutexception.php       30-Sep-2022 11:11                6826
class.zookeepersessionexception.php                30-Sep-2022 11:11                6743
classobj.configuration.php                         30-Sep-2022 11:11                1271
classobj.constants.php                             30-Sep-2022 11:11                1158
classobj.examples.php                              30-Sep-2022 11:11               18274
classobj.installation.php                          30-Sep-2022 11:11                1234
classobj.requirements.php                          30-Sep-2022 11:11                1178
classobj.resources.php                             30-Sep-2022 11:11                1222
classobj.setup.php                                 30-Sep-2022 11:11                1575
closure.bind.php                                   30-Sep-2022 11:10                7787
closure.bindto.php                                 30-Sep-2022 11:10                8994
closure.call.php                                   30-Sep-2022 11:10                6559
closure.construct.php                              30-Sep-2022 11:10                2418
closure.fromcallable.php                           30-Sep-2022 11:10                3955
cmark.installation.php                             30-Sep-2022 11:11                1923
cmark.requirements.php                             30-Sep-2022 11:11                1260
cmark.setup.php                                    30-Sep-2022 11:11                1380
collator.asort.php                                 30-Sep-2022 11:10                9105
collator.compare.php                               30-Sep-2022 11:10               10674
collator.construct.php                             30-Sep-2022 11:10                5528
collator.create.php                                30-Sep-2022 11:10                5413
collator.getattribute.php                          30-Sep-2022 11:10                6004
collator.geterrorcode.php                          30-Sep-2022 11:10                5152
collator.geterrormessage.php                       30-Sep-2022 11:10                5204
collator.getlocale.php                             30-Sep-2022 11:10                6686
collator.getsortkey.php                            30-Sep-2022 11:10                6727
collator.getstrength.php                           30-Sep-2022 11:10                4905
collator.setattribute.php                          30-Sep-2022 11:10                6489
collator.setstrength.php                           30-Sep-2022 11:10               13263
collator.sort.php                                  30-Sep-2022 11:10                8088
collator.sortwithsortkeys.php                      30-Sep-2022 11:10                6404
collectable.isgarbage.php                          30-Sep-2022 11:10                2672
com.configuration.php                              30-Sep-2022 11:11                7986
com.constants.php                                  30-Sep-2022 11:11               18703
com.construct.php                                  30-Sep-2022 11:11                8218
com.error-handling.php                             30-Sep-2022 11:11                1511
com.examples.arrays.php                            30-Sep-2022 11:11                2116
com.examples.foreach.php                           30-Sep-2022 11:11                2887
com.examples.php                                   30-Sep-2022 11:11                1412
com.installation.php                               30-Sep-2022 11:11                1582
com.requirements.php                               30-Sep-2022 11:11                1255
com.resources.php                                  30-Sep-2022 11:11                1188
com.setup.php                                      30-Sep-2022 11:11                1532
commonmark-cql.construct.php                       30-Sep-2022 11:11                2125
commonmark-cql.invoke.php                          30-Sep-2022 11:11                3744
commonmark-interfaces-ivisitable.accept.php        30-Sep-2022 11:11                3113
commonmark-interfaces-ivisitor.enter.php           30-Sep-2022 11:11                4115
commonmark-interfaces-ivisitor.leave.php           30-Sep-2022 11:11                4117
commonmark-node-bulletlist.construct.php           30-Sep-2022 11:11                2973
commonmark-node-codeblock.construct.php            30-Sep-2022 11:11                2689
commonmark-node-heading.construct.php              30-Sep-2022 11:11                2530
commonmark-node-image.construct.php                30-Sep-2022 11:11                3072
commonmark-node-link.construct.php                 30-Sep-2022 11:11                3069
commonmark-node-orderedlist.construct.php          30-Sep-2022 11:11                3793
commonmark-node-text.construct.php                 30-Sep-2022 11:11                2573
commonmark-node.accept.php                         30-Sep-2022 11:11                2853
commonmark-node.appendchild.php                    30-Sep-2022 11:11                2676
commonmark-node.insertafter.php                    30-Sep-2022 11:11                2701
commonmark-node.insertbefore.php                   30-Sep-2022 11:11                2699
commonmark-node.prependchild.php                   30-Sep-2022 11:11                2703
commonmark-node.replace.php                        30-Sep-2022 11:11                2647
commonmark-node.unlink.php                         30-Sep-2022 11:11                2316
commonmark-parser.construct.php                    30-Sep-2022 11:11                3225
commonmark-parser.finish.php                       30-Sep-2022 11:11                2371
commonmark-parser.parse.php                        30-Sep-2022 11:11                2521
compersisthelper.construct.php                     30-Sep-2022 11:11                3546
compersisthelper.getcurfilename.php                30-Sep-2022 11:11                3022
compersisthelper.getmaxstreamsize.php              30-Sep-2022 11:11                3056
compersisthelper.initnew.php                       30-Sep-2022 11:11                2909
compersisthelper.loadfromfile.php                  30-Sep-2022 11:11                4015
compersisthelper.loadfromstream.php                30-Sep-2022 11:11                3282
compersisthelper.savetofile.php                    30-Sep-2022 11:11                5915
compersisthelper.savetostream.php                  30-Sep-2022 11:11                3309
componere-abstract-definition.addinterface.php     30-Sep-2022 11:10                3250
componere-abstract-definition.addmethod.php        30-Sep-2022 11:10                4017
componere-abstract-definition.addtrait.php         30-Sep-2022 11:10                3202
componere-abstract-definition.getreflector.php     30-Sep-2022 11:10                2360
componere-definition.addconstant.php               30-Sep-2022 11:10                4303
componere-definition.addproperty.php               30-Sep-2022 11:10                3712
componere-definition.construct.php                 30-Sep-2022 11:10                5456
componere-definition.getclosure.php                30-Sep-2022 11:10                3377
componere-definition.getclosures.php               30-Sep-2022 11:10                2621
componere-definition.isregistered.php              30-Sep-2022 11:10                2183
componere-definition.register.php                  30-Sep-2022 11:10                2400
componere-method.construct.php                     30-Sep-2022 11:10                2181
componere-method.getreflector.php                  30-Sep-2022 11:10                2163
componere-method.setprivate.php                    30-Sep-2022 11:10                2424
componere-method.setprotected.php                  30-Sep-2022 11:10                2439
componere-method.setstatic.php                     30-Sep-2022 11:10                2021
componere-patch.apply.php                          30-Sep-2022 11:10                1821
componere-patch.construct.php                      30-Sep-2022 11:10                3419
componere-patch.derive.php                         30-Sep-2022 11:10                3161
componere-patch.getclosure.php                     30-Sep-2022 11:10                2970
componere-patch.getclosures.php                    30-Sep-2022 11:10                2105
componere-patch.isapplied.php                      30-Sep-2022 11:10                1741
componere-patch.revert.php                         30-Sep-2022 11:10                1818
componere-value.construct.php                      30-Sep-2022 11:10                2614
componere-value.hasdefault.php                     30-Sep-2022 11:10                1790
componere-value.isprivate.php                      30-Sep-2022 11:10                1806
componere-value.isprotected.php                    30-Sep-2022 11:10                1816
componere-value.isstatic.php                       30-Sep-2022 11:10                1800
componere-value.setprivate.php                     30-Sep-2022 11:10                2446
componere-value.setprotected.php                   30-Sep-2022 11:10                2460
componere-value.setstatic.php                      30-Sep-2022 11:10                2037
componere.cast.php                                 30-Sep-2022 11:10                4894
componere.cast_by_ref.php                          30-Sep-2022 11:10                5059
componere.installation.php                         30-Sep-2022 11:10                1295
componere.requirements.php                         30-Sep-2022 11:10                1150
componere.setup.php                                30-Sep-2022 11:10                1419
configuration.changes.modes.php                    30-Sep-2022 11:10                3577
configuration.changes.php                          30-Sep-2022 11:10                8877
configuration.file.per-user.php                    30-Sep-2022 11:10                3092
configuration.file.php                             30-Sep-2022 11:10               10248
configuration.php                                  30-Sep-2022 11:10                1659
configure.about.php                                30-Sep-2022 11:11               13004
configure.php                                      30-Sep-2022 11:11                1432
context.curl.php                                   30-Sep-2022 11:10                8986
context.ftp.php                                    30-Sep-2022 11:10                4193
context.http.php                                   30-Sep-2022 11:10               15906
context.params.php                                 30-Sep-2022 11:10                2468
context.phar.php                                   30-Sep-2022 11:10                2847
context.php                                        30-Sep-2022 11:10                3031
context.socket.php                                 30-Sep-2022 11:10               10209
context.ssl.php                                    30-Sep-2022 11:10               11204
context.zip.php                                    30-Sep-2022 11:10                4495
control-structures.alternative-syntax.php          30-Sep-2022 11:10                7397
control-structures.break.php                       30-Sep-2022 11:10                5445
control-structures.continue.php                    30-Sep-2022 11:10                7607
control-structures.declare.php                     30-Sep-2022 11:10               10740
control-structures.do.while.php                    30-Sep-2022 11:10                4888
control-structures.else.php                        30-Sep-2022 11:10                4884
control-structures.elseif.php                      30-Sep-2022 11:10                7873
control-structures.for.php                         30-Sep-2022 11:10               12538
control-structures.foreach.php                     30-Sep-2022 11:10               23151
control-structures.goto.php                        30-Sep-2022 11:10                7387
control-structures.if.php                          30-Sep-2022 11:10                4923
control-structures.intro.php                       30-Sep-2022 11:10                2472
control-structures.match.php                       30-Sep-2022 11:10               19647
control-structures.switch.php                      30-Sep-2022 11:10               21706
control-structures.while.php                       30-Sep-2022 11:10                5049
copyright.php                                      30-Sep-2022 11:10                2038
countable.count.php                                30-Sep-2022 11:11                5432
csprng.configuration.php                           30-Sep-2022 11:10                1257
csprng.constants.php                               30-Sep-2022 11:10                1142
csprng.installation.php                            30-Sep-2022 11:10                1220
csprng.requirements.php                            30-Sep-2022 11:10                1164
csprng.resources.php                               30-Sep-2022 11:10                1208
csprng.setup.php                                   30-Sep-2022 11:10                1549
ctype.configuration.php                            30-Sep-2022 11:11                1250
ctype.constants.php                                30-Sep-2022 11:11                1159
ctype.installation.php                             30-Sep-2022 11:11                1417
ctype.requirements.php                             30-Sep-2022 11:11                1176
ctype.resources.php                                30-Sep-2022 11:11                1201
ctype.setup.php                                    30-Sep-2022 11:11                1542
cubrid.configuration.php                           30-Sep-2022 11:10                1202
cubrid.constants.php                               30-Sep-2022 11:10               13783
cubrid.examples.php                                30-Sep-2022 11:10               21176
cubrid.installation.php                            30-Sep-2022 11:10                2025
cubrid.requirements.php                            30-Sep-2022 11:10                1226
cubrid.resources.php                               30-Sep-2022 11:10                3091
cubrid.setup.php                                   30-Sep-2022 11:10                1555
cubridmysql.cubrid.php                             30-Sep-2022 11:10                4902
curl.configuration.php                             30-Sep-2022 11:11                2433
curl.constants.php                                 30-Sep-2022 11:11              103291
curl.examples-basic.php                            30-Sep-2022 11:11                4686
curl.examples.php                                  30-Sep-2022 11:11                1353
curl.installation.php                              30-Sep-2022 11:11                2440
curl.requirements.php                              30-Sep-2022 11:11                1438
curl.resources.php                                 30-Sep-2022 11:11                1382
curl.setup.php                                     30-Sep-2022 11:11                1549
curlfile.construct.php                             30-Sep-2022 11:11               21011
curlfile.getfilename.php                           30-Sep-2022 11:11                2063
curlfile.getmimetype.php                           30-Sep-2022 11:11                2154
curlfile.getpostfilename.php                       30-Sep-2022 11:11                2123
curlfile.setmimetype.php                           30-Sep-2022 11:11                2434
curlfile.setpostfilename.php                       30-Sep-2022 11:11                2469
curlstringfile.construct.php                       30-Sep-2022 11:11                6867
dateinterval.construct.php                         30-Sep-2022 11:10               13218
dateinterval.createfromdatestring.php              30-Sep-2022 11:10               15498
dateinterval.format.php                            30-Sep-2022 11:10               14749
dateperiod.construct.php                           30-Sep-2022 11:10               18925
dateperiod.getdateinterval.php                     30-Sep-2022 11:10                4637
dateperiod.getenddate.php                          30-Sep-2022 11:10                7583
dateperiod.getrecurrences.php                      30-Sep-2022 11:10                2617
dateperiod.getstartdate.php                        30-Sep-2022 11:10                5073
datetime.add.php                                   30-Sep-2022 11:10                4911
datetime.configuration.php                         30-Sep-2022 11:10                5795
datetime.constants.php                             30-Sep-2022 11:10                2498
datetime.construct.php                             30-Sep-2022 11:10                4871
datetime.createfromformat.php                      30-Sep-2022 11:10                5286
datetime.createfromimmutable.php                   30-Sep-2022 11:10                4266
datetime.createfrominterface.php                   30-Sep-2022 11:10                4883
datetime.diff.php                                  30-Sep-2022 11:10               14777
datetime.examples-arithmetic.php                   30-Sep-2022 11:10               15989
datetime.examples.php                              30-Sep-2022 11:10                1391
datetime.format.php                                30-Sep-2022 11:10               22451
datetime.formats.compound.php                      30-Sep-2022 11:10               12015
datetime.formats.date.php                          30-Sep-2022 11:10               14355
datetime.formats.php                               30-Sep-2022 11:10                7194
datetime.formats.relative.php                      30-Sep-2022 11:10               16020
datetime.formats.time.php                          30-Sep-2022 11:10                7343
datetime.getlasterrors.php                         30-Sep-2022 11:10                3515
datetime.getoffset.php                             30-Sep-2022 11:10                8224
datetime.gettimestamp.php                          30-Sep-2022 11:10                6935
datetime.gettimezone.php                           30-Sep-2022 11:10                7690
datetime.installation.php                          30-Sep-2022 11:10                1628
datetime.modify.php                                30-Sep-2022 11:10               10390
datetime.requirements.php                          30-Sep-2022 11:10                1178
datetime.resources.php                             30-Sep-2022 11:10                1222
datetime.set-state.php                             30-Sep-2022 11:10                2765
datetime.setdate.php                               30-Sep-2022 11:10                5229
datetime.setisodate.php                            30-Sep-2022 11:10                5398
datetime.settime.php                               30-Sep-2022 11:10                6618
datetime.settimestamp.php                          30-Sep-2022 11:10                4859
datetime.settimezone.php                           30-Sep-2022 11:10                9405
datetime.setup.php                                 30-Sep-2022 11:10                1603
datetime.sub.php                                   30-Sep-2022 11:10                4844
datetime.wakeup.php                                30-Sep-2022 11:10                2915
datetimeimmutable.add.php                          30-Sep-2022 11:10               10784
datetimeimmutable.construct.php                    30-Sep-2022 11:10               18329
datetimeimmutable.createfromformat.php             30-Sep-2022 11:10               43868
datetimeimmutable.createfrominterface.php          30-Sep-2022 11:10                5147
datetimeimmutable.createfrommutable.php            30-Sep-2022 11:10                4425
datetimeimmutable.getlasterrors.php                30-Sep-2022 11:10                4913
datetimeimmutable.modify.php                       30-Sep-2022 11:10                8285
datetimeimmutable.set-state.php                    30-Sep-2022 11:10                2680
datetimeimmutable.setdate.php                      30-Sep-2022 11:10                9176
datetimeimmutable.setisodate.php                   30-Sep-2022 11:10               12877
datetimeimmutable.settime.php                      30-Sep-2022 11:10               12017
datetimeimmutable.settimestamp.php                 30-Sep-2022 11:10                5772
datetimeimmutable.settimezone.php                  30-Sep-2022 11:10                6030
datetimeimmutable.sub.php                          30-Sep-2022 11:10               10989
datetimezone.construct.php                         30-Sep-2022 11:10               10190
datetimezone.getlocation.php                       30-Sep-2022 11:10                5706
datetimezone.getname.php                           30-Sep-2022 11:10                3548
datetimezone.getoffset.php                         30-Sep-2022 11:10                7815
datetimezone.gettransitions.php                    30-Sep-2022 11:10               10958
datetimezone.listabbreviations.php                 30-Sep-2022 11:10                5912
datetimezone.listidentifiers.php                   30-Sep-2022 11:10               14161
dba.configuration.php                              30-Sep-2022 11:10                2234
dba.constants.php                                  30-Sep-2022 11:10                1905
dba.example.php                                    30-Sep-2022 11:10                6659
dba.examples.php                                   30-Sep-2022 11:10                1296
dba.installation.php                               30-Sep-2022 11:10                9443
dba.requirements.php                               30-Sep-2022 11:10                7174
dba.resources.php                                  30-Sep-2022 11:10                1455
dba.setup.php                                      30-Sep-2022 11:10                1536
dbase.configuration.php                            30-Sep-2022 11:10                1250
dbase.constants.php                                30-Sep-2022 11:10                3061
dbase.installation.php                             30-Sep-2022 11:10                1527
dbase.requirements.php                             30-Sep-2022 11:10                1157
dbase.resources.php                                30-Sep-2022 11:10                1467
dbase.setup.php                                    30-Sep-2022 11:10                1557
debugger-about.php                                 30-Sep-2022 11:11                1986
debugger.php                                       30-Sep-2022 11:11                1370
dio.configuration.php                              30-Sep-2022 11:10                1236
dio.constants.php                                  30-Sep-2022 11:10                7240
dio.installation.php                               30-Sep-2022 11:10                1936
dio.requirements.php                               30-Sep-2022 11:10                1143
dio.resources.php                                  30-Sep-2022 11:10                1333
dio.setup.php                                      30-Sep-2022 11:10                1532
dir.configuration.php                              30-Sep-2022 11:10                1236
dir.constants.php                                  30-Sep-2022 11:10                2185
dir.installation.php                               30-Sep-2022 11:10                1199
dir.requirements.php                               30-Sep-2022 11:10                1143
dir.resources.php                                  30-Sep-2022 11:10                1187
dir.setup.php                                      30-Sep-2022 11:10                1522
directory.close.php                                30-Sep-2022 11:10                2324
directory.read.php                                 30-Sep-2022 11:10                2389
directory.rewind.php                               30-Sep-2022 11:10                2340
directoryiterator.construct.php                    30-Sep-2022 11:10                5872
directoryiterator.current.php                      30-Sep-2022 11:10                6286
directoryiterator.getatime.php                     30-Sep-2022 11:10                5673
directoryiterator.getbasename.php                  30-Sep-2022 11:10                6755
directoryiterator.getctime.php                     30-Sep-2022 11:10                5791
directoryiterator.getextension.php                 30-Sep-2022 11:10                6110
directoryiterator.getfilename.php                  30-Sep-2022 11:10                5393
directoryiterator.getgroup.php                     30-Sep-2022 11:10                5827
directoryiterator.getinode.php                     30-Sep-2022 11:10                4676
directoryiterator.getmtime.php                     30-Sep-2022 11:10                5693
directoryiterator.getowner.php                     30-Sep-2022 11:10                5244
directoryiterator.getpath.php                      30-Sep-2022 11:10                4793
directoryiterator.getpathname.php                  30-Sep-2022 11:10                5188
directoryiterator.getperms.php                     30-Sep-2022 11:10                6095
directoryiterator.getsize.php                      30-Sep-2022 11:10                4936
directoryiterator.gettype.php                      30-Sep-2022 11:10                5725
directoryiterator.isdir.php                        30-Sep-2022 11:10                5569
directoryiterator.isdot.php                        30-Sep-2022 11:10                5803
directoryiterator.isexecutable.php                 30-Sep-2022 11:10                5454
directoryiterator.isfile.php                       30-Sep-2022 11:10                5724
directoryiterator.islink.php                       30-Sep-2022 11:10                7363
directoryiterator.isreadable.php                   30-Sep-2022 11:10                5306
directoryiterator.iswritable.php                   30-Sep-2022 11:10                5482
directoryiterator.key.php                          30-Sep-2022 11:10                6686
directoryiterator.next.php                         30-Sep-2022 11:10                5503
directoryiterator.rewind.php                       30-Sep-2022 11:10                5424
directoryiterator.seek.php                         30-Sep-2022 11:10                5339
directoryiterator.tostring.php                     30-Sep-2022 11:10                4606
directoryiterator.valid.php                        30-Sep-2022 11:10                5730
doc.changelog.php                                  30-Sep-2022 11:11              287341
dom.configuration.php                              30-Sep-2022 11:11                1236
dom.constants.php                                  30-Sep-2022 11:11               14593
dom.examples.php                                   30-Sep-2022 11:11                2966
dom.installation.php                               30-Sep-2022 11:11                1257
dom.requirements.php                               30-Sep-2022 11:11                1431
dom.resources.php                                  30-Sep-2022 11:11                1187
dom.setup.php                                      30-Sep-2022 11:11                1526
domattr.construct.php                              30-Sep-2022 11:11                5625
domattr.isid.php                                   30-Sep-2022 11:11                5075
domcdatasection.construct.php                      30-Sep-2022 11:11                5228
domcharacterdata.appenddata.php                    30-Sep-2022 11:11                3701
domcharacterdata.deletedata.php                    30-Sep-2022 11:11                4757
domcharacterdata.insertdata.php                    30-Sep-2022 11:11                4514
domcharacterdata.replacedata.php                   30-Sep-2022 11:11                5248
domcharacterdata.substringdata.php                 30-Sep-2022 11:11                4795
domchildnode.after.php                             30-Sep-2022 11:11                3490
domchildnode.before.php                            30-Sep-2022 11:11                3303
domchildnode.remove.php                            30-Sep-2022 11:11                3097
domchildnode.replacewith.php                       30-Sep-2022 11:11                3756
domcomment.construct.php                           30-Sep-2022 11:11                5374
domdocument.construct.php                          30-Sep-2022 11:11                4451
domdocument.createattribute.php                    30-Sep-2022 11:11                5982
domdocument.createattributens.php                  30-Sep-2022 11:11                6683
domdocument.createcdatasection.php                 30-Sep-2022 11:11                5657
domdocument.createcomment.php                      30-Sep-2022 11:11                6056
domdocument.createdocumentfragment.php             30-Sep-2022 11:11                5948
domdocument.createelement.php                      30-Sep-2022 11:11               11497
domdocument.createelementns.php                    30-Sep-2022 11:11               14322
domdocument.createentityreference.php              30-Sep-2022 11:11                6293
domdocument.createprocessinginstruction.php        30-Sep-2022 11:11                6555
domdocument.createtextnode.php                     30-Sep-2022 11:11                6101
domdocument.getelementbyid.php                     30-Sep-2022 11:11                6120
domdocument.getelementsbytagname.php               30-Sep-2022 11:11                6140
domdocument.getelementsbytagnamens.php             30-Sep-2022 11:11                7688
domdocument.importnode.php                         30-Sep-2022 11:11                8927
domdocument.load.php                               30-Sep-2022 11:11                6185
domdocument.loadhtml.php                           30-Sep-2022 11:11                6832
domdocument.loadhtmlfile.php                       30-Sep-2022 11:11                6505
domdocument.loadxml.php                            30-Sep-2022 11:11                6944
domdocument.normalizedocument.php                  30-Sep-2022 11:11                2951
domdocument.registernodeclass.php                  30-Sep-2022 11:11               21448
domdocument.relaxngvalidate.php                    30-Sep-2022 11:11                3810
domdocument.relaxngvalidatesource.php              30-Sep-2022 11:11                3830
domdocument.save.php                               30-Sep-2022 11:11                7540
domdocument.savehtml.php                           30-Sep-2022 11:11                7484
domdocument.savehtmlfile.php                       30-Sep-2022 11:11                7956
domdocument.savexml.php                            30-Sep-2022 11:11                8887
domdocument.schemavalidate.php                     30-Sep-2022 11:11                4238
domdocument.schemavalidatesource.php               30-Sep-2022 11:11                4242
domdocument.validate.php                           30-Sep-2022 11:11                5943
domdocument.xinclude.php                           30-Sep-2022 11:11                7548
domdocumentfragment.appendxml.php                  30-Sep-2022 11:11                5631
domdocumentfragment.construct.php                  30-Sep-2022 11:11                2074
domelement.construct.php                           30-Sep-2022 11:11                6847
domelement.getattribute.php                        30-Sep-2022 11:11                4067
domelement.getattributenode.php                    30-Sep-2022 11:11                3998
domelement.getattributenodens.php                  30-Sep-2022 11:11                4429
domelement.getattributens.php                      30-Sep-2022 11:11                3922
domelement.getelementsbytagname.php                30-Sep-2022 11:11                3472
domelement.getelementsbytagnamens.php              30-Sep-2022 11:11                4413
domelement.hasattribute.php                        30-Sep-2022 11:11                3719
domelement.hasattributens.php                      30-Sep-2022 11:11                4145
domelement.removeattribute.php                     30-Sep-2022 11:11                3819
domelement.removeattributenode.php                 30-Sep-2022 11:11                4402
domelement.removeattributens.php                   30-Sep-2022 11:11                4363
domelement.setattribute.php                        30-Sep-2022 11:11                6050
domelement.setattributenode.php                    30-Sep-2022 11:11                4134
domelement.setattributenodens.php                  30-Sep-2022 11:11                4212
domelement.setattributens.php                      30-Sep-2022 11:11                4834
domelement.setidattribute.php                      30-Sep-2022 11:11                4574
domelement.setidattributenode.php                  30-Sep-2022 11:11                4699
domelement.setidattributens.php                    30-Sep-2022 11:11                4971
domentityreference.construct.php                   30-Sep-2022 11:11                5058
domimplementation.construct.php                    30-Sep-2022 11:11                2200
domimplementation.createdocument.php               30-Sep-2022 11:11                6977
domimplementation.createdocumenttype.php           30-Sep-2022 11:11                9367
domimplementation.hasfeature.php                   30-Sep-2022 11:11                9582
domnamednodemap.count.php                          30-Sep-2022 11:11                2349
domnamednodemap.getnameditem.php                   30-Sep-2022 11:11                3150
domnamednodemap.getnameditemns.php                 30-Sep-2022 11:11                3557
domnamednodemap.item.php                           30-Sep-2022 11:11                2862
domnode.appendchild.php                            30-Sep-2022 11:11                8735
domnode.c14n.php                                   30-Sep-2022 11:11                4607
domnode.c14nfile.php                               30-Sep-2022 11:11                4883
domnode.clonenode.php                              30-Sep-2022 11:11                2599
domnode.getlineno.php                              30-Sep-2022 11:11                4947
domnode.getnodepath.php                            30-Sep-2022 11:11                5146
domnode.hasattributes.php                          30-Sep-2022 11:11                2801
domnode.haschildnodes.php                          30-Sep-2022 11:11                2725
domnode.insertbefore.php                           30-Sep-2022 11:11                5167
domnode.isdefaultnamespace.php                     30-Sep-2022 11:11                2740
domnode.issamenode.php                             30-Sep-2022 11:11                2601
domnode.issupported.php                            30-Sep-2022 11:11                3599
domnode.lookupnamespaceuri.php                     30-Sep-2022 11:11                3052
domnode.lookupprefix.php                           30-Sep-2022 11:11                3076
domnode.normalize.php                              30-Sep-2022 11:11                2782
domnode.removechild.php                            30-Sep-2022 11:11                6892
domnode.replacechild.php                           30-Sep-2022 11:11                5658
domnodelist.count.php                              30-Sep-2022 11:11                2268
domnodelist.item.php                               30-Sep-2022 11:11                6832
domparentnode.append.php                           30-Sep-2022 11:11                2994
domparentnode.prepend.php                          30-Sep-2022 11:11                3027
domprocessinginstruction.construct.php             30-Sep-2022 11:11                6595
domtext.construct.php                              30-Sep-2022 11:11                4910
domtext.iselementcontentwhitespace.php             30-Sep-2022 11:11                2601
domtext.iswhitespaceinelementcontent.php           30-Sep-2022 11:11                2645
domtext.splittext.php                              30-Sep-2022 11:11                3062
domxpath.construct.php                             30-Sep-2022 11:11                2871
domxpath.evaluate.php                              30-Sep-2022 11:11                7368
domxpath.query.php                                 30-Sep-2022 11:11               12207
domxpath.registernamespace.php                     30-Sep-2022 11:11                3129
domxpath.registerphpfunctions.php                  30-Sep-2022 11:11               14186
dotnet.construct.php                               30-Sep-2022 11:11                2822
ds-collection.clear.php                            30-Sep-2022 11:11                3955
ds-collection.copy.php                             30-Sep-2022 11:11                4402
ds-collection.isempty.php                          30-Sep-2022 11:11                4245
ds-collection.toarray.php                          30-Sep-2022 11:11                4020
ds-deque.allocate.php                              30-Sep-2022 11:11                4616
ds-deque.apply.php                                 30-Sep-2022 11:11                5090
ds-deque.capacity.php                              30-Sep-2022 11:11                3917
ds-deque.clear.php                                 30-Sep-2022 11:11                3837
ds-deque.construct.php                             30-Sep-2022 11:11                4366
ds-deque.contains.php                              30-Sep-2022 11:11                7523
ds-deque.copy.php                                  30-Sep-2022 11:11                4229
ds-deque.count.php                                 30-Sep-2022 11:11                1529
ds-deque.filter.php                                30-Sep-2022 11:11                7532
ds-deque.find.php                                  30-Sep-2022 11:11                5494
ds-deque.first.php                                 30-Sep-2022 11:11                3832
ds-deque.get.php                                   30-Sep-2022 11:11                6696
ds-deque.insert.php                                30-Sep-2022 11:11                7034
ds-deque.isempty.php                               30-Sep-2022 11:11                4092
ds-deque.join.php                                  30-Sep-2022 11:11                5771
ds-deque.jsonserialize.php                         30-Sep-2022 11:11                1814
ds-deque.last.php                                  30-Sep-2022 11:11                3820
ds-deque.map.php                                   30-Sep-2022 11:11                5474
ds-deque.merge.php                                 30-Sep-2022 11:11                4905
ds-deque.pop.php                                   30-Sep-2022 11:11                4317
ds-deque.push.php                                  30-Sep-2022 11:11                4723
ds-deque.reduce.php                                30-Sep-2022 11:11                8699
ds-deque.remove.php                                30-Sep-2022 11:11                4890
ds-deque.reverse.php                               30-Sep-2022 11:11                3673
ds-deque.reversed.php                              30-Sep-2022 11:11                4049
ds-deque.rotate.php                                30-Sep-2022 11:11                5100
ds-deque.set.php                                   30-Sep-2022 11:11                6162
ds-deque.shift.php                                 30-Sep-2022 11:11                4418
ds-deque.slice.php                                 30-Sep-2022 11:11                7249
ds-deque.sort.php                                  30-Sep-2022 11:11                7469
ds-deque.sorted.php                                30-Sep-2022 11:11                7526
ds-deque.sum.php                                   30-Sep-2022 11:11                5149
ds-deque.toarray.php                               30-Sep-2022 11:11                3871
ds-deque.unshift.php                               30-Sep-2022 11:11                4808
ds-hashable.equals.php                             30-Sep-2022 11:11                3399
ds-hashable.hash.php                               30-Sep-2022 11:11                8535
ds-map.allocate.php                                30-Sep-2022 11:11                4482
ds-map.apply.php                                   30-Sep-2022 11:11                5862
ds-map.capacity.php                                30-Sep-2022 11:11                3202
ds-map.clear.php                                   30-Sep-2022 11:11                4393
ds-map.construct.php                               30-Sep-2022 11:11                4898
ds-map.copy.php                                    30-Sep-2022 11:11                4159
ds-map.count.php                                   30-Sep-2022 11:11                1490
ds-map.diff.php                                    30-Sep-2022 11:11                5655
ds-map.filter.php                                  30-Sep-2022 11:11                8397
ds-map.first.php                                   30-Sep-2022 11:11                4120
ds-map.get.php                                     30-Sep-2022 11:11                8717
ds-map.haskey.php                                  30-Sep-2022 11:11                4649
ds-map.hasvalue.php                                30-Sep-2022 11:11                4693
ds-map.intersect.php                               30-Sep-2022 11:11                6181
ds-map.isempty.php                                 30-Sep-2022 11:11                4344
ds-map.jsonserialize.php                           30-Sep-2022 11:11                1792
ds-map.keys.php                                    30-Sep-2022 11:11                3996
ds-map.ksort.php                                   30-Sep-2022 11:11                8201
ds-map.ksorted.php                                 30-Sep-2022 11:11                8320
ds-map.last.php                                    30-Sep-2022 11:11                4105
ds-map.map.php                                     30-Sep-2022 11:11                6514
ds-map.merge.php                                   30-Sep-2022 11:11                5819
ds-map.pairs.php                                   30-Sep-2022 11:11                4387
ds-map.put.php                                     30-Sep-2022 11:11               14886
ds-map.putall.php                                  30-Sep-2022 11:11                5459
ds-map.reduce.php                                  30-Sep-2022 11:11                9749
ds-map.remove.php                                  30-Sep-2022 11:11                7141
ds-map.reverse.php                                 30-Sep-2022 11:11                4155
ds-map.reversed.php                                30-Sep-2022 11:11                4289
ds-map.skip.php                                    30-Sep-2022 11:11                4614
ds-map.slice.php                                   30-Sep-2022 11:11                8150
ds-map.sort.php                                    30-Sep-2022 11:11                8119
ds-map.sorted.php                                  30-Sep-2022 11:11                8299
ds-map.sum.php                                     30-Sep-2022 11:11                5676
ds-map.toarray.php                                 30-Sep-2022 11:11                4830
ds-map.union.php                                   30-Sep-2022 11:11                6165
ds-map.values.php                                  30-Sep-2022 11:11                3990
ds-map.xor.php                                     30-Sep-2022 11:11                5717
ds-pair.clear.php                                  30-Sep-2022 11:11                3733
ds-pair.construct.php                              30-Sep-2022 11:11                2634
ds-pair.copy.php                                   30-Sep-2022 11:11                4148
ds-pair.isempty.php                                30-Sep-2022 11:11                4037
ds-pair.jsonserialize.php                          30-Sep-2022 11:11                1812
ds-pair.toarray.php                                30-Sep-2022 11:11                3796
ds-priorityqueue.allocate.php                      30-Sep-2022 11:11                4782
ds-priorityqueue.capacity.php                      30-Sep-2022 11:11                3411
ds-priorityqueue.clear.php                         30-Sep-2022 11:11                4504
ds-priorityqueue.construct.php                     30-Sep-2022 11:11                2942
ds-priorityqueue.copy.php                          30-Sep-2022 11:11                4532
ds-priorityqueue.count.php                         30-Sep-2022 11:11                1638
ds-priorityqueue.isempty.php                       30-Sep-2022 11:11                5012
ds-priorityqueue.jsonserialize.php                 30-Sep-2022 11:11                1932
ds-priorityqueue.peek.php                          30-Sep-2022 11:11                4820
ds-priorityqueue.pop.php                           30-Sep-2022 11:11                5595
ds-priorityqueue.push.php                          30-Sep-2022 11:11                5605
ds-priorityqueue.toarray.php                       30-Sep-2022 11:11                4985
ds-queue.allocate.php                              30-Sep-2022 11:11                4814
ds-queue.capacity.php                              30-Sep-2022 11:11                3923
ds-queue.clear.php                                 30-Sep-2022 11:11                3822
ds-queue.construct.php                             30-Sep-2022 11:11                4364
ds-queue.copy.php                                  30-Sep-2022 11:11                4366
ds-queue.count.php                                 30-Sep-2022 11:11                1526
ds-queue.isempty.php                               30-Sep-2022 11:11                4108
ds-queue.jsonserialize.php                         30-Sep-2022 11:11                1820
ds-queue.peek.php                                  30-Sep-2022 11:11                4404
ds-queue.pop.php                                   30-Sep-2022 11:11                4938
ds-queue.push.php                                  30-Sep-2022 11:11                4758
ds-queue.toarray.php                               30-Sep-2022 11:11                4036
ds-sequence.allocate.php                           30-Sep-2022 11:11                4515
ds-sequence.apply.php                              30-Sep-2022 11:11                5205
ds-sequence.capacity.php                           30-Sep-2022 11:11                4482
ds-sequence.contains.php                           30-Sep-2022 11:11                7650
ds-sequence.filter.php                             30-Sep-2022 11:11                7671
ds-sequence.find.php                               30-Sep-2022 11:11                5606
ds-sequence.first.php                              30-Sep-2022 11:11                3947
ds-sequence.get.php                                30-Sep-2022 11:11                6824
ds-sequence.insert.php                             30-Sep-2022 11:11                7153
ds-sequence.join.php                               30-Sep-2022 11:11                5867
ds-sequence.last.php                               30-Sep-2022 11:11                3914
ds-sequence.map.php                                30-Sep-2022 11:11                5603
ds-sequence.merge.php                              30-Sep-2022 11:11                5031
ds-sequence.pop.php                                30-Sep-2022 11:11                4429
ds-sequence.push.php                               30-Sep-2022 11:11                4845
ds-sequence.reduce.php                             30-Sep-2022 11:11                8818
ds-sequence.remove.php                             30-Sep-2022 11:11                5002
ds-sequence.reverse.php                            30-Sep-2022 11:11                3786
ds-sequence.reversed.php                           30-Sep-2022 11:11                4172
ds-sequence.rotate.php                             30-Sep-2022 11:11                5237
ds-sequence.set.php                                30-Sep-2022 11:11                6286
ds-sequence.shift.php                              30-Sep-2022 11:11                4530
ds-sequence.slice.php                              30-Sep-2022 11:11                7414
ds-sequence.sort.php                               30-Sep-2022 11:11                7596
ds-sequence.sorted.php                             30-Sep-2022 11:11                7653
ds-sequence.sum.php                                30-Sep-2022 11:11                5274
ds-sequence.unshift.php                            30-Sep-2022 11:11                4919
ds-set.add.php                                     30-Sep-2022 11:11               13065
ds-set.allocate.php                                30-Sep-2022 11:11                4495
ds-set.capacity.php                                30-Sep-2022 11:11                3876
ds-set.clear.php                                   30-Sep-2022 11:11                3768
ds-set.construct.php                               30-Sep-2022 11:11                4318
ds-set.contains.php                                30-Sep-2022 11:11                7482
ds-set.copy.php                                    30-Sep-2022 11:11                4305
ds-set.count.php                                   30-Sep-2022 11:11                1490
ds-set.diff.php                                    30-Sep-2022 11:11                4885
ds-set.filter.php                                  30-Sep-2022 11:11                7480
ds-set.first.php                                   30-Sep-2022 11:11                3785
ds-set.get.php                                     30-Sep-2022 11:11                6640
ds-set.intersect.php                               30-Sep-2022 11:11                5116
ds-set.isempty.php                                 30-Sep-2022 11:11                4050
ds-set.join.php                                    30-Sep-2022 11:11                5717
ds-set.jsonserialize.php                           30-Sep-2022 11:11                1786
ds-set.last.php                                    30-Sep-2022 11:11                3786
ds-set.merge.php                                   30-Sep-2022 11:11                4831
ds-set.reduce.php                                  30-Sep-2022 11:11                8645
ds-set.remove.php                                  30-Sep-2022 11:11                5234
ds-set.reverse.php                                 30-Sep-2022 11:11                3621
ds-set.reversed.php                                30-Sep-2022 11:11                3987
ds-set.slice.php                                   30-Sep-2022 11:11                7163
ds-set.sort.php                                    30-Sep-2022 11:11                7405
ds-set.sorted.php                                  30-Sep-2022 11:11                7462
ds-set.sum.php                                     30-Sep-2022 11:11                5089
ds-set.toarray.php                                 30-Sep-2022 11:11                3817
ds-set.union.php                                   30-Sep-2022 11:11                5079
ds-set.xor.php                                     30-Sep-2022 11:11                5051
ds-stack.allocate.php                              30-Sep-2022 11:11                2722
ds-stack.capacity.php                              30-Sep-2022 11:11                2076
ds-stack.clear.php                                 30-Sep-2022 11:11                3818
ds-stack.construct.php                             30-Sep-2022 11:11                4330
ds-stack.copy.php                                  30-Sep-2022 11:11                4366
ds-stack.count.php                                 30-Sep-2022 11:11                1526
ds-stack.isempty.php                               30-Sep-2022 11:11                4108
ds-stack.jsonserialize.php                         30-Sep-2022 11:11                1820
ds-stack.peek.php                                  30-Sep-2022 11:11                4398
ds-stack.pop.php                                   30-Sep-2022 11:11                4932
ds-stack.push.php                                  30-Sep-2022 11:11                4758
ds-stack.toarray.php                               30-Sep-2022 11:11                3858
ds-vector.allocate.php                             30-Sep-2022 11:11                4432
ds-vector.apply.php                                30-Sep-2022 11:11                5116
ds-vector.capacity.php                             30-Sep-2022 11:11                4387
ds-vector.clear.php                                30-Sep-2022 11:11                3849
ds-vector.construct.php                            30-Sep-2022 11:11                4398
ds-vector.contains.php                             30-Sep-2022 11:11                7553
ds-vector.copy.php                                 30-Sep-2022 11:11                4390
ds-vector.count.php                                30-Sep-2022 11:11                1543
ds-vector.filter.php                               30-Sep-2022 11:11                7566
ds-vector.find.php                                 30-Sep-2022 11:11                5519
ds-vector.first.php                                30-Sep-2022 11:11                3858
ds-vector.get.php                                  30-Sep-2022 11:11                6727
ds-vector.insert.php                               30-Sep-2022 11:11                7064
ds-vector.isempty.php                              30-Sep-2022 11:11                4116
ds-vector.join.php                                 30-Sep-2022 11:11                5798
ds-vector.jsonserialize.php                        30-Sep-2022 11:11                1828
ds-vector.last.php                                 30-Sep-2022 11:11                3845
ds-vector.map.php                                  30-Sep-2022 11:11                5506
ds-vector.merge.php                                30-Sep-2022 11:11                4936
ds-vector.pop.php                                  30-Sep-2022 11:11                4342
ds-vector.push.php                                 30-Sep-2022 11:11                4752
ds-vector.reduce.php                               30-Sep-2022 11:11                8727
ds-vector.remove.php                               30-Sep-2022 11:11                4915
ds-vector.reverse.php                              30-Sep-2022 11:11                3699
ds-vector.reversed.php                             30-Sep-2022 11:11                4079
ds-vector.rotate.php                               30-Sep-2022 11:11                5134
ds-vector.set.php                                  30-Sep-2022 11:11                6193
ds-vector.shift.php                                30-Sep-2022 11:11                4443
ds-vector.slice.php                                30-Sep-2022 11:11                7295
ds-vector.sort.php                                 30-Sep-2022 11:11                7501
ds-vector.sorted.php                               30-Sep-2022 11:11                7558
ds-vector.sum.php                                  30-Sep-2022 11:11                5179
ds-vector.toarray.php                              30-Sep-2022 11:11                3896
ds-vector.unshift.php                              30-Sep-2022 11:11                4838
ds.constants.php                                   30-Sep-2022 11:11                1107
ds.examples.php                                    30-Sep-2022 11:11                4900
ds.installation.php                                30-Sep-2022 11:11                2462
ds.requirements.php                                30-Sep-2022 11:11                1151
ds.setup.php                                       30-Sep-2022 11:11                1356
eio.configuration.php                              30-Sep-2022 11:10                1234
eio.constants.php                                  30-Sep-2022 11:10               16108
eio.examples.php                                   30-Sep-2022 11:10               29478
eio.installation.php                               30-Sep-2022 11:10                1661
eio.requirements.php                               30-Sep-2022 11:10                1271
eio.resources.php                                  30-Sep-2022 11:10                1221
eio.setup.php                                      30-Sep-2022 11:10                1538
emptyiterator.current.php                          30-Sep-2022 11:10                2655
emptyiterator.key.php                              30-Sep-2022 11:10                2619
emptyiterator.next.php                             30-Sep-2022 11:10                2316
emptyiterator.rewind.php                           30-Sep-2022 11:10                2338
emptyiterator.valid.php                            30-Sep-2022 11:10                2320
enchant.configuration.php                          30-Sep-2022 11:10                1264
enchant.constants.php                              30-Sep-2022 11:10                2546
enchant.examples.php                               30-Sep-2022 11:10                5855
enchant.installation.php                           30-Sep-2022 11:10                3246
enchant.requirements.php                           30-Sep-2022 11:10                1754
enchant.resources.php                              30-Sep-2022 11:10                1328
enchant.setup.php                                  30-Sep-2022 11:10                1583
error.clone.php                                    30-Sep-2022 11:10                2782
error.construct.php                                30-Sep-2022 11:10                3206
error.getcode.php                                  30-Sep-2022 11:10                4010
error.getfile.php                                  30-Sep-2022 11:10                3768
error.getline.php                                  30-Sep-2022 11:10                4038
error.getmessage.php                               30-Sep-2022 11:10                3858
error.getprevious.php                              30-Sep-2022 11:10                6898
error.gettrace.php                                 30-Sep-2022 11:10                4284
error.gettraceasstring.php                         30-Sep-2022 11:10                4149
error.tostring.php                                 30-Sep-2022 11:10                3816
errorexception.construct.php                       30-Sep-2022 11:10                5455
errorexception.getseverity.php                     30-Sep-2022 11:10                4374
errorfunc.configuration.php                        30-Sep-2022 11:10               24003
errorfunc.constants.php                            30-Sep-2022 11:10                9690
errorfunc.examples.php                             30-Sep-2022 11:10               24163
errorfunc.installation.php                         30-Sep-2022 11:10                1241
errorfunc.requirements.php                         30-Sep-2022 11:10                1185
errorfunc.resources.php                            30-Sep-2022 11:10                1229
errorfunc.setup.php                                30-Sep-2022 11:10                1593
ev.backend.php                                     30-Sep-2022 11:10                3403
ev.configuration.php                               30-Sep-2022 11:10                1229
ev.depth.php                                       30-Sep-2022 11:10                3181
ev.embeddablebackends.php                          30-Sep-2022 11:10                6939
ev.examples.php                                    30-Sep-2022 11:10               47765
ev.feedsignal.php                                  30-Sep-2022 11:10                3282
ev.feedsignalevent.php                             30-Sep-2022 11:10                3069
ev.global.constants.php                            30-Sep-2022 11:10                1278
ev.installation.php                                30-Sep-2022 11:10                1636
ev.iteration.php                                   30-Sep-2022 11:10                2555
ev.now.php                                         30-Sep-2022 11:10                3026
ev.nowupdate.php                                   30-Sep-2022 11:10                3155
ev.periodic-modes.php                              30-Sep-2022 11:10                7864
ev.recommendedbackends.php                         30-Sep-2022 11:10                7681
ev.requirements.php                                30-Sep-2022 11:10                1206
ev.resources.php                                   30-Sep-2022 11:10                1187
ev.resume.php                                      30-Sep-2022 11:10                3745
ev.run.php                                         30-Sep-2022 11:10                4776
ev.setup.php                                       30-Sep-2022 11:10                1493
ev.sleep.php                                       30-Sep-2022 11:10                2321
ev.stop.php                                        30-Sep-2022 11:10                2798
ev.supportedbackends.php                           30-Sep-2022 11:10                6921
ev.suspend.php                                     30-Sep-2022 11:10                3478
ev.time.php                                        30-Sep-2022 11:10                2600
ev.verify.php                                      30-Sep-2022 11:10                2215
ev.watcher-callbacks.php                           30-Sep-2022 11:10                4117
ev.watchers.php                                    30-Sep-2022 11:10                3463
evcheck.construct.php                              30-Sep-2022 11:10                3647
evcheck.createstopped.php                          30-Sep-2022 11:10                3518
evchild.construct.php                              30-Sep-2022 11:10                6431
evchild.createstopped.php                          30-Sep-2022 11:10                4958
evchild.set.php                                    30-Sep-2022 11:10                3063
evembed.construct.php                              30-Sep-2022 11:10                8485
evembed.createstopped.php                          30-Sep-2022 11:10                4688
evembed.set.php                                    30-Sep-2022 11:10                2443
evembed.sweep.php                                  30-Sep-2022 11:10                3026
event.add.php                                      30-Sep-2022 11:11               11095
event.addsignal.php                                30-Sep-2022 11:11                1645
event.addtimer.php                                 30-Sep-2022 11:11                1654
event.callbacks.php                                30-Sep-2022 11:11                5402
event.configuration.php                            30-Sep-2022 11:11                1250
event.construct.php                                30-Sep-2022 11:11                4756
event.constructing.signal.events.php               30-Sep-2022 11:11                6851
event.del.php                                      30-Sep-2022 11:11                2464
event.delsignal.php                                30-Sep-2022 11:11                1645
event.deltimer.php                                 30-Sep-2022 11:11                1642
event.examples.php                                 30-Sep-2022 11:11              198944
event.flags.php                                    30-Sep-2022 11:11                2324
event.free.php                                     30-Sep-2022 11:11                2930
event.getsupportedmethods.php                      30-Sep-2022 11:11                2597
event.installation.php                             30-Sep-2022 11:11                1663
event.pending.php                                  30-Sep-2022 11:11                2662
event.persistence.php                              30-Sep-2022 11:11                2752
event.requirements.php                             30-Sep-2022 11:11                1424
event.resources.php                                30-Sep-2022 11:11                1188
event.set.php                                      30-Sep-2022 11:11                4504
event.setpriority.php                              30-Sep-2022 11:11                2372
event.settimer.php                                 30-Sep-2022 11:11                4027
event.setup.php                                    30-Sep-2022 11:11                1532
event.signal.php                                   30-Sep-2022 11:11                4246
event.timer.php                                    30-Sep-2022 11:11                3570
eventbase.construct.php                            30-Sep-2022 11:11                2805
eventbase.dispatch.php                             30-Sep-2022 11:11                3208
eventbase.exit.php                                 30-Sep-2022 11:11                2891
eventbase.free.php                                 30-Sep-2022 11:11                3285
eventbase.getfeatures.php                          30-Sep-2022 11:11                5988
eventbase.getmethod.php                            30-Sep-2022 11:11                4610
eventbase.gettimeofdaycached.php                   30-Sep-2022 11:11                2631
eventbase.gotexit.php                              30-Sep-2022 11:11                3214
eventbase.gotstop.php                              30-Sep-2022 11:11                3186
eventbase.loop.php                                 30-Sep-2022 11:11                3450
eventbase.priorityinit.php                         30-Sep-2022 11:11                2868
eventbase.reinit.php                               30-Sep-2022 11:11                2228
eventbase.stop.php                                 30-Sep-2022 11:11                2732
eventbuffer.add.php                                30-Sep-2022 11:11                2867
eventbuffer.addbuffer.php                          30-Sep-2022 11:11                3279
eventbuffer.appendfrom.php                         30-Sep-2022 11:11                4881
eventbuffer.construct.php                          30-Sep-2022 11:11                2136
eventbuffer.copyout.php                            30-Sep-2022 11:11                3820
eventbuffer.drain.php                              30-Sep-2022 11:11                3359
eventbuffer.enablelocking.php                      30-Sep-2022 11:11                2864
eventbuffer.expand.php                             30-Sep-2022 11:11                2645
eventbuffer.freeze.php                             30-Sep-2022 11:11                2916
eventbuffer.lock.php                               30-Sep-2022 11:11                3006
eventbuffer.prepend.php                            30-Sep-2022 11:11                3372
eventbuffer.prependbuffer.php                      30-Sep-2022 11:11                3594
eventbuffer.pullup.php                             30-Sep-2022 11:11                4575
eventbuffer.read.php                               30-Sep-2022 11:11                4848
eventbuffer.readfrom.php                           30-Sep-2022 11:11                4327
eventbuffer.readline.php                           30-Sep-2022 11:11                4151
eventbuffer.search.php                             30-Sep-2022 11:11                8718
eventbuffer.searcheol.php                          30-Sep-2022 11:11                4655
eventbuffer.substr.php                             30-Sep-2022 11:11                3313
eventbuffer.unfreeze.php                           30-Sep-2022 11:11                2930
eventbuffer.unlock.php                             30-Sep-2022 11:11                2692
eventbuffer.write.php                              30-Sep-2022 11:11                3380
eventbufferevent.about.callbacks.php               30-Sep-2022 11:11                5612
eventbufferevent.close.php                         30-Sep-2022 11:11                2447
eventbufferevent.connect.php                       30-Sep-2022 11:11               27036
eventbufferevent.connecthost.php                   30-Sep-2022 11:11               18516
eventbufferevent.construct.php                     30-Sep-2022 11:11                6900
eventbufferevent.createpair.php                    30-Sep-2022 11:11                4043
eventbufferevent.disable.php                       30-Sep-2022 11:11                3166
eventbufferevent.enable.php                        30-Sep-2022 11:11                3430
eventbufferevent.free.php                          30-Sep-2022 11:11                2754
eventbufferevent.getdnserrorstring.php             30-Sep-2022 11:11                3065
eventbufferevent.getenabled.php                    30-Sep-2022 11:11                3031
eventbufferevent.getinput.php                      30-Sep-2022 11:11                5200
eventbufferevent.getoutput.php                     30-Sep-2022 11:11                8356
eventbufferevent.read.php                          30-Sep-2022 11:11                2981
eventbufferevent.readbuffer.php                    30-Sep-2022 11:11                3116
eventbufferevent.setcallbacks.php                  30-Sep-2022 11:11                4616
eventbufferevent.setpriority.php                   30-Sep-2022 11:11                2754
eventbufferevent.settimeouts.php                   30-Sep-2022 11:11                2925
eventbufferevent.setwatermark.php                  30-Sep-2022 11:11                3824
eventbufferevent.sslerror.php                      30-Sep-2022 11:11                6345
eventbufferevent.sslfilter.php                     30-Sep-2022 11:11               41039
eventbufferevent.sslgetcipherinfo.php              30-Sep-2022 11:11                2826
eventbufferevent.sslgetciphername.php              30-Sep-2022 11:11                2712
eventbufferevent.sslgetcipherversion.php           30-Sep-2022 11:11                2741
eventbufferevent.sslgetprotocol.php                30-Sep-2022 11:11                2670
eventbufferevent.sslrenegotiate.php                30-Sep-2022 11:11                2789
eventbufferevent.sslsocket.php                     30-Sep-2022 11:11                5519
eventbufferevent.write.php                         30-Sep-2022 11:11                3052
eventbufferevent.writebuffer.php                   30-Sep-2022 11:11                3234
eventconfig.avoidmethod.php                        30-Sep-2022 11:11                4288
eventconfig.construct.php                          30-Sep-2022 11:11                4520
eventconfig.requirefeatures.php                    30-Sep-2022 11:11                6090
eventconfig.setflags.php                           30-Sep-2022 11:11                3171
eventconfig.setmaxdispatchinterval.php             30-Sep-2022 11:11                4282
eventdnsbase.addnameserverip.php                   30-Sep-2022 11:11                2779
eventdnsbase.addsearch.php                         30-Sep-2022 11:11                2473
eventdnsbase.clearsearch.php                       30-Sep-2022 11:11                2795
eventdnsbase.construct.php                         30-Sep-2022 11:11                3225
eventdnsbase.countnameservers.php                  30-Sep-2022 11:11                2474
eventdnsbase.loadhosts.php                         30-Sep-2022 11:11                2652
eventdnsbase.parseresolvconf.php                   30-Sep-2022 11:11                4070
eventdnsbase.setoption.php                         30-Sep-2022 11:11                3170
eventdnsbase.setsearchndots.php                    30-Sep-2022 11:11                2716
eventhttp.accept.php                               30-Sep-2022 11:11               13278
eventhttp.addserveralias.php                       30-Sep-2022 11:11                6485
eventhttp.bind.php                                 30-Sep-2022 11:11                7875
eventhttp.construct.php                            30-Sep-2022 11:11               19947
eventhttp.removeserveralias.php                    30-Sep-2022 11:11                3062
eventhttp.setallowedmethods.php                    30-Sep-2022 11:11                3314
eventhttp.setcallback.php                          30-Sep-2022 11:11               19781
eventhttp.setdefaultcallback.php                   30-Sep-2022 11:11                7851
eventhttp.setmaxbodysize.php                       30-Sep-2022 11:11                2849
eventhttp.setmaxheaderssize.php                    30-Sep-2022 11:11                2761
eventhttp.settimeout.php                           30-Sep-2022 11:11                2428
eventhttpconnection.construct.php                  30-Sep-2022 11:11                5224
eventhttpconnection.getbase.php                    30-Sep-2022 11:11                2555
eventhttpconnection.getpeer.php                    30-Sep-2022 11:11                2888
eventhttpconnection.makerequest.php                30-Sep-2022 11:11               12577
eventhttpconnection.setclosecallback.php           30-Sep-2022 11:11               11808
eventhttpconnection.setlocaladdress.php            30-Sep-2022 11:11                3146
eventhttpconnection.setlocalport.php               30-Sep-2022 11:11                3037
eventhttpconnection.setmaxbodysize.php             30-Sep-2022 11:11                3071
eventhttpconnection.setmaxheaderssize.php          30-Sep-2022 11:11                3092
eventhttpconnection.setretries.php                 30-Sep-2022 11:11                2658
eventhttpconnection.settimeout.php                 30-Sep-2022 11:11                2555
eventhttprequest.addheader.php                     30-Sep-2022 11:11                3674
eventhttprequest.cancel.php                        30-Sep-2022 11:11                2808
eventhttprequest.clearheaders.php                  30-Sep-2022 11:11                2780
eventhttprequest.closeconnection.php               30-Sep-2022 11:11                2363
eventhttprequest.construct.php                     30-Sep-2022 11:11               12721
eventhttprequest.findheader.php                    30-Sep-2022 11:11                3370
eventhttprequest.free.php                          30-Sep-2022 11:11                2271
eventhttprequest.getbufferevent.php                30-Sep-2022 11:11                3686
eventhttprequest.getcommand.php                    30-Sep-2022 11:11                2646
eventhttprequest.getconnection.php                 30-Sep-2022 11:11                4455
eventhttprequest.gethost.php                       30-Sep-2022 11:11                2823
eventhttprequest.getinputbuffer.php                30-Sep-2022 11:11                2770
eventhttprequest.getinputheaders.php               30-Sep-2022 11:11                2803
eventhttprequest.getoutputbuffer.php               30-Sep-2022 11:11                2829
eventhttprequest.getoutputheaders.php              30-Sep-2022 11:11                2787
eventhttprequest.getresponsecode.php               30-Sep-2022 11:11                3120
eventhttprequest.geturi.php                        30-Sep-2022 11:11                3031
eventhttprequest.removeheader.php                  30-Sep-2022 11:11                3381
eventhttprequest.senderror.php                     30-Sep-2022 11:11                5702
eventhttprequest.sendreply.php                     30-Sep-2022 11:11                3947
eventhttprequest.sendreplychunk.php                30-Sep-2022 11:11                3429
eventhttprequest.sendreplyend.php                  30-Sep-2022 11:11                3028
eventhttprequest.sendreplystart.php                30-Sep-2022 11:11                4202
eventlistener.construct.php                        30-Sep-2022 11:11               27662
eventlistener.disable.php                          30-Sep-2022 11:11                2668
eventlistener.enable.php                           30-Sep-2022 11:11                2654
eventlistener.getbase.php                          30-Sep-2022 11:11                2285
eventlistener.getsocketname.php                    30-Sep-2022 11:11                3192
eventlistener.setcallback.php                      30-Sep-2022 11:11                5715
eventlistener.seterrorcallback.php                 30-Sep-2022 11:11                4249
eventsslcontext.construct.php                      30-Sep-2022 11:11                5822
eventutil.construct.php                            30-Sep-2022 11:11                2324
eventutil.getlastsocketerrno.php                   30-Sep-2022 11:11                3243
eventutil.getlastsocketerror.php                   30-Sep-2022 11:11                3108
eventutil.getsocketfd.php                          30-Sep-2022 11:11                3140
eventutil.getsocketname.php                        30-Sep-2022 11:11                3640
eventutil.setsocketoption.php                      30-Sep-2022 11:11                5532
eventutil.sslrandpoll.php                          30-Sep-2022 11:11                2313
evfork.construct.php                               30-Sep-2022 11:10                3622
evfork.createstopped.php                           30-Sep-2022 11:10                3720
evidle.construct.php                               30-Sep-2022 11:10                3677
evidle.createstopped.php                           30-Sep-2022 11:10                4036
evio.construct.php                                 30-Sep-2022 11:10                4725
evio.createstopped.php                             30-Sep-2022 11:10                5102
evio.set.php                                       30-Sep-2022 11:10                2785
evloop.backend.php                                 30-Sep-2022 11:10                2656
evloop.check.php                                   30-Sep-2022 11:10                3122
evloop.child.php                                   30-Sep-2022 11:10                3484
evloop.construct.php                               30-Sep-2022 11:10                3917
evloop.defaultloop.php                             30-Sep-2022 11:10                4515
evloop.embed.php                                   30-Sep-2022 11:10                3587
evloop.fork.php                                    30-Sep-2022 11:10                3316
evloop.idle.php                                    30-Sep-2022 11:10                3336
evloop.invokepending.php                           30-Sep-2022 11:10                2178
evloop.io.php                                      30-Sep-2022 11:10                3755
evloop.loopfork.php                                30-Sep-2022 11:10                2478
evloop.now.php                                     30-Sep-2022 11:10                2770
evloop.nowupdate.php                               30-Sep-2022 11:10                3132
evloop.periodic.php                                30-Sep-2022 11:10                3794
evloop.prepare.php                                 30-Sep-2022 11:10                3334
evloop.resume.php                                  30-Sep-2022 11:10                2792
evloop.run.php                                     30-Sep-2022 11:10                4742
evloop.signal.php                                  30-Sep-2022 11:10                3581
evloop.stat.php                                    30-Sep-2022 11:10                3702
evloop.stop.php                                    30-Sep-2022 11:10                2925
evloop.suspend.php                                 30-Sep-2022 11:10                2784
evloop.timer.php                                   30-Sep-2022 11:10                3721
evloop.verify.php                                  30-Sep-2022 11:10                2559
evperiodic.again.php                               30-Sep-2022 11:10                2532
evperiodic.at.php                                  30-Sep-2022 11:10                2553
evperiodic.construct.php                           30-Sep-2022 11:10               10167
evperiodic.createstopped.php                       30-Sep-2022 11:10                5658
evperiodic.set.php                                 30-Sep-2022 11:10                3043
evprepare.construct.php                            30-Sep-2022 11:10                3402
evprepare.createstopped.php                        30-Sep-2022 11:10                4268
evsignal.construct.php                             30-Sep-2022 11:10                5493
evsignal.createstopped.php                         30-Sep-2022 11:10                4756
evsignal.set.php                                   30-Sep-2022 11:10                2397
evstat.attr.php                                    30-Sep-2022 11:10                8668
evstat.construct.php                               30-Sep-2022 11:10                7410
evstat.createstopped.php                           30-Sep-2022 11:10                5052
evstat.prev.php                                    30-Sep-2022 11:10                2916
evstat.set.php                                     30-Sep-2022 11:10                2718
evstat.stat.php                                    30-Sep-2022 11:10                2836
evtimer.again.php                                  30-Sep-2022 11:10                3027
evtimer.construct.php                              30-Sep-2022 11:10               13517
evtimer.createstopped.php                          30-Sep-2022 11:10                8511
evtimer.set.php                                    30-Sep-2022 11:10                2860
evwatcher.clear.php                                30-Sep-2022 11:10                2742
evwatcher.construct.php                            30-Sep-2022 11:10                2077
evwatcher.feed.php                                 30-Sep-2022 11:10                2510
evwatcher.getloop.php                              30-Sep-2022 11:10                2284
evwatcher.invoke.php                               30-Sep-2022 11:10                2517
evwatcher.keepalive.php                            30-Sep-2022 11:10                5121
evwatcher.setcallback.php                          30-Sep-2022 11:10                2530
evwatcher.start.php                                30-Sep-2022 11:10                2474
evwatcher.stop.php                                 30-Sep-2022 11:10                2443
example.xml-external-entity.php                    30-Sep-2022 11:11               26058
example.xml-map-tags.php                           30-Sep-2022 11:11                9160
example.xml-structure.php                          30-Sep-2022 11:11                6959
example.xmlwriter-namespace.php                    30-Sep-2022 11:11                5555
example.xmlwriter-oop.php                          30-Sep-2022 11:11                3501
example.xmlwriter-simple.php                       30-Sep-2022 11:11                8946
exception.clone.php                                30-Sep-2022 11:10                2847
exception.construct.php                            30-Sep-2022 11:10                3577
exception.getcode.php                              30-Sep-2022 11:10                4587
exception.getfile.php                              30-Sep-2022 11:10                3864
exception.getline.php                              30-Sep-2022 11:10                4162
exception.getmessage.php                           30-Sep-2022 11:10                3934
exception.getprevious.php                          30-Sep-2022 11:10                7177
exception.gettrace.php                             30-Sep-2022 11:10                4332
exception.gettraceasstring.php                     30-Sep-2022 11:10                4267
exception.tostring.php                             30-Sep-2022 11:10                4042
exec.configuration.php                             30-Sep-2022 11:10                1243
exec.constants.php                                 30-Sep-2022 11:10                1148
exec.installation.php                              30-Sep-2022 11:10                1206
exec.requirements.php                              30-Sep-2022 11:10                1150
exec.resources.php                                 30-Sep-2022 11:10                1351
exec.setup.php                                     30-Sep-2022 11:10                1539
exif.configuration.php                             30-Sep-2022 11:10                7126
exif.constants.php                                 30-Sep-2022 11:10                1887
exif.installation.php                              30-Sep-2022 11:10                1736
exif.requirements.php                              30-Sep-2022 11:10                1774
exif.resources.php                                 30-Sep-2022 11:10                1194
exif.setup.php                                     30-Sep-2022 11:10                1551
expect.configuration.php                           30-Sep-2022 11:10                5129
expect.constants.php                               30-Sep-2022 11:10                3249
expect.examples-usage.php                          30-Sep-2022 11:10               17175
expect.examples.php                                30-Sep-2022 11:10                1360
expect.installation.php                            30-Sep-2022 11:10                2288
expect.requirements.php                            30-Sep-2022 11:10                1277
expect.resources.php                               30-Sep-2022 11:10                1405
expect.setup.php                                   30-Sep-2022 11:10                1576
ext-weakmap.construct.php                          30-Sep-2022 11:10                1855
extensions.alphabetical.php                        30-Sep-2022 11:11               20468
extensions.membership.php                          30-Sep-2022 11:11               20310
extensions.php                                     30-Sep-2022 11:11                1617
extensions.state.php                               30-Sep-2022 11:11                2675
fann.configuration.php                             30-Sep-2022 11:10                1243
fann.constants.php                                 30-Sep-2022 11:10               17663
fann.examples-1.php                                30-Sep-2022 11:10                9055
fann.examples.php                                  30-Sep-2022 11:10                1314
fann.installation.php                              30-Sep-2022 11:10                5008
fann.requirements.php                              30-Sep-2022 11:10                1132
fann.resources.php                                 30-Sep-2022 11:10                1142
fann.setup.php                                     30-Sep-2022 11:10                1523
fannconnection.construct.php                       30-Sep-2022 11:10                2814
fannconnection.getfromneuron.php                   30-Sep-2022 11:10                2279
fannconnection.gettoneuron.php                     30-Sep-2022 11:10                2267
fannconnection.getweight.php                       30-Sep-2022 11:10                2235
fannconnection.setweight.php                       30-Sep-2022 11:10                2824
faq.build.php                                      30-Sep-2022 11:11               24508
faq.com.php                                        30-Sep-2022 11:11               12647
faq.databases.php                                  30-Sep-2022 11:11                8224
faq.general.php                                    30-Sep-2022 11:11                4871
faq.html.php                                       30-Sep-2022 11:11               20774
faq.installation.php                               30-Sep-2022 11:11               25762
faq.mailinglist.php                                30-Sep-2022 11:11               10702
faq.misc.php                                       30-Sep-2022 11:11                4375
faq.obtaining.php                                  30-Sep-2022 11:11               10922
faq.passwords.php                                  30-Sep-2022 11:11               10207
faq.php                                            30-Sep-2022 11:11                1979
faq.using.php                                      30-Sep-2022 11:11               24195
fdf.configuration.php                              30-Sep-2022 11:10                1236
fdf.constants.php                                  30-Sep-2022 11:10                6363
fdf.examples.php                                   30-Sep-2022 11:10                6602
fdf.installation.php                               30-Sep-2022 11:10                3413
fdf.requirements.php                               30-Sep-2022 11:10                1469
fdf.resources.php                                  30-Sep-2022 11:10                1702
fdf.setup.php                                      30-Sep-2022 11:10                1531
features.commandline.differences.php               30-Sep-2022 11:10               11839
features.commandline.ini.php                       30-Sep-2022 11:10                2258
features.commandline.interactive.php               30-Sep-2022 11:10                8858
features.commandline.introduction.php              30-Sep-2022 11:10                7193
features.commandline.io-streams.php                30-Sep-2022 11:10                6081
features.commandline.options.php                   30-Sep-2022 11:10               26117
features.commandline.php                           30-Sep-2022 11:10                2056
features.commandline.usage.php                     30-Sep-2022 11:10               14575
features.commandline.webserver.php                 30-Sep-2022 11:10               12744
features.connection-handling.php                   30-Sep-2022 11:10                5673
features.cookies.php                               30-Sep-2022 11:10                3036
features.dtrace.dtrace.php                         30-Sep-2022 11:10               13921
features.dtrace.introduction.php                   30-Sep-2022 11:10                3313
features.dtrace.php                                30-Sep-2022 11:10                1605
features.dtrace.systemtap.php                      30-Sep-2022 11:10                8011
features.file-upload.common-pitfalls.php           30-Sep-2022 11:10                4919
features.file-upload.errors.php                    30-Sep-2022 11:10                3782
features.file-upload.errors.seealso.php            30-Sep-2022 11:10                1351
features.file-upload.multiple.php                  30-Sep-2022 11:10                6658
features.file-upload.php                           30-Sep-2022 11:10                1938
features.file-upload.post-method.php               30-Sep-2022 11:10               17203
features.file-upload.put-method.php                30-Sep-2022 11:10                5822
features.gc.collecting-cycles.php                  30-Sep-2022 11:10                7918
features.gc.performance-considerations.php         30-Sep-2022 11:10               14090
features.gc.php                                    30-Sep-2022 11:10                1701
features.gc.refcounting-basics.php                 30-Sep-2022 11:10               21324
features.http-auth.php                             30-Sep-2022 11:10               25550
features.persistent-connections.php                30-Sep-2022 11:10                8485
features.php                                       30-Sep-2022 11:10                4213
features.remote-files.php                          30-Sep-2022 11:10                8626
features.session.security.management.php           30-Sep-2022 11:11               25874
features.sessions.php                              30-Sep-2022 11:10                1405
features.xforms.php                                30-Sep-2022 11:10                5318
ffi-ctype.getalignment.php                         30-Sep-2022 11:10                2246
ffi-ctype.getarrayelementtype.php                  30-Sep-2022 11:10                2390
ffi-ctype.getarraylength.php                       30-Sep-2022 11:10                2289
ffi-ctype.getattributes.php                        30-Sep-2022 11:10                2265
ffi-ctype.getenumkind.php                          30-Sep-2022 11:10                2241
ffi-ctype.getfuncabi.php                           30-Sep-2022 11:10                2249
ffi-ctype.getfuncparametercount.php                30-Sep-2022 11:10                2355
ffi-ctype.getfuncparametertype.php                 30-Sep-2022 11:10                2603
ffi-ctype.getfuncreturntype.php                    30-Sep-2022 11:10                2372
ffi-ctype.getkind.php                              30-Sep-2022 11:10                2203
ffi-ctype.getname.php                              30-Sep-2022 11:10                2207
ffi-ctype.getpointertype.php                       30-Sep-2022 11:10                2316
ffi-ctype.getsize.php                              30-Sep-2022 11:10                2221
ffi-ctype.getstructfieldnames.php                  30-Sep-2022 11:10                2331
ffi-ctype.getstructfieldoffset.php                 30-Sep-2022 11:10                2539
ffi-ctype.getstructfieldtype.php                   30-Sep-2022 11:10                2559
ffi.addr.php                                       30-Sep-2022 11:10                2755
ffi.alignof.php                                    30-Sep-2022 11:10                2827
ffi.arraytype.php                                  30-Sep-2022 11:10                4446
ffi.cast.php                                       30-Sep-2022 11:10                4892
ffi.cdef.php                                       30-Sep-2022 11:10                4142
ffi.configuration.php                              30-Sep-2022 11:10                4127
ffi.constants.php                                  30-Sep-2022 11:10                1118
ffi.examples-basic.php                             30-Sep-2022 11:10               17203
ffi.examples-callback.php                          30-Sep-2022 11:10                5054
ffi.examples-complete.php                          30-Sep-2022 11:10                5826
ffi.examples.php                                   30-Sep-2022 11:10                1471
ffi.free.php                                       30-Sep-2022 11:10                2369
ffi.installation.php                               30-Sep-2022 11:10                1389
ffi.isnull.php                                     30-Sep-2022 11:10                2356
ffi.load.php                                       30-Sep-2022 11:10                4155
ffi.memcmp.php                                     30-Sep-2022 11:10                3746
ffi.memcpy.php                                     30-Sep-2022 11:10                3111
ffi.memset.php                                     30-Sep-2022 11:10                2953
ffi.new.php                                        30-Sep-2022 11:10                5277
ffi.requirements.php                               30-Sep-2022 11:10                1228
ffi.resources.php                                  30-Sep-2022 11:10                1187
ffi.scope.php                                      30-Sep-2022 11:10                3067
ffi.setup.php                                      30-Sep-2022 11:10                1521
ffi.sizeof.php                                     30-Sep-2022 11:10                2668
ffi.string.php                                     30-Sep-2022 11:10                3645
ffi.type.php                                       30-Sep-2022 11:10                3520
ffi.typeof.php                                     30-Sep-2022 11:10                2819
fiber.construct.php                                30-Sep-2022 11:10                2259
fiber.getcurrent.php                               30-Sep-2022 11:10                2371
fiber.getreturn.php                                30-Sep-2022 11:10                2571
fiber.isrunning.php                                30-Sep-2022 11:10                2532
fiber.isstarted.php                                30-Sep-2022 11:10                2114
fiber.issuspended.php                              30-Sep-2022 11:10                2126
fiber.isterminated.php                             30-Sep-2022 11:10                2179
fiber.resume.php                                   30-Sep-2022 11:10                3368
fiber.start.php                                    30-Sep-2022 11:10                3089
fiber.suspend.php                                  30-Sep-2022 11:10                4053
fiber.throw.php                                    30-Sep-2022 11:10                3217
fibererror.construct.php                           30-Sep-2022 11:10                2164
fileinfo.configuration.php                         30-Sep-2022 11:10                1271
fileinfo.constants.php                             30-Sep-2022 11:10                4892
fileinfo.installation.php                          30-Sep-2022 11:10                1741
fileinfo.requirements.php                          30-Sep-2022 11:10                1178
fileinfo.resources.php                             30-Sep-2022 11:10                1432
fileinfo.setup.php                                 30-Sep-2022 11:10                1597
filesystem.configuration.php                       30-Sep-2022 11:10                7274
filesystem.constants.php                           30-Sep-2022 11:10                8791
filesystem.installation.php                        30-Sep-2022 11:10                1248
filesystem.requirements.php                        30-Sep-2022 11:10                1192
filesystem.resources.php                           30-Sep-2022 11:10                1287
filesystem.setup.php                               30-Sep-2022 11:10                1622
filesystemiterator.construct.php                   30-Sep-2022 11:10                6970
filesystemiterator.current.php                     30-Sep-2022 11:10                5360
filesystemiterator.getflags.php                    30-Sep-2022 11:10                3140
filesystemiterator.key.php                         30-Sep-2022 11:10                5252
filesystemiterator.next.php                        30-Sep-2022 11:10                4527
filesystemiterator.rewind.php                      30-Sep-2022 11:10                5146
filesystemiterator.setflags.php                    30-Sep-2022 11:10                6704
filter.configuration.php                           30-Sep-2022 11:11                4894
filter.constants.php                               30-Sep-2022 11:11               17869
filter.examples.php                                30-Sep-2022 11:11                1421
filter.examples.sanitization.php                   30-Sep-2022 11:11                6060
filter.examples.validation.php                     30-Sep-2022 11:11               11118
filter.filters.flags.php                           30-Sep-2022 11:11               12182
filter.filters.misc.php                            30-Sep-2022 11:11                1827
filter.filters.php                                 30-Sep-2022 11:11                1574
filter.filters.sanitize.php                        30-Sep-2022 11:11               10303
filter.filters.validate.php                        30-Sep-2022 11:11               10815
filter.installation.php                            30-Sep-2022 11:11                1267
filter.requirements.php                            30-Sep-2022 11:11                1164
filter.resources.php                               30-Sep-2022 11:11                1197
filter.setup.php                                   30-Sep-2022 11:11                1560
filteriterator.accept.php                          30-Sep-2022 11:10                5459
filteriterator.construct.php                       30-Sep-2022 11:10                3057
filteriterator.current.php                         30-Sep-2022 11:10                3021
filteriterator.getinneriterator.php                30-Sep-2022 11:10                2467
filteriterator.key.php                             30-Sep-2022 11:10                2953
filteriterator.next.php                            30-Sep-2022 11:10                2884
filteriterator.rewind.php                          30-Sep-2022 11:10                3077
filteriterator.valid.php                           30-Sep-2022 11:10                2424
filters.compression.php                            30-Sep-2022 11:11               16935
filters.convert.php                                30-Sep-2022 11:11               13824
filters.encryption.php                             30-Sep-2022 11:11               46190
filters.php                                        30-Sep-2022 11:11                3480
filters.string.php                                 30-Sep-2022 11:11               10904
finfo.buffer.php                                   30-Sep-2022 11:10                2448
finfo.construct.php                                30-Sep-2022 11:10                2812
finfo.file.php                                     30-Sep-2022 11:10                2439
finfo.set-flags.php                                30-Sep-2022 11:10                1950
fpm.observability.php                              30-Sep-2022 11:11                1342
fpm.setup.php                                      30-Sep-2022 11:11                1235
fpm.status.php                                     30-Sep-2022 11:11                9941
ftp.configuration.php                              30-Sep-2022 11:11                1236
ftp.constants.php                                  30-Sep-2022 11:11                4090
ftp.examples-basic.php                             30-Sep-2022 11:11                5403
ftp.examples.php                                   30-Sep-2022 11:11                1318
ftp.installation.php                               30-Sep-2022 11:11                1437
ftp.requirements.php                               30-Sep-2022 11:11                1143
ftp.resources.php                                  30-Sep-2022 11:11                1524
ftp.setup.php                                      30-Sep-2022 11:11                1531
funchand.configuration.php                         30-Sep-2022 11:11                1271
funchand.constants.php                             30-Sep-2022 11:11                1171
funchand.installation.php                          30-Sep-2022 11:11                1234
funchand.requirements.php                          30-Sep-2022 11:11                1178
funchand.resources.php                             30-Sep-2022 11:11                1222
funchand.setup.php                                 30-Sep-2022 11:11                1575
funcref.php                                        30-Sep-2022 11:11               14465
function.abs.php                                   30-Sep-2022 11:10                5051
function.acos.php                                  30-Sep-2022 11:10                3353
function.acosh.php                                 30-Sep-2022 11:10                3166
function.addcslashes.php                           30-Sep-2022 11:11                8040
function.addslashes.php                            30-Sep-2022 11:11                6551
function.apache-child-terminate.php                30-Sep-2022 11:11                3360
function.apache-get-modules.php                    30-Sep-2022 11:11                3230
function.apache-get-version.php                    30-Sep-2022 11:11                3793
function.apache-getenv.php                         30-Sep-2022 11:11                4941
function.apache-lookup-uri.php                     30-Sep-2022 11:11                5768
function.apache-note.php                           30-Sep-2022 11:11                6983
function.apache-request-headers.php                30-Sep-2022 11:11                5747
function.apache-response-headers.php               30-Sep-2022 11:11                4356
function.apache-setenv.php                         30-Sep-2022 11:11                5455
function.apcu-add.php                              30-Sep-2022 11:10                8234
function.apcu-cache-info.php                       30-Sep-2022 11:10                6455
function.apcu-cas.php                              30-Sep-2022 11:10                8873
function.apcu-clear-cache.php                      30-Sep-2022 11:10                2483
function.apcu-dec.php                              30-Sep-2022 11:10                8014
function.apcu-delete.php                           30-Sep-2022 11:10                5936
function.apcu-enabled.php                          30-Sep-2022 11:10                2200
function.apcu-entry.php                            30-Sep-2022 11:10                8794
function.apcu-exists.php                           30-Sep-2022 11:10                7022
function.apcu-fetch.php                            30-Sep-2022 11:10                5678
function.apcu-inc.php                              30-Sep-2022 11:10                7998
function.apcu-key-info.php                         30-Sep-2022 11:10                4755
function.apcu-sma-info.php                         30-Sep-2022 11:10                4299
function.apcu-store.php                            30-Sep-2022 11:10                7027
function.array-change-key-case.php                 30-Sep-2022 11:11                5515
function.array-chunk.php                           30-Sep-2022 11:11                7364
function.array-column.php                          30-Sep-2022 11:11               18005
function.array-combine.php                         30-Sep-2022 11:11                6998
function.array-count-values.php                    30-Sep-2022 11:11                5641
function.array-diff-assoc.php                      30-Sep-2022 11:11               11087
function.array-diff-key.php                        30-Sep-2022 11:11               13191
function.array-diff-uassoc.php                     30-Sep-2022 11:11               12001
function.array-diff-ukey.php                       30-Sep-2022 11:11               12247
function.array-diff.php                            30-Sep-2022 11:11               12580
function.array-fill-keys.php                       30-Sep-2022 11:11                5326
function.array-fill.php                            30-Sep-2022 11:11                8754
function.array-filter.php                          30-Sep-2022 11:11               17111
function.array-flip.php                            30-Sep-2022 11:11                7128
function.array-intersect-assoc.php                 30-Sep-2022 11:11                8838
function.array-intersect-key.php                   30-Sep-2022 11:11               10506
function.array-intersect-uassoc.php                30-Sep-2022 11:11                8650
function.array-intersect-ukey.php                  30-Sep-2022 11:11               12101
function.array-intersect.php                       30-Sep-2022 11:11                6919
function.array-is-list.php                         30-Sep-2022 11:11                7019
function.array-key-exists.php                      30-Sep-2022 11:11                8619
function.array-key-first.php                       30-Sep-2022 11:11                7222
function.array-key-last.php                        30-Sep-2022 11:11                3137
function.array-keys.php                            30-Sep-2022 11:11                8495
function.array-map.php                             30-Sep-2022 11:11               28274
function.array-merge-recursive.php                 30-Sep-2022 11:11                6737
function.array-merge.php                           30-Sep-2022 11:11               12624
function.array-multisort.php                       30-Sep-2022 11:11               23847
function.array-pad.php                             30-Sep-2022 11:11                7213
function.array-pop.php                             30-Sep-2022 11:11                5650
function.array-product.php                         30-Sep-2022 11:11                4304
function.array-push.php                            30-Sep-2022 11:11                6960
function.array-rand.php                            30-Sep-2022 11:11                6756
function.array-reduce.php                          30-Sep-2022 11:11               10490
function.array-replace-recursive.php               30-Sep-2022 11:11               11675
function.array-replace.php                         30-Sep-2022 11:11                6553
function.array-reverse.php                         30-Sep-2022 11:11                5980
function.array-search.php                          30-Sep-2022 11:11                8322
function.array-shift.php                           30-Sep-2022 11:11                5688
function.array-slice.php                           30-Sep-2022 11:11               13895
function.array-splice.php                          30-Sep-2022 11:11               18793
function.array-sum.php                             30-Sep-2022 11:11                5023
function.array-udiff-assoc.php                     30-Sep-2022 11:11               14988
function.array-udiff-uassoc.php                    30-Sep-2022 11:11               16856
function.array-udiff.php                           30-Sep-2022 11:11               29466
function.array-uintersect-assoc.php                30-Sep-2022 11:11                8128
function.array-uintersect-uassoc.php               30-Sep-2022 11:11                8788
function.array-uintersect.php                      30-Sep-2022 11:11                7666
function.array-unique.php                          30-Sep-2022 11:11                9375
function.array-unshift.php                         30-Sep-2022 11:11                6073
function.array-values.php                          30-Sep-2022 11:11                4604
function.array-walk-recursive.php                  30-Sep-2022 11:11                7527
function.array-walk.php                            30-Sep-2022 11:11               14335
function.array.php                                 30-Sep-2022 11:11               12276
function.arsort.php                                30-Sep-2022 11:11                8091
function.asin.php                                  30-Sep-2022 11:10                3349
function.asinh.php                                 30-Sep-2022 11:10                3162
function.asort.php                                 30-Sep-2022 11:11                8353
function.assert-options.php                        30-Sep-2022 11:10               12177
function.assert.php                                30-Sep-2022 11:10               26510
function.atan.php                                  30-Sep-2022 11:10                3362
function.atan2.php                                 30-Sep-2022 11:10                3257
function.atanh.php                                 30-Sep-2022 11:10                3187
function.autoload.php                              30-Sep-2022 11:11                3141
function.base-convert.php                          30-Sep-2022 11:10                6331
function.base64-decode.php                         30-Sep-2022 11:11                4740
function.base64-encode.php                         30-Sep-2022 11:11                4685
function.basename.php                              30-Sep-2022 11:10                7416
function.bcadd.php                                 30-Sep-2022 11:10                5679
function.bccomp.php                                30-Sep-2022 11:10                5607
function.bcdiv.php                                 30-Sep-2022 11:10                5124
function.bcmod.php                                 30-Sep-2022 11:10                7392
function.bcmul.php                                 30-Sep-2022 11:10                7135
function.bcpow.php                                 30-Sep-2022 11:10                7184
function.bcpowmod.php                              30-Sep-2022 11:10                7116
function.bcscale.php                               30-Sep-2022 11:10                5416
function.bcsqrt.php                                30-Sep-2022 11:10                4775
function.bcsub.php                                 30-Sep-2022 11:10                5675
function.bin2hex.php                               30-Sep-2022 11:11                4650
function.bind-textdomain-codeset.php               30-Sep-2022 11:10                4317
function.bindec.php                                30-Sep-2022 11:10               15528
function.bindtextdomain.php                        30-Sep-2022 11:10                5221
function.boolval.php                               30-Sep-2022 11:11               10766
function.bzclose.php                               30-Sep-2022 11:10                2933
function.bzcompress.php                            30-Sep-2022 11:10                5094
function.bzdecompress.php                          30-Sep-2022 11:10                6255
function.bzerrno.php                               30-Sep-2022 11:10                3093
function.bzerror.php                               30-Sep-2022 11:10                4384
function.bzerrstr.php                              30-Sep-2022 11:10                3112
function.bzflush.php                               30-Sep-2022 11:10                3252
function.bzopen.php                                30-Sep-2022 11:10                4950
function.bzread.php                                30-Sep-2022 11:10                6592
function.bzwrite.php                               30-Sep-2022 11:10                6191
function.cal-days-in-month.php                     30-Sep-2022 11:10                4459
function.cal-from-jd.php                           30-Sep-2022 11:10                6856
function.cal-info.php                              30-Sep-2022 11:10                5663
function.cal-to-jd.php                             30-Sep-2022 11:10                5662
function.call-user-func-array.php                  30-Sep-2022 11:11               14458
function.call-user-func.php                        30-Sep-2022 11:11               15131
function.ceil.php                                  30-Sep-2022 11:10                4899
function.chdir.php                                 30-Sep-2022 11:10                5479
function.checkdate.php                             30-Sep-2022 11:10                5295
function.checkdnsrr.php                            30-Sep-2022 11:11                4956
function.chgrp.php                                 30-Sep-2022 11:10                6400
function.chmod.php                                 30-Sep-2022 11:10                8769
function.chop.php                                  30-Sep-2022 11:11                1959
function.chown.php                                 30-Sep-2022 11:10                6647
function.chr.php                                   30-Sep-2022 11:11                9130
function.chroot.php                                30-Sep-2022 11:10                4481
function.chunk-split.php                           30-Sep-2022 11:11                5224
function.class-alias.php                           30-Sep-2022 11:11                7367
function.class-exists.php                          30-Sep-2022 11:11                7279
function.class-implements.php                      30-Sep-2022 11:11                6282
function.class-parents.php                         30-Sep-2022 11:11                5950
function.class-uses.php                            30-Sep-2022 11:11                6057
function.clearstatcache.php                        30-Sep-2022 11:10               10972
function.cli-get-process-title.php                 30-Sep-2022 11:10                4393
function.cli-set-process-title.php                 30-Sep-2022 11:10                6112
function.closedir.php                              30-Sep-2022 11:10                5646
function.closelog.php                              30-Sep-2022 11:11                2963
function.com-create-guid.php                       30-Sep-2022 11:11                2731
function.com-event-sink.php                        30-Sep-2022 11:11               10642
function.com-get-active-object.php                 30-Sep-2022 11:11                5544
function.com-load-typelib.php                      30-Sep-2022 11:11                4913
function.com-message-pump.php                      30-Sep-2022 11:11                3717
function.com-print-typeinfo.php                    30-Sep-2022 11:11                4614
function.commonmark-parse.php                      30-Sep-2022 11:11                3524
function.commonmark-render-html.php                30-Sep-2022 11:11                3934
function.commonmark-render-latex.php               30-Sep-2022 11:11                4210
function.commonmark-render-man.php                 30-Sep-2022 11:11                4192
function.commonmark-render-xml.php                 30-Sep-2022 11:11                3891
function.commonmark-render.php                     30-Sep-2022 11:11                4138
function.compact.php                               30-Sep-2022 11:11                7722
function.connection-aborted.php                    30-Sep-2022 11:10                3117
function.connection-status.php                     30-Sep-2022 11:10                3197
function.constant.php                              30-Sep-2022 11:10                7684
function.convert-cyr-string.php                    30-Sep-2022 11:11                4991
function.convert-uudecode.php                      30-Sep-2022 11:11                4426
function.convert-uuencode.php                      30-Sep-2022 11:11                5348
function.copy.php                                  30-Sep-2022 11:10                5752
function.cos.php                                   30-Sep-2022 11:10                3902
function.cosh.php                                  30-Sep-2022 11:10                3105
function.count-chars.php                           30-Sep-2022 11:11                7115
function.count.php                                 30-Sep-2022 11:11               16218
function.crc32.php                                 30-Sep-2022 11:11                7696
function.create-function.php                       30-Sep-2022 11:11               33390
function.crypt.php                                 30-Sep-2022 11:11               17067
function.ctype-alnum.php                           30-Sep-2022 11:11                6776
function.ctype-alpha.php                           30-Sep-2022 11:11                7056
function.ctype-cntrl.php                           30-Sep-2022 11:11                6746
function.ctype-digit.php                           30-Sep-2022 11:11                9023
function.ctype-graph.php                           30-Sep-2022 11:11                7686
function.ctype-lower.php                           30-Sep-2022 11:11                6751
function.ctype-print.php                           30-Sep-2022 11:11                7726
function.ctype-punct.php                           30-Sep-2022 11:11                6808
function.ctype-space.php                           30-Sep-2022 11:11                7686
function.ctype-upper.php                           30-Sep-2022 11:11                6783
function.ctype-xdigit.php                          30-Sep-2022 11:11                6512
function.cubrid-affected-rows.php                  30-Sep-2022 11:10                9316
function.cubrid-bind.php                           30-Sep-2022 11:10               21469
function.cubrid-client-encoding.php                30-Sep-2022 11:10                5162
function.cubrid-close-prepare.php                  30-Sep-2022 11:10                6685
function.cubrid-close-request.php                  30-Sep-2022 11:10                6696
function.cubrid-close.php                          30-Sep-2022 11:10                6514
function.cubrid-col-get.php                        30-Sep-2022 11:10                8476
function.cubrid-col-size.php                       30-Sep-2022 11:10                8594
function.cubrid-column-names.php                   30-Sep-2022 11:10                8650
function.cubrid-column-types.php                   30-Sep-2022 11:10                8630
function.cubrid-commit.php                         30-Sep-2022 11:10               16189
function.cubrid-connect-with-url.php               30-Sep-2022 11:10               15546
function.cubrid-connect.php                        30-Sep-2022 11:10               12140
function.cubrid-current-oid.php                    30-Sep-2022 11:10                5891
function.cubrid-data-seek.php                      30-Sep-2022 11:10                7242
function.cubrid-db-name.php                        30-Sep-2022 11:10                6399
function.cubrid-disconnect.php                     30-Sep-2022 11:10                7470
function.cubrid-drop.php                           30-Sep-2022 11:10               11556
function.cubrid-errno.php                          30-Sep-2022 11:10                6945
function.cubrid-error-code-facility.php            30-Sep-2022 11:10                5959
function.cubrid-error-code.php                     30-Sep-2022 11:10                5894
function.cubrid-error-msg.php                      30-Sep-2022 11:10                5292
function.cubrid-error.php                          30-Sep-2022 11:10                6503
function.cubrid-execute.php                        30-Sep-2022 11:10               14298
function.cubrid-fetch-array.php                    30-Sep-2022 11:10                9939
function.cubrid-fetch-assoc.php                    30-Sep-2022 11:10                9149
function.cubrid-fetch-field.php                    30-Sep-2022 11:10               14187
function.cubrid-fetch-lengths.php                  30-Sep-2022 11:10                6020
function.cubrid-fetch-object.php                   30-Sep-2022 11:10               12268
function.cubrid-fetch-row.php                      30-Sep-2022 11:10                9033
function.cubrid-fetch.php                          30-Sep-2022 11:10               10212
function.cubrid-field-flags.php                    30-Sep-2022 11:10                7682
function.cubrid-field-len.php                      30-Sep-2022 11:10                8263
function.cubrid-field-name.php                     30-Sep-2022 11:10                7097
function.cubrid-field-seek.php                     30-Sep-2022 11:10               10837
function.cubrid-field-table.php                    30-Sep-2022 11:10                7320
function.cubrid-field-type.php                     30-Sep-2022 11:10                7382
function.cubrid-free-result.php                    30-Sep-2022 11:10                5667
function.cubrid-get-autocommit.php                 30-Sep-2022 11:10                3546
function.cubrid-get-charset.php                    30-Sep-2022 11:10                4893
function.cubrid-get-class-name.php                 30-Sep-2022 11:10                6192
function.cubrid-get-client-info.php                30-Sep-2022 11:10                8256
function.cubrid-get-db-parameter.php               30-Sep-2022 11:10               14405
function.cubrid-get-query-timeout.php              30-Sep-2022 11:10                6626
function.cubrid-get-server-info.php                30-Sep-2022 11:10                8488
function.cubrid-get.php                            30-Sep-2022 11:10               10031
function.cubrid-insert-id.php                      30-Sep-2022 11:10                7100
function.cubrid-is-instance.php                    30-Sep-2022 11:10                7348
function.cubrid-list-dbs.php                       30-Sep-2022 11:10                4365
function.cubrid-load-from-glo.php                  30-Sep-2022 11:10                6815
function.cubrid-lob-close.php                      30-Sep-2022 11:10                7260
function.cubrid-lob-export.php                     30-Sep-2022 11:10                7717
function.cubrid-lob-get.php                        30-Sep-2022 11:10                7633
function.cubrid-lob-send.php                       30-Sep-2022 11:10                6923
function.cubrid-lob-size.php                       30-Sep-2022 11:10                5776
function.cubrid-lob2-bind.php                      30-Sep-2022 11:10                9668
function.cubrid-lob2-close.php                     30-Sep-2022 11:10                3192
function.cubrid-lob2-export.php                    30-Sep-2022 11:10                8685
function.cubrid-lob2-import.php                    30-Sep-2022 11:10                8549
function.cubrid-lob2-new.php                       30-Sep-2022 11:10                3707
function.cubrid-lob2-read.php                      30-Sep-2022 11:10               14409
function.cubrid-lob2-seek.php                      30-Sep-2022 11:10               11239
function.cubrid-lob2-seek64.php                    30-Sep-2022 11:10               12782
function.cubrid-lob2-size.php                      30-Sep-2022 11:10                4240
function.cubrid-lob2-size64.php                    30-Sep-2022 11:10                4418
function.cubrid-lob2-tell.php                      30-Sep-2022 11:10                4259
function.cubrid-lob2-tell64.php                    30-Sep-2022 11:10                4455
function.cubrid-lob2-write.php                     30-Sep-2022 11:10               14334
function.cubrid-lock-read.php                      30-Sep-2022 11:10                9142
function.cubrid-lock-write.php                     30-Sep-2022 11:10                9560
function.cubrid-move-cursor.php                    30-Sep-2022 11:10                9287
function.cubrid-new-glo.php                        30-Sep-2022 11:10                6970
function.cubrid-next-result.php                    30-Sep-2022 11:10               17222
function.cubrid-num-cols.php                       30-Sep-2022 11:10                5904
function.cubrid-num-fields.php                     30-Sep-2022 11:10                5582
function.cubrid-num-rows.php                       30-Sep-2022 11:10                7103
function.cubrid-pconnect-with-url.php              30-Sep-2022 11:10               14985
function.cubrid-pconnect.php                       30-Sep-2022 11:10               12028
function.cubrid-ping.php                           30-Sep-2022 11:10                6246
function.cubrid-prepare.php                        30-Sep-2022 11:10               10326
function.cubrid-put.php                            30-Sep-2022 11:10               11452
function.cubrid-query.php                          30-Sep-2022 11:10               15240
function.cubrid-real-escape-string.php             30-Sep-2022 11:10                8107
function.cubrid-result.php                         30-Sep-2022 11:10                7307
function.cubrid-rollback.php                       30-Sep-2022 11:10               15469
function.cubrid-save-to-glo.php                    30-Sep-2022 11:10                6728
function.cubrid-schema.php                         30-Sep-2022 11:10               20227
function.cubrid-send-glo.php                       30-Sep-2022 11:10                6161
function.cubrid-seq-drop.php                       30-Sep-2022 11:10                9661
function.cubrid-seq-insert.php                     30-Sep-2022 11:10               10116
function.cubrid-seq-put.php                        30-Sep-2022 11:10               10043
function.cubrid-set-add.php                        30-Sep-2022 11:10                9416
function.cubrid-set-autocommit.php                 30-Sep-2022 11:10                3945
function.cubrid-set-db-parameter.php               30-Sep-2022 11:10                7946
function.cubrid-set-drop.php                       30-Sep-2022 11:10                9393
function.cubrid-set-query-timeout.php              30-Sep-2022 11:10                3289
function.cubrid-unbuffered-query.php               30-Sep-2022 11:10                7114
function.cubrid-version.php                        30-Sep-2022 11:10                8884
function.curl-close.php                            30-Sep-2022 11:11                6218
function.curl-copy-handle.php                      30-Sep-2022 11:11                6411
function.curl-errno.php                            30-Sep-2022 11:11                5840
function.curl-error.php                            30-Sep-2022 11:11                6035
function.curl-escape.php                           30-Sep-2022 11:11                7498
function.curl-exec.php                             30-Sep-2022 11:11                7210
function.curl-getinfo.php                          30-Sep-2022 11:11               30551
function.curl-init.php                             30-Sep-2022 11:11                7201
function.curl-multi-add-handle.php                 30-Sep-2022 11:11               10942
function.curl-multi-close.php                      30-Sep-2022 11:11                9998
function.curl-multi-errno.php                      30-Sep-2022 11:11                3754
function.curl-multi-exec.php                       30-Sep-2022 11:11               10968
function.curl-multi-getcontent.php                 30-Sep-2022 11:11                3896
function.curl-multi-info-read.php                  30-Sep-2022 11:11               12137
function.curl-multi-init.php                       30-Sep-2022 11:11                9505
function.curl-multi-remove-handle.php              30-Sep-2022 11:11                5364
function.curl-multi-select.php                     30-Sep-2022 11:11                4220
function.curl-multi-setopt.php                     30-Sep-2022 11:11               10433
function.curl-multi-strerror.php                   30-Sep-2022 11:11                7308
function.curl-pause.php                            30-Sep-2022 11:11                3517
function.curl-reset.php                            30-Sep-2022 11:11                6487
function.curl-setopt-array.php                     30-Sep-2022 11:11                7623
function.curl-setopt.php                           30-Sep-2022 11:11              128635
function.curl-share-close.php                      30-Sep-2022 11:11                8333
function.curl-share-errno.php                      30-Sep-2022 11:11                3857
function.curl-share-init.php                       30-Sep-2022 11:11                7960
function.curl-share-setopt.php                     30-Sep-2022 11:11               10385
function.curl-share-strerror.php                   30-Sep-2022 11:11                3281
function.curl-strerror.php                         30-Sep-2022 11:11                6273
function.curl-unescape.php                         30-Sep-2022 11:11                7997
function.curl-version.php                          30-Sep-2022 11:11                7436
function.curl_upkeep.php                           30-Sep-2022 11:11                6863
function.current.php                               30-Sep-2022 11:11               10789
function.date-add.php                              30-Sep-2022 11:10                1717
function.date-create-from-format.php               30-Sep-2022 11:10                1891
function.date-create-immutable-from-format.php     30-Sep-2022 11:10                1992
function.date-create-immutable.php                 30-Sep-2022 11:10                1884
function.date-create.php                           30-Sep-2022 11:10                4193
function.date-date-set.php                         30-Sep-2022 11:10                1776
function.date-default-timezone-get.php             30-Sep-2022 11:10                7160
function.date-default-timezone-set.php             30-Sep-2022 11:10                5785
function.date-diff.php                             30-Sep-2022 11:10                1736
function.date-format.php                           30-Sep-2022 11:10                1744
function.date-get-last-errors.php                  30-Sep-2022 11:10                1873
function.date-interval-create-from-date-string.php 30-Sep-2022 11:10                2020
function.date-interval-format.php                  30-Sep-2022 11:10                1871
function.date-isodate-set.php                      30-Sep-2022 11:10                1799
function.date-modify.php                           30-Sep-2022 11:10                1748
function.date-offset-get.php                       30-Sep-2022 11:10                1792
function.date-parse-from-format.php                30-Sep-2022 11:10               13220
function.date-parse.php                            30-Sep-2022 11:10               19264
function.date-sub.php                              30-Sep-2022 11:10                2358
function.date-sun-info.php                         30-Sep-2022 11:10               16319
function.date-sunrise.php                          30-Sep-2022 11:10               13256
function.date-sunset.php                           30-Sep-2022 11:10               13293
function.date-time-set.php                         30-Sep-2022 11:10                1762
function.date-timestamp-get.php                    30-Sep-2022 11:10                1821
function.date-timestamp-set.php                    30-Sep-2022 11:10                1829
function.date-timezone-get.php                     30-Sep-2022 11:10                1818
function.date-timezone-set.php                     30-Sep-2022 11:10                1790
function.date.php                                  30-Sep-2022 11:10               23330
function.db2-autocommit.php                        30-Sep-2022 11:10               10950
function.db2-bind-param.php                        30-Sep-2022 11:10               22703
function.db2-client-info.php                       30-Sep-2022 11:10               12155
function.db2-close.php                             30-Sep-2022 11:10                5517
function.db2-column-privileges.php                 30-Sep-2022 11:10                7936
function.db2-columns.php                           30-Sep-2022 11:10                9832
function.db2-commit.php                            30-Sep-2022 11:10                3514
function.db2-conn-error.php                        30-Sep-2022 11:10                6658
function.db2-conn-errormsg.php                     30-Sep-2022 11:10                6430
function.db2-connect.php                           30-Sep-2022 11:10               40565
function.db2-cursor-type.php                       30-Sep-2022 11:10                3068
function.db2-escape-string.php                     30-Sep-2022 11:10                7979
function.db2-exec.php                              30-Sep-2022 11:10               28768
function.db2-execute.php                           30-Sep-2022 11:10               27687
function.db2-fetch-array.php                       30-Sep-2022 11:10               11398
function.db2-fetch-assoc.php                       30-Sep-2022 11:10               11414
function.db2-fetch-both.php                        30-Sep-2022 11:10               11947
function.db2-fetch-object.php                      30-Sep-2022 11:10                9029
function.db2-fetch-row.php                         30-Sep-2022 11:10               16694
function.db2-field-display-size.php                30-Sep-2022 11:10                4821
function.db2-field-name.php                        30-Sep-2022 11:10                4707
function.db2-field-num.php                         30-Sep-2022 11:10                4717
function.db2-field-precision.php                   30-Sep-2022 11:10                4749
function.db2-field-scale.php                       30-Sep-2022 11:10                4711
function.db2-field-type.php                        30-Sep-2022 11:10                4712
function.db2-field-width.php                       30-Sep-2022 11:10                4919
function.db2-foreign-keys.php                      30-Sep-2022 11:10                8553
function.db2-free-result.php                       30-Sep-2022 11:10                3157
function.db2-free-stmt.php                         30-Sep-2022 11:10                3145
function.db2-get-option.php                        30-Sep-2022 11:10               24971
function.db2-last-insert-id.php                    30-Sep-2022 11:10                8571
function.db2-lob-read.php                          30-Sep-2022 11:10               17751
function.db2-next-result.php                       30-Sep-2022 11:10                8977
function.db2-num-fields.php                        30-Sep-2022 11:10                7168
function.db2-num-rows.php                          30-Sep-2022 11:10                4253
function.db2-pclose.php                            30-Sep-2022 11:10                5710
function.db2-pconnect.php                          30-Sep-2022 11:10               32555
function.db2-prepare.php                           30-Sep-2022 11:10               10590
function.db2-primary-keys.php                      30-Sep-2022 11:10                7187
function.db2-procedure-columns.php                 30-Sep-2022 11:10               11242
function.db2-procedures.php                        30-Sep-2022 11:10                7625
function.db2-result.php                            30-Sep-2022 11:10                7896
function.db2-rollback.php                          30-Sep-2022 11:10                9819
function.db2-server-info.php                       30-Sep-2022 11:10               24285
function.db2-set-option.php                        30-Sep-2022 11:10               70587
function.db2-special-columns.php                   30-Sep-2022 11:10                9772
function.db2-statistics.php                        30-Sep-2022 11:10               11908
function.db2-stmt-error.php                        30-Sep-2022 11:10                4326
function.db2-stmt-errormsg.php                     30-Sep-2022 11:10                3957
function.db2-table-privileges.php                  30-Sep-2022 11:10                7716
function.db2-tables.php                            30-Sep-2022 11:10                7746
function.dba-close.php                             30-Sep-2022 11:10                3105
function.dba-delete.php                            30-Sep-2022 11:10                3834
function.dba-exists.php                            30-Sep-2022 11:10                3858
function.dba-fetch.php                             30-Sep-2022 11:10                5233
function.dba-firstkey.php                          30-Sep-2022 11:10                3480
function.dba-handlers.php                          30-Sep-2022 11:10                5388
function.dba-insert.php                            30-Sep-2022 11:10                4416
function.dba-key-split.php                         30-Sep-2022 11:10                3591
function.dba-list.php                              30-Sep-2022 11:10                2138
function.dba-nextkey.php                           30-Sep-2022 11:10                3402
function.dba-open.php                              30-Sep-2022 11:10               11329
function.dba-optimize.php                          30-Sep-2022 11:10                2987
function.dba-popen.php                             30-Sep-2022 11:10                6317
function.dba-replace.php                           30-Sep-2022 11:10                4244
function.dba-sync.php                              30-Sep-2022 11:10                3007
function.dbase-add-record.php                      30-Sep-2022 11:10                6795
function.dbase-close.php                           30-Sep-2022 11:10                5021
function.dbase-create.php                          30-Sep-2022 11:10                7994
function.dbase-delete-record.php                   30-Sep-2022 11:10                4614
function.dbase-get-header-info.php                 30-Sep-2022 11:10                6852
function.dbase-get-record-with-names.php           30-Sep-2022 11:10                8715
function.dbase-get-record.php                      30-Sep-2022 11:10                5325
function.dbase-numfields.php                       30-Sep-2022 11:10                5764
function.dbase-numrecords.php                      30-Sep-2022 11:10                7075
function.dbase-open.php                            30-Sep-2022 11:10                6212
function.dbase-pack.php                            30-Sep-2022 11:10                6198
function.dbase-replace-record.php                  30-Sep-2022 11:10                9350
function.dcgettext.php                             30-Sep-2022 11:10                3389
function.dcngettext.php                            30-Sep-2022 11:10                3956
function.debug-backtrace.php                       30-Sep-2022 11:10                9371
function.debug-print-backtrace.php                 30-Sep-2022 11:10                6663
function.debug-zval-dump.php                       30-Sep-2022 11:11               10208
function.decbin.php                                30-Sep-2022 11:10                8645
function.dechex.php                                30-Sep-2022 11:10                7084
function.decoct.php                                30-Sep-2022 11:10                4718
function.define.php                                30-Sep-2022 11:10               11381
function.defined.php                               30-Sep-2022 11:10                5104
function.deflate-add.php                           30-Sep-2022 11:10                5091
function.deflate-init.php                          30-Sep-2022 11:10                7145
function.deg2rad.php                               30-Sep-2022 11:10                3928
function.delete.php                                30-Sep-2022 11:10                2461
function.dgettext.php                              30-Sep-2022 11:10                3094
function.die.php                                   30-Sep-2022 11:10                1551
function.dio-close.php                             30-Sep-2022 11:10                3983
function.dio-fcntl.php                             30-Sep-2022 11:10                9118
function.dio-open.php                              30-Sep-2022 11:10                7614
function.dio-read.php                              30-Sep-2022 11:10                3440
function.dio-seek.php                              30-Sep-2022 11:10                7303
function.dio-stat.php                              30-Sep-2022 11:10                4216
function.dio-tcsetattr.php                         30-Sep-2022 11:10                7039
function.dio-truncate.php                          30-Sep-2022 11:10                3402
function.dio-write.php                             30-Sep-2022 11:10                3720
function.dir.php                                   30-Sep-2022 11:10                6902
function.dirname.php                               30-Sep-2022 11:10                9606
function.disk-free-space.php                       30-Sep-2022 11:10                5509
function.disk-total-space.php                      30-Sep-2022 11:10                5143
function.diskfreespace.php                         30-Sep-2022 11:10                1757
function.dl.php                                    30-Sep-2022 11:10                9872
function.dngettext.php                             30-Sep-2022 11:10                3696
function.dns-check-record.php                      30-Sep-2022 11:11                1719
function.dns-get-mx.php                            30-Sep-2022 11:11                1690
function.dns-get-record.php                        30-Sep-2022 11:11               23683
function.dom-import-simplexml.php                  30-Sep-2022 11:11                7253
function.doubleval.php                             30-Sep-2022 11:11                1679
function.each.php                                  30-Sep-2022 11:11               11302
function.easter-date.php                           30-Sep-2022 11:10               11927
function.easter-days.php                           30-Sep-2022 11:10                7283
function.echo.php                                  30-Sep-2022 11:11               19595
function.eio-busy.php                              30-Sep-2022 11:10                4419
function.eio-cancel.php                            30-Sep-2022 11:10                7306
function.eio-chmod.php                             30-Sep-2022 11:10                5650
function.eio-chown.php                             30-Sep-2022 11:10                5797
function.eio-close.php                             30-Sep-2022 11:10                5237
function.eio-custom.php                            30-Sep-2022 11:10               10291
function.eio-dup2.php                              30-Sep-2022 11:10                5312
function.eio-event-loop.php                        30-Sep-2022 11:10                5833
function.eio-fallocate.php                         30-Sep-2022 11:10                6758
function.eio-fchmod.php                            30-Sep-2022 11:10                5710
function.eio-fchown.php                            30-Sep-2022 11:10                5958
function.eio-fdatasync.php                         30-Sep-2022 11:10                5131
function.eio-fstat.php                             30-Sep-2022 11:10               11578
function.eio-fstatvfs.php                          30-Sep-2022 11:10                5279
function.eio-fsync.php                             30-Sep-2022 11:10                5253
function.eio-ftruncate.php                         30-Sep-2022 11:10                5728
function.eio-futime.php                            30-Sep-2022 11:10                5980
function.eio-get-event-stream.php                  30-Sep-2022 11:10                8492
function.eio-get-last-error.php                    30-Sep-2022 11:10                2995
function.eio-grp-add.php                           30-Sep-2022 11:10               12106
function.eio-grp-cancel.php                        30-Sep-2022 11:10                3040
function.eio-grp-limit.php                         30-Sep-2022 11:10                2885
function.eio-grp.php                               30-Sep-2022 11:10               12164
function.eio-init.php                              30-Sep-2022 11:10                2527
function.eio-link.php                              30-Sep-2022 11:10               12528
function.eio-lstat.php                             30-Sep-2022 11:10                9595
function.eio-mkdir.php                             30-Sep-2022 11:10                8934
function.eio-mknod.php                             30-Sep-2022 11:10               10823
function.eio-nop.php                               30-Sep-2022 11:10                4865
function.eio-npending.php                          30-Sep-2022 11:10                2956
function.eio-nready.php                            30-Sep-2022 11:10                2704
function.eio-nreqs.php                             30-Sep-2022 11:10                5576
function.eio-nthreads.php                          30-Sep-2022 11:10                3423
function.eio-open.php                              30-Sep-2022 11:10               11506
function.eio-poll.php                              30-Sep-2022 11:10                5740
function.eio-read.php                              30-Sep-2022 11:10               12822
function.eio-readahead.php                         30-Sep-2022 11:10                5692
function.eio-readdir.php                           30-Sep-2022 11:10               15625
function.eio-readlink.php                          30-Sep-2022 11:10               12229
function.eio-realpath.php                          30-Sep-2022 11:10                5111
function.eio-rename.php                            30-Sep-2022 11:10                9037
function.eio-rmdir.php                             30-Sep-2022 11:10                7974
function.eio-seek.php                              30-Sep-2022 11:10                6385
function.eio-sendfile.php                          30-Sep-2022 11:10                5961
function.eio-set-max-idle.php                      30-Sep-2022 11:10                3064
function.eio-set-max-parallel.php                  30-Sep-2022 11:10                3113
function.eio-set-max-poll-reqs.php                 30-Sep-2022 11:10                2381
function.eio-set-max-poll-time.php                 30-Sep-2022 11:10                2451
function.eio-set-min-parallel.php                  30-Sep-2022 11:10                3102
function.eio-stat.php                              30-Sep-2022 11:10                9567
function.eio-statvfs.php                           30-Sep-2022 11:10                7932
function.eio-symlink.php                           30-Sep-2022 11:10               10662
function.eio-sync-file-range.php                   30-Sep-2022 11:10                6548
function.eio-sync.php                              30-Sep-2022 11:10                2729
function.eio-syncfs.php                            30-Sep-2022 11:10                4814
function.eio-truncate.php                          30-Sep-2022 11:10                5604
function.eio-unlink.php                            30-Sep-2022 11:10                4819
function.eio-utime.php                             30-Sep-2022 11:10                5588
function.eio-write.php                             30-Sep-2022 11:10                6351
function.empty.php                                 30-Sep-2022 11:11                9409
function.enchant-broker-describe.php               30-Sep-2022 11:10                5908
function.enchant-broker-dict-exists.php            30-Sep-2022 11:10                5603
function.enchant-broker-free-dict.php              30-Sep-2022 11:10                4684
function.enchant-broker-free.php                   30-Sep-2022 11:10                4221
function.enchant-broker-get-dict-path.php          30-Sep-2022 11:10                5040
function.enchant-broker-get-error.php              30-Sep-2022 11:10                3524
function.enchant-broker-init.php                   30-Sep-2022 11:10                3411
function.enchant-broker-list-dicts.php             30-Sep-2022 11:10                6774
function.enchant-broker-request-dict.php           30-Sep-2022 11:10                7038
function.enchant-broker-request-pwl-dict.php       30-Sep-2022 11:10                5282
function.enchant-broker-set-dict-path.php          30-Sep-2022 11:10                5242
function.enchant-broker-set-ordering.php           30-Sep-2022 11:10                4526
function.enchant-dict-add-to-personal.php          30-Sep-2022 11:10                2197
function.enchant-dict-add-to-session.php           30-Sep-2022 11:10                4363
function.enchant-dict-add.php                      30-Sep-2022 11:10                6260
function.enchant-dict-check.php                    30-Sep-2022 11:10                3922
function.enchant-dict-describe.php                 30-Sep-2022 11:10                6420
function.enchant-dict-get-error.php                30-Sep-2022 11:10                3727
function.enchant-dict-is-added.php                 30-Sep-2022 11:10                4276
function.enchant-dict-is-in-session.php            30-Sep-2022 11:10                2183
function.enchant-dict-quick-check.php              30-Sep-2022 11:10                7998
function.enchant-dict-store-replacement.php        30-Sep-2022 11:10                4471
function.enchant-dict-suggest.php                  30-Sep-2022 11:10                7689
function.end.php                                   30-Sep-2022 11:11                6015
function.enum-exists.php                           30-Sep-2022 11:11                5170
function.error-clear-last.php                      30-Sep-2022 11:10                4551
function.error-get-last.php                        30-Sep-2022 11:10                4758
function.error-log.php                             30-Sep-2022 11:10               10607
function.error-reporting.php                       30-Sep-2022 11:10                8562
function.escapeshellarg.php                        30-Sep-2022 11:10                5425
function.escapeshellcmd.php                        30-Sep-2022 11:10                7740
function.eval.php                                  30-Sep-2022 11:10                9039
function.exec.php                                  30-Sep-2022 11:10                9168
function.exif-imagetype.php                        30-Sep-2022 11:10                8683
function.exif-read-data.php                        30-Sep-2022 11:10               22628
function.exif-tagname.php                          30-Sep-2022 11:10                4636
function.exif-thumbnail.php                        30-Sep-2022 11:10                8788
function.exit.php                                  30-Sep-2022 11:10                9473
function.exp.php                                   30-Sep-2022 11:10                4212
function.expect-expectl.php                        30-Sep-2022 11:10               11468
function.expect-popen.php                          30-Sep-2022 11:10                4550
function.explode.php                               30-Sep-2022 11:11               15001
function.expm1.php                                 30-Sep-2022 11:10                3291
function.extension-loaded.php                      30-Sep-2022 11:10                5510
function.extract.php                               30-Sep-2022 11:11               13076
function.ezmlm-hash.php                            30-Sep-2022 11:10                4612
function.fann-cascadetrain-on-data.php             30-Sep-2022 11:10                6044
function.fann-cascadetrain-on-file.php             30-Sep-2022 11:10                5136
function.fann-clear-scaling-params.php             30-Sep-2022 11:10                2450
function.fann-copy.php                             30-Sep-2022 11:10                3035
function.fann-create-from-file.php                 30-Sep-2022 11:10                3066
function.fann-create-shortcut-array.php            30-Sep-2022 11:10                3953
function.fann-create-shortcut.php                  30-Sep-2022 11:10                4865
function.fann-create-sparse-array.php              30-Sep-2022 11:10                4538
function.fann-create-sparse.php                    30-Sep-2022 11:10                5188
function.fann-create-standard-array.php            30-Sep-2022 11:10                4266
function.fann-create-standard.php                  30-Sep-2022 11:10                4933
function.fann-create-train-from-callback.php       30-Sep-2022 11:10                9153
function.fann-create-train.php                     30-Sep-2022 11:10                4327
function.fann-descale-input.php                    30-Sep-2022 11:10                3491
function.fann-descale-output.php                   30-Sep-2022 11:10                3507
function.fann-descale-train.php                    30-Sep-2022 11:10                3427
function.fann-destroy-train.php                    30-Sep-2022 11:10                2405
function.fann-destroy.php                          30-Sep-2022 11:10                2437
function.fann-duplicate-train-data.php             30-Sep-2022 11:10                2571
function.fann-get-activation-function.php          30-Sep-2022 11:10                5006
function.fann-get-activation-steepness.php         30-Sep-2022 11:10                5419
function.fann-get-bias-array.php                   30-Sep-2022 11:10                2426
function.fann-get-bit-fail-limit.php               30-Sep-2022 11:10                3554
function.fann-get-bit-fail.php                     30-Sep-2022 11:10                4777
function.fann-get-cascade-activation-functions-..> 30-Sep-2022 11:10                3666
function.fann-get-cascade-activation-functions.php 30-Sep-2022 11:10                4122
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:10                3722
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:10                3873
function.fann-get-cascade-candidate-change-frac..> 30-Sep-2022 11:10                4994
function.fann-get-cascade-candidate-limit.php      30-Sep-2022 11:10                3354
function.fann-get-cascade-candidate-stagnation-..> 30-Sep-2022 11:10                4105
function.fann-get-cascade-max-cand-epochs.php      30-Sep-2022 11:10                3236
function.fann-get-cascade-max-out-epochs.php       30-Sep-2022 11:10                3157
function.fann-get-cascade-min-cand-epochs.php      30-Sep-2022 11:10                3536
function.fann-get-cascade-min-out-epochs.php       30-Sep-2022 11:10                3493
function.fann-get-cascade-num-candidate-groups.php 30-Sep-2022 11:10                3634
function.fann-get-cascade-num-candidates.php       30-Sep-2022 11:10                5828
function.fann-get-cascade-output-change-fractio..> 30-Sep-2022 11:10                4922
function.fann-get-cascade-output-stagnation-epo..> 30-Sep-2022 11:10                4048
function.fann-get-cascade-weight-multiplier.php    30-Sep-2022 11:10                3312
function.fann-get-connection-array.php             30-Sep-2022 11:10                2453
function.fann-get-connection-rate.php              30-Sep-2022 11:10                2524
function.fann-get-errno.php                        30-Sep-2022 11:10                2946
function.fann-get-errstr.php                       30-Sep-2022 11:10                2949
function.fann-get-layer-array.php                  30-Sep-2022 11:10                2527
function.fann-get-learning-momentum.php            30-Sep-2022 11:10                3542
function.fann-get-learning-rate.php                30-Sep-2022 11:10                3400
function.fann-get-mse.php                          30-Sep-2022 11:10                3017
function.fann-get-network-type.php                 30-Sep-2022 11:10                2494
function.fann-get-num-input.php                    30-Sep-2022 11:10                2381
function.fann-get-num-layers.php                   30-Sep-2022 11:10                2436
function.fann-get-num-output.php                   30-Sep-2022 11:10                2400
function.fann-get-quickprop-decay.php              30-Sep-2022 11:10                3169
function.fann-get-quickprop-mu.php                 30-Sep-2022 11:10                3062
function.fann-get-rprop-decrease-factor.php        30-Sep-2022 11:10                3123
function.fann-get-rprop-delta-max.php              30-Sep-2022 11:10                3200
function.fann-get-rprop-delta-min.php              30-Sep-2022 11:10                2996
function.fann-get-rprop-delta-zero.php             30-Sep-2022 11:10                3399
function.fann-get-rprop-increase-factor.php        30-Sep-2022 11:10                3148
function.fann-get-sarprop-step-error-shift.php     30-Sep-2022 11:10                3453
function.fann-get-sarprop-step-error-threshold-..> 30-Sep-2022 11:10                3605
function.fann-get-sarprop-temperature.php          30-Sep-2022 11:10                3367
function.fann-get-sarprop-weight-decay-shift.php   30-Sep-2022 11:10                3434
function.fann-get-total-connections.php            30-Sep-2022 11:10                2573
function.fann-get-total-neurons.php                30-Sep-2022 11:10                2620
function.fann-get-train-error-function.php         30-Sep-2022 11:10                3339
function.fann-get-train-stop-function.php          30-Sep-2022 11:10                3327
function.fann-get-training-algorithm.php           30-Sep-2022 11:10                3499
function.fann-init-weights.php                     30-Sep-2022 11:10                4078
function.fann-length-train-data.php                30-Sep-2022 11:10                2570
function.fann-merge-train-data.php                 30-Sep-2022 11:10                2790
function.fann-num-input-train-data.php             30-Sep-2022 11:10                3306
function.fann-num-output-train-data.php            30-Sep-2022 11:10                3304
function.fann-print-error.php                      30-Sep-2022 11:10                2764
function.fann-randomize-weights.php                30-Sep-2022 11:10                3612
function.fann-read-train-from-file.php             30-Sep-2022 11:10                4917
function.fann-reset-errno.php                      30-Sep-2022 11:10                2955
function.fann-reset-errstr.php                     30-Sep-2022 11:10                2936
function.fann-reset-mse.php                        30-Sep-2022 11:10                3241
function.fann-run.php                              30-Sep-2022 11:10                2636
function.fann-save-train.php                       30-Sep-2022 11:10                3216
function.fann-save.php                             30-Sep-2022 11:10                4027
function.fann-scale-input-train-data.php           30-Sep-2022 11:10                3806
function.fann-scale-input.php                      30-Sep-2022 11:10                3505
function.fann-scale-output-train-data.php          30-Sep-2022 11:10                3834
function.fann-scale-output.php                     30-Sep-2022 11:10                3509
function.fann-scale-train-data.php                 30-Sep-2022 11:10                3804
function.fann-scale-train.php                      30-Sep-2022 11:10                3445
function.fann-set-activation-function-hidden.php   30-Sep-2022 11:10                4230
function.fann-set-activation-function-layer.php    30-Sep-2022 11:10                4690
function.fann-set-activation-function-output.php   30-Sep-2022 11:10                4246
function.fann-set-activation-function.php          30-Sep-2022 11:10                5954
function.fann-set-activation-steepness-hidden.php  30-Sep-2022 11:10                4531
function.fann-set-activation-steepness-layer.php   30-Sep-2022 11:10                4942
function.fann-set-activation-steepness-output.php  30-Sep-2022 11:10                4512
function.fann-set-activation-steepness.php         30-Sep-2022 11:10                5784
function.fann-set-bit-fail-limit.php               30-Sep-2022 11:10                3174
function.fann-set-callback.php                     30-Sep-2022 11:10                5228
function.fann-set-cascade-activation-functions.php 30-Sep-2022 11:10                3845
function.fann-set-cascade-activation-steepnesse..> 30-Sep-2022 11:10                4058
function.fann-set-cascade-candidate-change-frac..> 30-Sep-2022 11:10                3525
function.fann-set-cascade-candidate-limit.php      30-Sep-2022 11:10                3332
function.fann-set-cascade-candidate-stagnation-..> 30-Sep-2022 11:10                3587
function.fann-set-cascade-max-cand-epochs.php      30-Sep-2022 11:10                3333
function.fann-set-cascade-max-out-epochs.php       30-Sep-2022 11:10                3284
function.fann-set-cascade-min-cand-epochs.php      30-Sep-2022 11:10                3638
function.fann-set-cascade-min-out-epochs.php       30-Sep-2022 11:10                3620
function.fann-set-cascade-num-candidate-groups.php 30-Sep-2022 11:10                3418
function.fann-set-cascade-output-change-fractio..> 30-Sep-2022 11:10                3482
function.fann-set-cascade-output-stagnation-epo..> 30-Sep-2022 11:10                3548
function.fann-set-cascade-weight-multiplier.php    30-Sep-2022 11:10                3317
function.fann-set-error-log.php                    30-Sep-2022 11:10                2709
function.fann-set-input-scaling-params.php         30-Sep-2022 11:10                4082
function.fann-set-learning-momentum.php            30-Sep-2022 11:10                3573
function.fann-set-learning-rate.php                30-Sep-2022 11:10                3499
function.fann-set-output-scaling-params.php        30-Sep-2022 11:10                4102
function.fann-set-quickprop-decay.php              30-Sep-2022 11:10                3245
function.fann-set-quickprop-mu.php                 30-Sep-2022 11:10                3100
function.fann-set-rprop-decrease-factor.php        30-Sep-2022 11:10                3302
function.fann-set-rprop-delta-max.php              30-Sep-2022 11:10                3429
function.fann-set-rprop-delta-min.php              30-Sep-2022 11:10                3220
function.fann-set-rprop-delta-zero.php             30-Sep-2022 11:10                3632
function.fann-set-rprop-increase-factor.php        30-Sep-2022 11:10                3328
function.fann-set-sarprop-step-error-shift.php     30-Sep-2022 11:10                3688
function.fann-set-sarprop-step-error-threshold-..> 30-Sep-2022 11:10                3882
function.fann-set-sarprop-temperature.php          30-Sep-2022 11:10                3599
function.fann-set-sarprop-weight-decay-shift.php   30-Sep-2022 11:10                3682
function.fann-set-scaling-params.php               30-Sep-2022 11:10                5026
function.fann-set-train-error-function.php         30-Sep-2022 11:10                3514
function.fann-set-train-stop-function.php          30-Sep-2022 11:10                3502
function.fann-set-training-algorithm.php           30-Sep-2022 11:10                3450
function.fann-set-weight-array.php                 30-Sep-2022 11:10                2938
function.fann-set-weight.php                       30-Sep-2022 11:10                3278
function.fann-shuffle-train-data.php               30-Sep-2022 11:10                2605
function.fann-subset-train-data.php                30-Sep-2022 11:10                3850
function.fann-test-data.php                        30-Sep-2022 11:10                3935
function.fann-test.php                             30-Sep-2022 11:10                4252
function.fann-train-epoch.php                      30-Sep-2022 11:10                4294
function.fann-train-on-data.php                    30-Sep-2022 11:10                6065
function.fann-train-on-file.php                    30-Sep-2022 11:10                6084
function.fann-train.php                            30-Sep-2022 11:10                4276
function.fastcgi-finish-request.php                30-Sep-2022 11:11                2413
function.fbird-add-user.php                        30-Sep-2022 11:10                2338
function.fbird-affected-rows.php                   30-Sep-2022 11:10                2351
function.fbird-backup.php                          30-Sep-2022 11:10                1737
function.fbird-blob-add.php                        30-Sep-2022 11:10                2697
function.fbird-blob-cancel.php                     30-Sep-2022 11:10                3505
function.fbird-blob-close.php                      30-Sep-2022 11:10                2728
function.fbird-blob-create.php                     30-Sep-2022 11:10                2728
function.fbird-blob-echo.php                       30-Sep-2022 11:10                2516
function.fbird-blob-get.php                        30-Sep-2022 11:10                2509
function.fbird-blob-import.php                     30-Sep-2022 11:10                2724
function.fbird-blob-info.php                       30-Sep-2022 11:10                1769
function.fbird-blob-open.php                       30-Sep-2022 11:10                2506
function.fbird-close.php                           30-Sep-2022 11:10                2274
function.fbird-commit-ret.php                      30-Sep-2022 11:10                1762
function.fbird-commit.php                          30-Sep-2022 11:10                1730
function.fbird-connect.php                         30-Sep-2022 11:10                2280
function.fbird-db-info.php                         30-Sep-2022 11:10                1743
function.fbird-delete-user.php                     30-Sep-2022 11:10                2348
function.fbird-drop-db.php                         30-Sep-2022 11:10                2296
function.fbird-errcode.php                         30-Sep-2022 11:10                2101
function.fbird-errmsg.php                          30-Sep-2022 11:10                2094
function.fbird-execute.php                         30-Sep-2022 11:10                2106
function.fbird-fetch-assoc.php                     30-Sep-2022 11:10                2364
function.fbird-fetch-object.php                    30-Sep-2022 11:10                2375
function.fbird-fetch-row.php                       30-Sep-2022 11:10                2352
function.fbird-field-info.php                      30-Sep-2022 11:10                2176
function.fbird-free-event-handler.php              30-Sep-2022 11:10                2280
function.fbird-free-query.php                      30-Sep-2022 11:10                1798
function.fbird-free-result.php                     30-Sep-2022 11:10                1783
function.fbird-gen-id.php                          30-Sep-2022 11:10                1740
function.fbird-maintain-db.php                     30-Sep-2022 11:10                1785
function.fbird-modify-user.php                     30-Sep-2022 11:10                2364
function.fbird-name-result.php                     30-Sep-2022 11:10                2347
function.fbird-num-fields.php                      30-Sep-2022 11:10                2165
function.fbird-num-params.php                      30-Sep-2022 11:10                2342
function.fbird-param-info.php                      30-Sep-2022 11:10                2347
function.fbird-pconnect.php                        30-Sep-2022 11:10                2297
function.fbird-prepare.php                         30-Sep-2022 11:10                1733
function.fbird-query.php                           30-Sep-2022 11:10                2649
function.fbird-restore.php                         30-Sep-2022 11:10                1740
function.fbird-rollback-ret.php                    30-Sep-2022 11:10                1792
function.fbird-rollback.php                        30-Sep-2022 11:10                1764
function.fbird-server-info.php                     30-Sep-2022 11:10                1795
function.fbird-service-attach.php                  30-Sep-2022 11:10                1834
function.fbird-service-detach.php                  30-Sep-2022 11:10                1846
function.fbird-set-event-handler.php               30-Sep-2022 11:10                2457
function.fbird-trans.php                           30-Sep-2022 11:10                1739
function.fbird-wait-event.php                      30-Sep-2022 11:10                2382
function.fclose.php                                30-Sep-2022 11:10                4368
function.fdatasync.php                             30-Sep-2022 11:10                5905
function.fdf-add-doc-javascript.php                30-Sep-2022 11:10                5200
function.fdf-add-template.php                      30-Sep-2022 11:10                2501
function.fdf-close.php                             30-Sep-2022 11:10                2980
function.fdf-create.php                            30-Sep-2022 11:10                5549
function.fdf-enum-values.php                       30-Sep-2022 11:10                2351
function.fdf-errno.php                             30-Sep-2022 11:10                2686
function.fdf-error.php                             30-Sep-2022 11:10                3075
function.fdf-get-ap.php                            30-Sep-2022 11:10                3847
function.fdf-get-attachment.php                    30-Sep-2022 11:10                5931
function.fdf-get-encoding.php                      30-Sep-2022 11:10                3251
function.fdf-get-file.php                          30-Sep-2022 11:10                3071
function.fdf-get-flags.php                         30-Sep-2022 11:10                2113
function.fdf-get-opt.php                           30-Sep-2022 11:10                2251
function.fdf-get-status.php                        30-Sep-2022 11:10                3090
function.fdf-get-value.php                         30-Sep-2022 11:10                4385
function.fdf-get-version.php                       30-Sep-2022 11:10                3450
function.fdf-header.php                            30-Sep-2022 11:10                2267
function.fdf-next-field-name.php                   30-Sep-2022 11:10                5327
function.fdf-open-string.php                       30-Sep-2022 11:10                4727
function.fdf-open.php                              30-Sep-2022 11:10                5833
function.fdf-remove-item.php                       30-Sep-2022 11:10                2125
function.fdf-save-string.php                       30-Sep-2022 11:10                5492
function.fdf-save.php                              30-Sep-2022 11:10                3838
function.fdf-set-ap.php                            30-Sep-2022 11:10                4020
function.fdf-set-encoding.php                      30-Sep-2022 11:10                3471
function.fdf-set-file.php                          30-Sep-2022 11:10                6710
function.fdf-set-flags.php                         30-Sep-2022 11:10                4006
function.fdf-set-javascript-action.php             30-Sep-2022 11:10                4201
function.fdf-set-on-import-javascript.php          30-Sep-2022 11:10                2936
function.fdf-set-opt.php                           30-Sep-2022 11:10                4231
function.fdf-set-status.php                        30-Sep-2022 11:10                3527
function.fdf-set-submit-form-action.php            30-Sep-2022 11:10                4446
function.fdf-set-target-frame.php                  30-Sep-2022 11:10                3527
function.fdf-set-value.php                         30-Sep-2022 11:10                4975
function.fdf-set-version.php                       30-Sep-2022 11:10                3751
function.fdiv.php                                  30-Sep-2022 11:10                5970
function.feof.php                                  30-Sep-2022 11:10                5496
function.fflush.php                                30-Sep-2022 11:10                5519
function.fgetc.php                                 30-Sep-2022 11:10                6606
function.fgetcsv.php                               30-Sep-2022 11:10               12778
function.fgets.php                                 30-Sep-2022 11:10                8684
function.fgetss.php                                30-Sep-2022 11:10                9727
function.file-exists.php                           30-Sep-2022 11:10                7182
function.file-get-contents.php                     30-Sep-2022 11:10               17998
function.file-put-contents.php                     30-Sep-2022 11:10               12784
function.file.php                                  30-Sep-2022 11:10               11604
function.fileatime.php                             30-Sep-2022 11:10                7046
function.filectime.php                             30-Sep-2022 11:10                7120
function.filegroup.php                             30-Sep-2022 11:10                5515
function.fileinode.php                             30-Sep-2022 11:10                5319
function.filemtime.php                             30-Sep-2022 11:10                6848
function.fileowner.php                             30-Sep-2022 11:10                5503
function.fileperms.php                             30-Sep-2022 11:10               18122
function.filesize.php                              30-Sep-2022 11:10                5715
function.filetype.php                              30-Sep-2022 11:10                6544
function.filter-has-var.php                        30-Sep-2022 11:11                2839
function.filter-id.php                             30-Sep-2022 11:11                2770
function.filter-input-array.php                    30-Sep-2022 11:11               13607
function.filter-input.php                          30-Sep-2022 11:11                7591
function.filter-list.php                           30-Sep-2022 11:11                3565
function.filter-var-array.php                      30-Sep-2022 11:11               13267
function.filter-var.php                            30-Sep-2022 11:11               13486
function.finfo-buffer.php                          30-Sep-2022 11:10                7810
function.finfo-close.php                           30-Sep-2022 11:10                3360
function.finfo-file.php                            30-Sep-2022 11:10                8240
function.finfo-open.php                            30-Sep-2022 11:10                9930
function.finfo-set-flags.php                       30-Sep-2022 11:10                4425
function.floatval.php                              30-Sep-2022 11:11                6315
function.flock.php                                 30-Sep-2022 11:10               13088
function.floor.php                                 30-Sep-2022 11:10                5017
function.flush.php                                 30-Sep-2022 11:10                4836
function.fmod.php                                  30-Sep-2022 11:10                4933
function.fnmatch.php                               30-Sep-2022 11:10                9068
function.fopen.php                                 30-Sep-2022 11:10               23337
function.forward-static-call-array.php             30-Sep-2022 11:11               10147
function.forward-static-call.php                   30-Sep-2022 11:11                9660
function.fpassthru.php                             30-Sep-2022 11:10                7337
function.fpm-get-status.php                        30-Sep-2022 11:11                2465
function.fprintf.php                               30-Sep-2022 11:11               18763
function.fputcsv.php                               30-Sep-2022 11:10               10217
function.fputs.php                                 30-Sep-2022 11:10                1642
function.fread.php                                 30-Sep-2022 11:10               14938
function.frenchtojd.php                            30-Sep-2022 11:10                3972
function.fscanf.php                                30-Sep-2022 11:10                9372
function.fseek.php                                 30-Sep-2022 11:10                7763
function.fsockopen.php                             30-Sep-2022 11:11               17217
function.fstat.php                                 30-Sep-2022 11:10                5908
function.fsync.php                                 30-Sep-2022 11:10                5667
function.ftell.php                                 30-Sep-2022 11:10                6234
function.ftok.php                                  30-Sep-2022 11:10                3482
function.ftp-alloc.php                             30-Sep-2022 11:11                8103
function.ftp-append.php                            30-Sep-2022 11:11                4107
function.ftp-cdup.php                              30-Sep-2022 11:11                6712
function.ftp-chdir.php                             30-Sep-2022 11:11                7689
function.ftp-chmod.php                             30-Sep-2022 11:11                7204
function.ftp-close.php                             30-Sep-2022 11:11                5974
function.ftp-connect.php                           30-Sep-2022 11:11                6570
function.ftp-delete.php                            30-Sep-2022 11:11                6214
function.ftp-exec.php                              30-Sep-2022 11:11                6742
function.ftp-fget.php                              30-Sep-2022 11:11                9736
function.ftp-fput.php                              30-Sep-2022 11:11                9346
function.ftp-get-option.php                        30-Sep-2022 11:11                5940
function.ftp-get.php                               30-Sep-2022 11:11                8958
function.ftp-login.php                             30-Sep-2022 11:11                6825
function.ftp-mdtm.php                              30-Sep-2022 11:11                7430
function.ftp-mkdir.php                             30-Sep-2022 11:11                6819
function.ftp-mlsd.php                              30-Sep-2022 11:11                9100
function.ftp-nb-continue.php                       30-Sep-2022 11:11                5479
function.ftp-nb-fget.php                           30-Sep-2022 11:11               10277
function.ftp-nb-fput.php                           30-Sep-2022 11:11               10151
function.ftp-nb-get.php                            30-Sep-2022 11:11               14487
function.ftp-nb-put.php                            30-Sep-2022 11:11               11846
function.ftp-nlist.php                             30-Sep-2022 11:11                7090
function.ftp-pasv.php                              30-Sep-2022 11:11                7596
function.ftp-put.php                               30-Sep-2022 11:11                9129
function.ftp-pwd.php                               30-Sep-2022 11:11                6297
function.ftp-quit.php                              30-Sep-2022 11:11                1651
function.ftp-raw.php                               30-Sep-2022 11:11                5474
function.ftp-rawlist.php                           30-Sep-2022 11:11                8355
function.ftp-rename.php                            30-Sep-2022 11:11                7183
function.ftp-rmdir.php                             30-Sep-2022 11:11                6534
function.ftp-set-option.php                        30-Sep-2022 11:11                6874
function.ftp-site.php                              30-Sep-2022 11:11                6780
function.ftp-size.php                              30-Sep-2022 11:11                7000
function.ftp-ssl-connect.php                       30-Sep-2022 11:11                8876
function.ftp-systype.php                           30-Sep-2022 11:11                5529
function.ftruncate.php                             30-Sep-2022 11:10                6384
function.func-get-arg.php                          30-Sep-2022 11:11               11786
function.func-get-args.php                         30-Sep-2022 11:11               12573
function.func-num-args.php                         30-Sep-2022 11:11                5958
function.function-exists.php                       30-Sep-2022 11:11                5961
function.fwrite.php                                30-Sep-2022 11:10               15282
function.gc-collect-cycles.php                     30-Sep-2022 11:10                2615
function.gc-disable.php                            30-Sep-2022 11:10                2553
function.gc-enable.php                             30-Sep-2022 11:10                2526
function.gc-enabled.php                            30-Sep-2022 11:10                3272
function.gc-mem-caches.php                         30-Sep-2022 11:10                2459
function.gc-status.php                             30-Sep-2022 11:10                5949
function.gd-info.php                               30-Sep-2022 11:10                8753
function.geoip-asnum-by-name.php                   30-Sep-2022 11:10                4092
function.geoip-continent-code-by-name.php          30-Sep-2022 11:10                5631
function.geoip-country-code-by-name.php            30-Sep-2022 11:10                5366
function.geoip-country-code3-by-name.php           30-Sep-2022 11:10                4931
function.geoip-country-name-by-name.php            30-Sep-2022 11:10                4896
function.geoip-database-info.php                   30-Sep-2022 11:10                4111
function.geoip-db-avail.php                        30-Sep-2022 11:10                4250
function.geoip-db-filename.php                     30-Sep-2022 11:10                3987
function.geoip-db-get-all-info.php                 30-Sep-2022 11:10                6733
function.geoip-domain-by-name.php                  30-Sep-2022 11:10                4319
function.geoip-id-by-name.php                      30-Sep-2022 11:10                5855
function.geoip-isp-by-name.php                     30-Sep-2022 11:10                4343
function.geoip-netspeedcell-by-name.php            30-Sep-2022 11:10                5066
function.geoip-org-by-name.php                     30-Sep-2022 11:10                4362
function.geoip-record-by-name.php                  30-Sep-2022 11:10                7529
function.geoip-region-by-name.php                  30-Sep-2022 11:10                4980
function.geoip-region-name-by-code.php             30-Sep-2022 11:10                7089
function.geoip-setup-custom-directory.php          30-Sep-2022 11:10                4111
function.geoip-time-zone-by-country-and-region.php 30-Sep-2022 11:10                7299
function.get-browser.php                           30-Sep-2022 11:10                8032
function.get-called-class.php                      30-Sep-2022 11:11                5075
function.get-cfg-var.php                           30-Sep-2022 11:10                3725
function.get-class-methods.php                     30-Sep-2022 11:11                7297
function.get-class-vars.php                        30-Sep-2022 11:11               10404
function.get-class.php                             30-Sep-2022 11:11               13214
function.get-current-user.php                      30-Sep-2022 11:10                4485
function.get-debug-type.php                        30-Sep-2022 11:11                9805
function.get-declared-classes.php                  30-Sep-2022 11:11                5325
function.get-declared-interfaces.php               30-Sep-2022 11:11                4262
function.get-declared-traits.php                   30-Sep-2022 11:11                2940
function.get-defined-constants.php                 30-Sep-2022 11:10                7506
function.get-defined-functions.php                 30-Sep-2022 11:11                7096
function.get-defined-vars.php                      30-Sep-2022 11:11                6470
function.get-extension-funcs.php                   30-Sep-2022 11:10                5524
function.get-headers.php                           30-Sep-2022 11:11                8974
function.get-html-translation-table.php            30-Sep-2022 11:11               13385
function.get-include-path.php                      30-Sep-2022 11:10                4411
function.get-included-files.php                    30-Sep-2022 11:10                5965
function.get-loaded-extensions.php                 30-Sep-2022 11:10                5071
function.get-magic-quotes-gpc.php                  30-Sep-2022 11:10                3977
function.get-magic-quotes-runtime.php              30-Sep-2022 11:10                4895
function.get-mangled-object-vars.php               30-Sep-2022 11:11                8293
function.get-meta-tags.php                         30-Sep-2022 11:11                8190
function.get-object-vars.php                       30-Sep-2022 11:11                6349
function.get-parent-class.php                      30-Sep-2022 11:11                7919
function.get-required-files.php                    30-Sep-2022 11:10                1827
function.get-resource-id.php                       30-Sep-2022 11:11                4717
function.get-resource-type.php                     30-Sep-2022 11:11                5211
function.get-resources.php                         30-Sep-2022 11:10                7706
function.getallheaders.php                         30-Sep-2022 11:11                4927
function.getcwd.php                                30-Sep-2022 11:10                5274
function.getdate.php                               30-Sep-2022 11:10                9543
function.getenv.php                                30-Sep-2022 11:10                7901
function.gethostbyaddr.php                         30-Sep-2022 11:11                4198
function.gethostbyname.php                         30-Sep-2022 11:11                4495
function.gethostbynamel.php                        30-Sep-2022 11:11                4972
function.gethostname.php                           30-Sep-2022 11:11                3969
function.getimagesize.php                          30-Sep-2022 11:10               17632
function.getimagesizefromstring.php                30-Sep-2022 11:10                5542
function.getlastmod.php                            30-Sep-2022 11:10                6450
function.getmxrr.php                               30-Sep-2022 11:11                5763
function.getmygid.php                              30-Sep-2022 11:10                3547
function.getmyinode.php                            30-Sep-2022 11:10                3590
function.getmypid.php                              30-Sep-2022 11:10                3833
function.getmyuid.php                              30-Sep-2022 11:10                3537
function.getopt.php                                30-Sep-2022 11:10               15771
function.getprotobyname.php                        30-Sep-2022 11:11                4679
function.getprotobynumber.php                      30-Sep-2022 11:11                3169
function.getrandmax.php                            30-Sep-2022 11:10                2930
function.getrusage.php                             30-Sep-2022 11:10               11981
function.getservbyname.php                         30-Sep-2022 11:11                6430
function.getservbyport.php                         30-Sep-2022 11:11                3625
function.gettext.php                               30-Sep-2022 11:10                5909
function.gettimeofday.php                          30-Sep-2022 11:10                4644
function.gettype.php                               30-Sep-2022 11:11                9347
function.glob.php                                  30-Sep-2022 11:10                9686
function.gmdate.php                                30-Sep-2022 11:10                7678
function.gmmktime.php                              30-Sep-2022 11:10               10100
function.gmp-abs.php                               30-Sep-2022 11:10                4291
function.gmp-add.php                               30-Sep-2022 11:10                4412
function.gmp-and.php                               30-Sep-2022 11:10                4893
function.gmp-binomial.php                          30-Sep-2022 11:10                3659
function.gmp-clrbit.php                            30-Sep-2022 11:10                5503
function.gmp-cmp.php                               30-Sep-2022 11:10                5292
function.gmp-com.php                               30-Sep-2022 11:10                3757
function.gmp-div-q.php                             30-Sep-2022 11:10                9583
function.gmp-div-qr.php                            30-Sep-2022 11:10                6312
function.gmp-div-r.php                             30-Sep-2022 11:10                5722
function.gmp-div.php                               30-Sep-2022 11:10                1659
function.gmp-divexact.php                          30-Sep-2022 11:10                5547
function.gmp-export.php                            30-Sep-2022 11:10                5254
function.gmp-fact.php                              30-Sep-2022 11:10                4744
function.gmp-gcd.php                               30-Sep-2022 11:10                4815
function.gmp-gcdext.php                            30-Sep-2022 11:10                9290
function.gmp-hamdist.php                           30-Sep-2022 11:10                6130
function.gmp-import.php                            30-Sep-2022 11:10                5716
function.gmp-init.php                              30-Sep-2022 11:10                5170
function.gmp-intval.php                            30-Sep-2022 11:10                5031
function.gmp-invert.php                            30-Sep-2022 11:10                4969
function.gmp-jacobi.php                            30-Sep-2022 11:10                5296
function.gmp-kronecker.php                         30-Sep-2022 11:10                3599
function.gmp-lcm.php                               30-Sep-2022 11:10                3413
function.gmp-legendre.php                          30-Sep-2022 11:10                5315
function.gmp-mod.php                               30-Sep-2022 11:10                4537
function.gmp-mul.php                               30-Sep-2022 11:10                4619
function.gmp-neg.php                               30-Sep-2022 11:10                4238
function.gmp-nextprime.php                         30-Sep-2022 11:10                4964
function.gmp-or.php                                30-Sep-2022 11:10                5118
function.gmp-perfect-power.php                     30-Sep-2022 11:10                3024
function.gmp-perfect-square.php                    30-Sep-2022 11:10                5353
function.gmp-popcount.php                          30-Sep-2022 11:10                4657
function.gmp-pow.php                               30-Sep-2022 11:10                5602
function.gmp-powm.php                              30-Sep-2022 11:10                5302
function.gmp-prob-prime.php                        30-Sep-2022 11:10                5481
function.gmp-random-bits.php                       30-Sep-2022 11:10                4547
function.gmp-random-range.php                      30-Sep-2022 11:10                5466
function.gmp-random-seed.php                       30-Sep-2022 11:10                6660
function.gmp-random.php                            30-Sep-2022 11:10                5351
function.gmp-root.php                              30-Sep-2022 11:10                2951
function.gmp-rootrem.php                           30-Sep-2022 11:10                3059
function.gmp-scan0.php                             30-Sep-2022 11:10                5358
function.gmp-scan1.php                             30-Sep-2022 11:10                5370
function.gmp-setbit.php                            30-Sep-2022 11:10               11837
function.gmp-sign.php                              30-Sep-2022 11:10                4977
function.gmp-sqrt.php                              30-Sep-2022 11:10                4835
function.gmp-sqrtrem.php                           30-Sep-2022 11:10                6247
function.gmp-strval.php                            30-Sep-2022 11:10                4409
function.gmp-sub.php                               30-Sep-2022 11:10                4711
function.gmp-testbit.php                           30-Sep-2022 11:10                5538
function.gmp-xor.php                               30-Sep-2022 11:10                5119
function.gmstrftime.php                            30-Sep-2022 11:10                9012
function.gnupg-adddecryptkey.php                   30-Sep-2022 11:10                5083
function.gnupg-addencryptkey.php                   30-Sep-2022 11:10                4683
function.gnupg-addsignkey.php                      30-Sep-2022 11:10                5100
function.gnupg-cleardecryptkeys.php                30-Sep-2022 11:10                4282
function.gnupg-clearencryptkeys.php                30-Sep-2022 11:10                4287
function.gnupg-clearsignkeys.php                   30-Sep-2022 11:10                4229
function.gnupg-decrypt.php                         30-Sep-2022 11:10                5849
function.gnupg-decryptverify.php                   30-Sep-2022 11:10                6957
function.gnupg-deletekey.php                       30-Sep-2022 11:10                4919
function.gnupg-encrypt.php                         30-Sep-2022 11:10                5777
function.gnupg-encryptsign.php                     30-Sep-2022 11:10                6677
function.gnupg-export.php                          30-Sep-2022 11:10                4946
function.gnupg-getengineinfo.php                   30-Sep-2022 11:10                5490
function.gnupg-geterror.php                        30-Sep-2022 11:10                4139
function.gnupg-geterrorinfo.php                    30-Sep-2022 11:10                5633
function.gnupg-getprotocol.php                     30-Sep-2022 11:10                4269
function.gnupg-gettrustlist.php                    30-Sep-2022 11:10                5013
function.gnupg-import.php                          30-Sep-2022 11:10                5202
function.gnupg-init.php                            30-Sep-2022 11:10                7015
function.gnupg-keyinfo.php                         30-Sep-2022 11:10                5134
function.gnupg-listsignatures.php                  30-Sep-2022 11:10                5242
function.gnupg-setarmor.php                        30-Sep-2022 11:10                5524
function.gnupg-seterrormode.php                    30-Sep-2022 11:10                5466
function.gnupg-setsignmode.php                     30-Sep-2022 11:10                5371
function.gnupg-sign.php                            30-Sep-2022 11:10                6019
function.gnupg-verify.php                          30-Sep-2022 11:10                8140
function.grapheme-extract.php                      30-Sep-2022 11:10                8772
function.grapheme-stripos.php                      30-Sep-2022 11:10                8417
function.grapheme-stristr.php                      30-Sep-2022 11:10                7702
function.grapheme-strlen.php                       30-Sep-2022 11:10                5710
function.grapheme-strpos.php                       30-Sep-2022 11:10                8066
function.grapheme-strripos.php                     30-Sep-2022 11:10                7767
function.grapheme-strrpos.php                      30-Sep-2022 11:10                7416
function.grapheme-strstr.php                       30-Sep-2022 11:10                7471
function.grapheme-substr.php                       30-Sep-2022 11:10                8459
function.gregoriantojd.php                         30-Sep-2022 11:10                7593
function.gzclose.php                               30-Sep-2022 11:10                4185
function.gzcompress.php                            30-Sep-2022 11:10                6073
function.gzdecode.php                              30-Sep-2022 11:10                3544
function.gzdeflate.php                             30-Sep-2022 11:10                5705
function.gzencode.php                              30-Sep-2022 11:10                6958
function.gzeof.php                                 30-Sep-2022 11:10                3984
function.gzfile.php                                30-Sep-2022 11:10                4771
function.gzgetc.php                                30-Sep-2022 11:10                4703
function.gzgets.php                                30-Sep-2022 11:10                6239
function.gzgetss.php                               30-Sep-2022 11:10                6110
function.gzinflate.php                             30-Sep-2022 11:10                5451
function.gzopen.php                                30-Sep-2022 11:10                5796
function.gzpassthru.php                            30-Sep-2022 11:10                4741
function.gzputs.php                                30-Sep-2022 11:10                1633
function.gzread.php                                30-Sep-2022 11:10                6201
function.gzrewind.php                              30-Sep-2022 11:10                3191
function.gzseek.php                                30-Sep-2022 11:10                6190
function.gztell.php                                30-Sep-2022 11:10                3423
function.gzuncompress.php                          30-Sep-2022 11:10                5435
function.gzwrite.php                               30-Sep-2022 11:10                6481
function.halt-compiler.php                         30-Sep-2022 11:10                4667
function.hash-algos.php                            30-Sep-2022 11:10                5857
function.hash-copy.php                             30-Sep-2022 11:10                5653
function.hash-equals.php                           30-Sep-2022 11:10                6495
function.hash-file.php                             30-Sep-2022 11:10                7537
function.hash-final.php                            30-Sep-2022 11:10                6438
function.hash-hkdf.php                             30-Sep-2022 11:10                8966
function.hash-hmac-algos.php                       30-Sep-2022 11:10                5359
function.hash-hmac-file.php                        30-Sep-2022 11:10                7712
function.hash-hmac.php                             30-Sep-2022 11:10                7313
function.hash-init.php                             30-Sep-2022 11:10                8672
function.hash-pbkdf2.php                           30-Sep-2022 11:10               11873
function.hash-update-file.php                      30-Sep-2022 11:10                5875
function.hash-update-stream.php                    30-Sep-2022 11:10                7309
function.hash-update.php                           30-Sep-2022 11:10                4516
function.hash.php                                  30-Sep-2022 11:10                7110
function.header-register-callback.php              30-Sep-2022 11:11                7036
function.header-remove.php                         30-Sep-2022 11:11                6869
function.header.php                                30-Sep-2022 11:11               18974
function.headers-list.php                          30-Sep-2022 11:11                6392
function.headers-sent.php                          30-Sep-2022 11:11                8364
function.hebrev.php                                30-Sep-2022 11:11                3249
function.hebrevc.php                               30-Sep-2022 11:11                3703
function.hex2bin.php                               30-Sep-2022 11:11                4831
function.hexdec.php                                30-Sep-2022 11:10                6275
function.highlight-file.php                        30-Sep-2022 11:10                5268
function.highlight-string.php                      30-Sep-2022 11:10                5591
function.hrtime.php                                30-Sep-2022 11:10                5029
function.html-entity-decode.php                    30-Sep-2022 11:11               11018
function.htmlentities.php                          30-Sep-2022 11:11               13934
function.htmlspecialchars-decode.php               30-Sep-2022 11:11                8906
function.htmlspecialchars.php                      30-Sep-2022 11:11               20297
function.http-build-query.php                      30-Sep-2022 11:11               20309
function.http-response-code.php                    30-Sep-2022 11:11                6762
function.hypot.php                                 30-Sep-2022 11:10                2866
function.ibase-add-user.php                        30-Sep-2022 11:10                4686
function.ibase-affected-rows.php                   30-Sep-2022 11:10                3333
function.ibase-backup.php                          30-Sep-2022 11:10               10011
function.ibase-blob-add.php                        30-Sep-2022 11:10                3880
function.ibase-blob-cancel.php                     30-Sep-2022 11:10                3504
function.ibase-blob-close.php                      30-Sep-2022 11:10                3851
function.ibase-blob-create.php                     30-Sep-2022 11:10                3837
function.ibase-blob-echo.php                       30-Sep-2022 11:10                3856
function.ibase-blob-get.php                        30-Sep-2022 11:10                6513
function.ibase-blob-import.php                     30-Sep-2022 11:10                8275
function.ibase-blob-info.php                       30-Sep-2022 11:10                3189
function.ibase-blob-open.php                       30-Sep-2022 11:10                4062
function.ibase-close.php                           30-Sep-2022 11:10                3540
function.ibase-commit-ret.php                      30-Sep-2022 11:10                3024
function.ibase-commit.php                          30-Sep-2022 11:10                2825
function.ibase-connect.php                         30-Sep-2022 11:10               10085
function.ibase-db-info.php                         30-Sep-2022 11:10                2384
function.ibase-delete-user.php                     30-Sep-2022 11:10                3326
function.ibase-drop-db.php                         30-Sep-2022 11:10                3438
function.ibase-errcode.php                         30-Sep-2022 11:10                2561
function.ibase-errmsg.php                          30-Sep-2022 11:10                2552
function.ibase-execute.php                         30-Sep-2022 11:10                6955
function.ibase-fetch-assoc.php                     30-Sep-2022 11:10                4502
function.ibase-fetch-object.php                    30-Sep-2022 11:10                6545
function.ibase-fetch-row.php                       30-Sep-2022 11:10                4267
function.ibase-field-info.php                      30-Sep-2022 11:10                7075
function.ibase-free-event-handler.php              30-Sep-2022 11:10                3312
function.ibase-free-query.php                      30-Sep-2022 11:10                2591
function.ibase-free-result.php                     30-Sep-2022 11:10                2683
function.ibase-gen-id.php                          30-Sep-2022 11:10                2610
function.ibase-maintain-db.php                     30-Sep-2022 11:10                2726
function.ibase-modify-user.php                     30-Sep-2022 11:10                4691
function.ibase-name-result.php                     30-Sep-2022 11:10                5677
function.ibase-num-fields.php                      30-Sep-2022 11:10                6640
function.ibase-num-params.php                      30-Sep-2022 11:10                3323
function.ibase-param-info.php                      30-Sep-2022 11:10                3521
function.ibase-pconnect.php                        30-Sep-2022 11:10                7362
function.ibase-prepare.php                         30-Sep-2022 11:10                4030
function.ibase-query.php                           30-Sep-2022 11:10                6956
function.ibase-restore.php                         30-Sep-2022 11:10               10090
function.ibase-rollback-ret.php                    30-Sep-2022 11:10                3065
function.ibase-rollback.php                        30-Sep-2022 11:10                2870
function.ibase-server-info.php                     30-Sep-2022 11:10               10803
function.ibase-service-attach.php                  30-Sep-2022 11:10               12729
function.ibase-service-detach.php                  30-Sep-2022 11:10                7004
function.ibase-set-event-handler.php               30-Sep-2022 11:10                7751
function.ibase-trans.php                           30-Sep-2022 11:10                5446
function.ibase-wait-event.php                      30-Sep-2022 11:10                3926
function.iconv-get-encoding.php                    30-Sep-2022 11:10                5876
function.iconv-mime-decode-headers.php             30-Sep-2022 11:10               10606
function.iconv-mime-decode.php                     30-Sep-2022 11:10                8427
function.iconv-mime-encode.php                     30-Sep-2022 11:10               11481
function.iconv-set-encoding.php                    30-Sep-2022 11:10                4865
function.iconv-strlen.php                          30-Sep-2022 11:10                4744
function.iconv-strpos.php                          30-Sep-2022 11:10                6761
function.iconv-strrpos.php                         30-Sep-2022 11:10                6104
function.iconv-substr.php                          30-Sep-2022 11:10                7457
function.iconv.php                                 30-Sep-2022 11:10                8573
function.idate.php                                 30-Sep-2022 11:10               11095
function.idn-to-ascii.php                          30-Sep-2022 11:10                7099
function.idn-to-utf8.php                           30-Sep-2022 11:10                7089
function.igbinary-serialize.php                    30-Sep-2022 11:10                9677
function.igbinary-unserialize.php                  30-Sep-2022 11:10                9106
function.ignore-user-abort.php                     30-Sep-2022 11:10                7572
function.image-type-to-extension.php               30-Sep-2022 11:10                5240
function.image-type-to-mime-type.php               30-Sep-2022 11:10                8119
function.image2wbmp.php                            30-Sep-2022 11:10                6470
function.imageaffine.php                           30-Sep-2022 11:10                4627
function.imageaffinematrixconcat.php               30-Sep-2022 11:10                6711
function.imageaffinematrixget.php                  30-Sep-2022 11:10                6199
function.imagealphablending.php                    30-Sep-2022 11:10                7487
function.imageantialias.php                        30-Sep-2022 11:10               11245
function.imagearc.php                              30-Sep-2022 11:10               13832
function.imageavif.php                             30-Sep-2022 11:10                5727
function.imagebmp.php                              30-Sep-2022 11:10                7754
function.imagechar.php                             30-Sep-2022 11:10                9945
function.imagecharup.php                           30-Sep-2022 11:10               10050
function.imagecolorallocate.php                    30-Sep-2022 11:10               10004
function.imagecolorallocatealpha.php               30-Sep-2022 11:10               18641
function.imagecolorat.php                          30-Sep-2022 11:10                9738
function.imagecolorclosest.php                     30-Sep-2022 11:10               12731
function.imagecolorclosestalpha.php                30-Sep-2022 11:10               12725
function.imagecolorclosesthwb.php                  30-Sep-2022 11:10                6562
function.imagecolordeallocate.php                  30-Sep-2022 11:10                5874
function.imagecolorexact.php                       30-Sep-2022 11:10                8543
function.imagecolorexactalpha.php                  30-Sep-2022 11:10                9372
function.imagecolormatch.php                       30-Sep-2022 11:10                8715
function.imagecolorresolve.php                     30-Sep-2022 11:10                7863
function.imagecolorresolvealpha.php                30-Sep-2022 11:10                8309
function.imagecolorset.php                         30-Sep-2022 11:10                8611
function.imagecolorsforindex.php                   30-Sep-2022 11:10                7599
function.imagecolorstotal.php                      30-Sep-2022 11:10                5999
function.imagecolortransparent.php                 30-Sep-2022 11:10                9047
function.imageconvolution.php                      30-Sep-2022 11:10               11984
function.imagecopy.php                             30-Sep-2022 11:10                9088
function.imagecopymerge.php                        30-Sep-2022 11:10                9280
function.imagecopymergegray.php                    30-Sep-2022 11:10                9690
function.imagecopyresampled.php                    30-Sep-2022 11:10               19583
function.imagecopyresized.php                      30-Sep-2022 11:10               14205
function.imagecreate.php                           30-Sep-2022 11:10                8536
function.imagecreatefromavif.php                   30-Sep-2022 11:10                2790
function.imagecreatefrombmp.php                    30-Sep-2022 11:10                5583
function.imagecreatefromgd.php                     30-Sep-2022 11:10                6385
function.imagecreatefromgd2.php                    30-Sep-2022 11:10                6551
function.imagecreatefromgd2part.php                30-Sep-2022 11:10                8955
function.imagecreatefromgif.php                    30-Sep-2022 11:10               10444
function.imagecreatefromjpeg.php                   30-Sep-2022 11:10               10079
function.imagecreatefrompng.php                    30-Sep-2022 11:10               10054
function.imagecreatefromstring.php                 30-Sep-2022 11:10                8427
function.imagecreatefromtga.php                    30-Sep-2022 11:10                3445
function.imagecreatefromwbmp.php                   30-Sep-2022 11:10               10115
function.imagecreatefromwebp.php                   30-Sep-2022 11:10                5766
function.imagecreatefromxbm.php                    30-Sep-2022 11:10                5555
function.imagecreatefromxpm.php                    30-Sep-2022 11:10                6380
function.imagecreatetruecolor.php                  30-Sep-2022 11:10                7362
function.imagecrop.php                             30-Sep-2022 11:10                8090
function.imagecropauto.php                         30-Sep-2022 11:10               10908
function.imagedashedline.php                       30-Sep-2022 11:10               13576
function.imagedestroy.php                          30-Sep-2022 11:10                5225
function.imageellipse.php                          30-Sep-2022 11:10               10096
function.imagefill.php                             30-Sep-2022 11:10                7539
function.imagefilledarc.php                        30-Sep-2022 11:10               18633
function.imagefilledellipse.php                    30-Sep-2022 11:10                9757
function.imagefilledpolygon.php                    30-Sep-2022 11:10               12850
function.imagefilledrectangle.php                  30-Sep-2022 11:10                8248
function.imagefilltoborder.php                     30-Sep-2022 11:10               11487
function.imagefilter.php                           30-Sep-2022 11:10               34733
function.imageflip.php                             30-Sep-2022 11:10                9689
function.imagefontheight.php                       30-Sep-2022 11:10                6867
function.imagefontwidth.php                        30-Sep-2022 11:10                6866
function.imageftbbox.php                           30-Sep-2022 11:10               14215
function.imagefttext.php                           30-Sep-2022 11:10               15744
function.imagegammacorrect.php                     30-Sep-2022 11:10                5947
function.imagegd.php                               30-Sep-2022 11:10               11121
function.imagegd2.php                              30-Sep-2022 11:10               11897
function.imagegetclip.php                          30-Sep-2022 11:10                6038
function.imagegetinterpolation.php                 30-Sep-2022 11:10                3746
function.imagegif.php                              30-Sep-2022 11:10               17418
function.imagegrabscreen.php                       30-Sep-2022 11:10                4792
function.imagegrabwindow.php                       30-Sep-2022 11:10                9917
function.imageinterlace.php                        30-Sep-2022 11:10                6618
function.imageistruecolor.php                      30-Sep-2022 11:10                7840
function.imagejpeg.php                             30-Sep-2022 11:10               15573
function.imagelayereffect.php                      30-Sep-2022 11:10               11763
function.imageline.php                             30-Sep-2022 11:10               16663
function.imageloadfont.php                         30-Sep-2022 11:10                9891
function.imageopenpolygon.php                      30-Sep-2022 11:10               10547
function.imagepalettecopy.php                      30-Sep-2022 11:10                7681
function.imagepalettetotruecolor.php               30-Sep-2022 11:10               10554
function.imagepng.php                              30-Sep-2022 11:10                8662
function.imagepolygon.php                          30-Sep-2022 11:10               10474
function.imagerectangle.php                        30-Sep-2022 11:10               10585
function.imageresolution.php                       30-Sep-2022 11:10                7607
function.imagerotate.php                           30-Sep-2022 11:10                9373
function.imagesavealpha.php                        30-Sep-2022 11:10                6974
function.imagescale.php                            30-Sep-2022 11:10                6494
function.imagesetbrush.php                         30-Sep-2022 11:10                9332
function.imagesetclip.php                          30-Sep-2022 11:10                4898
function.imagesetinterpolation.php                 30-Sep-2022 11:10               10403
function.imagesetpixel.php                         30-Sep-2022 11:10               11762
function.imagesetstyle.php                         30-Sep-2022 11:10               12548
function.imagesetthickness.php                     30-Sep-2022 11:10                8578
function.imagesettile.php                          30-Sep-2022 11:10                8581
function.imagestring.php                           30-Sep-2022 11:10               10226
function.imagestringup.php                         30-Sep-2022 11:10                9227
function.imagesx.php                               30-Sep-2022 11:10                5388
function.imagesy.php                               30-Sep-2022 11:10                5372
function.imagetruecolortopalette.php               30-Sep-2022 11:10                6803
function.imagettfbbox.php                          30-Sep-2022 11:10               20052
function.imagettftext.php                          30-Sep-2022 11:10               18334
function.imagetypes.php                            30-Sep-2022 11:10                4581
function.imagewbmp.php                             30-Sep-2022 11:10               15620
function.imagewebp.php                             30-Sep-2022 11:10                7311
function.imagexbm.php                              30-Sep-2022 11:10               11687
function.imap-8bit.php                             30-Sep-2022 11:10                3074
function.imap-alerts.php                           30-Sep-2022 11:10                3088
function.imap-append.php                           30-Sep-2022 11:10                9814
function.imap-base64.php                           30-Sep-2022 11:10                3464
function.imap-binary.php                           30-Sep-2022 11:10                3027
function.imap-body.php                             30-Sep-2022 11:10                5079
function.imap-bodystruct.php                       30-Sep-2022 11:10                4496
function.imap-check.php                            30-Sep-2022 11:10                5894
function.imap-clearflag-full.php                   30-Sep-2022 11:10                5377
function.imap-close.php                            30-Sep-2022 11:10                4124
function.imap-create.php                           30-Sep-2022 11:10                1744
function.imap-createmailbox.php                    30-Sep-2022 11:10               15701
function.imap-delete.php                           30-Sep-2022 11:10                9711
function.imap-deletemailbox.php                    30-Sep-2022 11:10                4735
function.imap-errors.php                           30-Sep-2022 11:10                3377
function.imap-expunge.php                          30-Sep-2022 11:10                3441
function.imap-fetch-overview.php                   30-Sep-2022 11:10               11208
function.imap-fetchbody.php                        30-Sep-2022 11:10                5932
function.imap-fetchheader.php                      30-Sep-2022 11:10                5482
function.imap-fetchmime.php                        30-Sep-2022 11:10                6022
function.imap-fetchstructure.php                   30-Sep-2022 11:10                9366
function.imap-fetchtext.php                        30-Sep-2022 11:10                1725
function.imap-gc.php                               30-Sep-2022 11:10                4842
function.imap-get-quota.php                        30-Sep-2022 11:10               12735
function.imap-get-quotaroot.php                    30-Sep-2022 11:10                9497
function.imap-getacl.php                           30-Sep-2022 11:10                5807
function.imap-getmailboxes.php                     30-Sep-2022 11:10               11995
function.imap-getsubscribed.php                    30-Sep-2022 11:10                7164
function.imap-header.php                           30-Sep-2022 11:10                1960
function.imap-headerinfo.php                       30-Sep-2022 11:10               14118
function.imap-headers.php                          30-Sep-2022 11:10                3367
function.imap-last-error.php                       30-Sep-2022 11:10                2936
function.imap-list.php                             30-Sep-2022 11:10                8641
function.imap-listmailbox.php                      30-Sep-2022 11:10                1727
function.imap-listscan.php                         30-Sep-2022 11:10                6493
function.imap-listsubscribed.php                   30-Sep-2022 11:10                1748
function.imap-lsub.php                             30-Sep-2022 11:10                5667
function.imap-mail-compose.php                     30-Sep-2022 11:10               14673
function.imap-mail-copy.php                        30-Sep-2022 11:10                5955
function.imap-mail-move.php                        30-Sep-2022 11:10                6286
function.imap-mail.php                             30-Sep-2022 11:10                6616
function.imap-mailboxmsginfo.php                   30-Sep-2022 11:10               10019
function.imap-mime-header-decode.php               30-Sep-2022 11:10                6431
function.imap-msgno.php                            30-Sep-2022 11:10                4000
function.imap-mutf7-to-utf8.php                    30-Sep-2022 11:10                3232
function.imap-num-msg.php                          30-Sep-2022 11:10                3868
function.imap-num-recent.php                       30-Sep-2022 11:10                3752
function.imap-open.php                             30-Sep-2022 11:10               23107
function.imap-ping.php                             30-Sep-2022 11:10                4871
function.imap-qprint.php                           30-Sep-2022 11:10                3143
function.imap-rename.php                           30-Sep-2022 11:10                1747
function.imap-renamemailbox.php                    30-Sep-2022 11:10                4773
function.imap-reopen.php                           30-Sep-2022 11:10                8477
function.imap-rfc822-parse-adrlist.php             30-Sep-2022 11:10                8340
function.imap-rfc822-parse-headers.php             30-Sep-2022 11:10                3652
function.imap-rfc822-write-address.php             30-Sep-2022 11:10                5267
function.imap-savebody.php                         30-Sep-2022 11:10                6105
function.imap-scan.php                             30-Sep-2022 11:10                1712
function.imap-scanmailbox.php                      30-Sep-2022 11:10                1737
function.imap-search.php                           30-Sep-2022 11:10               13570
function.imap-set-quota.php                        30-Sep-2022 11:10                6706
function.imap-setacl.php                           30-Sep-2022 11:10                5340
function.imap-setflag-full.php                     30-Sep-2022 11:10                7706
function.imap-sort.php                             30-Sep-2022 11:10                7501
function.imap-status.php                           30-Sep-2022 11:10               10925
function.imap-subscribe.php                        30-Sep-2022 11:10                4311
function.imap-thread.php                           30-Sep-2022 11:10                7893
function.imap-timeout.php                          30-Sep-2022 11:10                4276
function.imap-uid.php                              30-Sep-2022 11:10                4432
function.imap-undelete.php                         30-Sep-2022 11:10                4735
function.imap-unsubscribe.php                      30-Sep-2022 11:10                4374
function.imap-utf7-decode.php                      30-Sep-2022 11:10                3554
function.imap-utf7-encode.php                      30-Sep-2022 11:10                3326
function.imap-utf8-to-mutf7.php                    30-Sep-2022 11:10                3244
function.imap-utf8.php                             30-Sep-2022 11:10                4247
function.implode.php                               30-Sep-2022 11:11                7688
function.in-array.php                              30-Sep-2022 11:11               11831
function.include-once.php                          30-Sep-2022 11:10                2286
function.include.php                               30-Sep-2022 11:10               21320
function.inet-ntop.php                             30-Sep-2022 11:11                6351
function.inet-pton.php                             30-Sep-2022 11:11                4761
function.inflate-add.php                           30-Sep-2022 11:10                5408
function.inflate-get-read-len.php                  30-Sep-2022 11:10                3268
function.inflate-get-status.php                    30-Sep-2022 11:10                3181
function.inflate-init.php                          30-Sep-2022 11:10                6457
function.ini-alter.php                             30-Sep-2022 11:10                1683
function.ini-get-all.php                           30-Sep-2022 11:10               10110
function.ini-get.php                               30-Sep-2022 11:10               11320
function.ini-restore.php                           30-Sep-2022 11:10                6651
function.ini-set.php                               30-Sep-2022 11:10                6492
function.inotify-add-watch.php                     30-Sep-2022 11:10                3942
function.inotify-init.php                          30-Sep-2022 11:10                9331
function.inotify-queue-len.php                     30-Sep-2022 11:10                3782
function.inotify-read.php                          30-Sep-2022 11:10                4403
function.inotify-rm-watch.php                      30-Sep-2022 11:10                3431
function.intdiv.php                                30-Sep-2022 11:10                7307
function.interface-exists.php                      30-Sep-2022 11:11                5414
function.intl-error-name.php                       30-Sep-2022 11:10                5115
function.intl-get-error-code.php                   30-Sep-2022 11:10                4763
function.intl-get-error-message.php                30-Sep-2022 11:10                4785
function.intl-is-failure.php                       30-Sep-2022 11:10                5747
function.intval.php                                30-Sep-2022 11:11               14010
function.ip2long.php                               30-Sep-2022 11:11                9613
function.iptcembed.php                             30-Sep-2022 11:10               12886
function.iptcparse.php                             30-Sep-2022 11:10                4627
function.is-a.php                                  30-Sep-2022 11:11                7050
function.is-array.php                              30-Sep-2022 11:11                5859
function.is-bool.php                               30-Sep-2022 11:11                5779
function.is-callable.php                           30-Sep-2022 11:11               11189
function.is-countable.php                          30-Sep-2022 11:11                6340
function.is-dir.php                                30-Sep-2022 11:10                6651
function.is-double.php                             30-Sep-2022 11:11                1679
function.is-executable.php                         30-Sep-2022 11:10                6770
function.is-file.php                               30-Sep-2022 11:10                6042
function.is-finite.php                             30-Sep-2022 11:10                3047
function.is-float.php                              30-Sep-2022 11:11                6577
function.is-infinite.php                           30-Sep-2022 11:10                3134
function.is-int.php                                30-Sep-2022 11:11                6733
function.is-integer.php                            30-Sep-2022 11:11                1672
function.is-iterable.php                           30-Sep-2022 11:11                5795
function.is-link.php                               30-Sep-2022 11:10                5714
function.is-long.php                               30-Sep-2022 11:11                1653
function.is-nan.php                                30-Sep-2022 11:10                4465
function.is-null.php                               30-Sep-2022 11:11                5978
function.is-numeric.php                            30-Sep-2022 11:11               12803
function.is-object.php                             30-Sep-2022 11:11                7270
function.is-readable.php                           30-Sep-2022 11:10                6315
function.is-real.php                               30-Sep-2022 11:11                1920
function.is-resource.php                           30-Sep-2022 11:11                4971
function.is-scalar.php                             30-Sep-2022 11:11                8218
function.is-soap-fault.php                         30-Sep-2022 11:11                8262
function.is-string.php                             30-Sep-2022 11:11                6847
function.is-subclass-of.php                        30-Sep-2022 11:11               13402
function.is-tainted.php                            30-Sep-2022 11:11                2233
function.is-uploaded-file.php                      30-Sep-2022 11:10                7002
function.is-writable.php                           30-Sep-2022 11:10                6054
function.is-writeable.php                          30-Sep-2022 11:10                1721
function.isset.php                                 30-Sep-2022 11:11               16286
function.iterator-apply.php                        30-Sep-2022 11:11                6608
function.iterator-count.php                        30-Sep-2022 11:11                7840
function.iterator-to-array.php                     30-Sep-2022 11:11                6277
function.jddayofweek.php                           30-Sep-2022 11:10                3566
function.jdmonthname.php                           30-Sep-2022 11:10                4452
function.jdtofrench.php                            30-Sep-2022 11:10                3085
function.jdtogregorian.php                         30-Sep-2022 11:10                3104
function.jdtojewish.php                            30-Sep-2022 11:10                7169
function.jdtojulian.php                            30-Sep-2022 11:10                3083
function.jdtounix.php                              30-Sep-2022 11:10                4311
function.jewishtojd.php                            30-Sep-2022 11:10                4054
function.join.php                                  30-Sep-2022 11:11                1626
function.jpeg2wbmp.php                             30-Sep-2022 11:10                6488
function.json-decode.php                           30-Sep-2022 11:10               20102
function.json-encode.php                           30-Sep-2022 11:10               27710
function.json-last-error-msg.php                   30-Sep-2022 11:10                2803
function.json-last-error.php                       30-Sep-2022 11:10               14305
function.juliantojd.php                            30-Sep-2022 11:10                4387
function.key-exists.php                            30-Sep-2022 11:11                1708
function.key.php                                   30-Sep-2022 11:11                7199
function.krsort.php                                30-Sep-2022 11:11                8225
function.ksort.php                                 30-Sep-2022 11:11                9904
function.lcfirst.php                               30-Sep-2022 11:11                5597
function.lcg-value.php                             30-Sep-2022 11:10                3469
function.lchgrp.php                                30-Sep-2022 11:10                5795
function.lchown.php                                30-Sep-2022 11:10                5652
function.ldap-8859-to-t61.php                      30-Sep-2022 11:11                3201
function.ldap-add-ext.php                          30-Sep-2022 11:11                5416
function.ldap-add.php                              30-Sep-2022 11:11               10679
function.ldap-bind-ext.php                         30-Sep-2022 11:11                5402
function.ldap-bind.php                             30-Sep-2022 11:11               10012
function.ldap-close.php                            30-Sep-2022 11:11                1681
function.ldap-compare.php                          30-Sep-2022 11:11               10959
function.ldap-connect.php                          30-Sep-2022 11:11                9593
function.ldap-control-paged-result-response.php    30-Sep-2022 11:11                5634
function.ldap-control-paged-result.php             30-Sep-2022 11:11               15767
function.ldap-count-entries.php                    30-Sep-2022 11:11                5868
function.ldap-count-references.php                 30-Sep-2022 11:11                4634
function.ldap-delete-ext.php                       30-Sep-2022 11:11                4969
function.ldap-delete.php                           30-Sep-2022 11:11                5069
function.ldap-dn2ufn.php                           30-Sep-2022 11:11                2560
function.ldap-err2str.php                          30-Sep-2022 11:11                4640
function.ldap-errno.php                            30-Sep-2022 11:11                7887
function.ldap-error.php                            30-Sep-2022 11:11                4515
function.ldap-escape.php                           30-Sep-2022 11:11                6348
function.ldap-exop-passwd.php                      30-Sep-2022 11:11               10764
function.ldap-exop-refresh.php                     30-Sep-2022 11:11                4964
function.ldap-exop-whoami.php                      30-Sep-2022 11:11                3848
function.ldap-exop.php                             30-Sep-2022 11:11               12545
function.ldap-explode-dn.php                       30-Sep-2022 11:11                3414
function.ldap-first-attribute.php                  30-Sep-2022 11:11                5985
function.ldap-first-entry.php                      30-Sep-2022 11:11                5671
function.ldap-first-reference.php                  30-Sep-2022 11:11                2347
function.ldap-free-result.php                      30-Sep-2022 11:11                3862
function.ldap-get-attributes.php                   30-Sep-2022 11:11                8528
function.ldap-get-dn.php                           30-Sep-2022 11:11                4145
function.ldap-get-entries.php                      30-Sep-2022 11:11                5967
function.ldap-get-option.php                       30-Sep-2022 11:11               12786
function.ldap-get-values-len.php                   30-Sep-2022 11:11                5314
function.ldap-get-values.php                       30-Sep-2022 11:11                8870
function.ldap-list.php                             30-Sep-2022 11:11               14529
function.ldap-mod-add.php                          30-Sep-2022 11:11                6579
function.ldap-mod-del.php                          30-Sep-2022 11:11                6093
function.ldap-mod-replace.php                      30-Sep-2022 11:11                6524
function.ldap-mod_add-ext.php                      30-Sep-2022 11:11                5380
function.ldap-mod_del-ext.php                      30-Sep-2022 11:11                5396
function.ldap-mod_replace-ext.php                  30-Sep-2022 11:11                5458
function.ldap-modify-batch.php                     30-Sep-2022 11:11               20676
function.ldap-modify.php                           30-Sep-2022 11:11                2107
function.ldap-next-attribute.php                   30-Sep-2022 11:11                5445
function.ldap-next-entry.php                       30-Sep-2022 11:11                5717
function.ldap-next-reference.php                   30-Sep-2022 11:11                2317
function.ldap-parse-exop.php                       30-Sep-2022 11:11                5565
function.ldap-parse-reference.php                  30-Sep-2022 11:11                2325
function.ldap-parse-result.php                     30-Sep-2022 11:11                9228
function.ldap-read.php                             30-Sep-2022 11:11               11675
function.ldap-rename-ext.php                       30-Sep-2022 11:11                5609
function.ldap-rename.php                           30-Sep-2022 11:11                6752
function.ldap-sasl-bind.php                        30-Sep-2022 11:11                5851
function.ldap-search.php                           30-Sep-2022 11:11               14768
function.ldap-set-option.php                       30-Sep-2022 11:11               15629
function.ldap-set-rebind-proc.php                  30-Sep-2022 11:11                3047
function.ldap-sort.php                             30-Sep-2022 11:11                7471
function.ldap-start-tls.php                        30-Sep-2022 11:11                1954
function.ldap-t61-to-8859.php                      30-Sep-2022 11:11                2019
function.ldap-unbind.php                           30-Sep-2022 11:11                3745
function.levenshtein.php                           30-Sep-2022 11:11               13144
function.libxml-clear-errors.php                   30-Sep-2022 11:11                2822
function.libxml-disable-entity-loader.php          30-Sep-2022 11:11                4816
function.libxml-get-errors.php                     30-Sep-2022 11:11               12027
function.libxml-get-last-error.php                 30-Sep-2022 11:11                3165
function.libxml-set-external-entity-loader.php     30-Sep-2022 11:11                9901
function.libxml-set-streams-context.php            30-Sep-2022 11:11                5204
function.libxml-use-internal-errors.php            30-Sep-2022 11:11                6650
function.link.php                                  30-Sep-2022 11:10                5797
function.linkinfo.php                              30-Sep-2022 11:10                4491
function.list.php                                  30-Sep-2022 11:11               17657
function.localeconv.php                            30-Sep-2022 11:11                9242
function.localtime.php                             30-Sep-2022 11:10                8840
function.log.php                                   30-Sep-2022 11:10                3658
function.log10.php                                 30-Sep-2022 11:10                2588
function.log1p.php                                 30-Sep-2022 11:10                3382
function.long2ip.php                               30-Sep-2022 11:11                4084
function.lstat.php                                 30-Sep-2022 11:10                6427
function.ltrim.php                                 30-Sep-2022 11:11                9671
function.lzf-compress.php                          30-Sep-2022 11:10                2896
function.lzf-decompress.php                        30-Sep-2022 11:10                2964
function.lzf-optimized-for.php                     30-Sep-2022 11:10                2254
function.mail.php                                  30-Sep-2022 11:10               27726
function.mailparse-determine-best-xfer-encoding..> 30-Sep-2022 11:10                4185
function.mailparse-msg-create.php                  30-Sep-2022 11:10                3344
function.mailparse-msg-extract-part-file.php       30-Sep-2022 11:10                5048
function.mailparse-msg-extract-part.php            30-Sep-2022 11:10                3997
function.mailparse-msg-extract-whole-part-file.php 30-Sep-2022 11:10                3987
function.mailparse-msg-free.php                    30-Sep-2022 11:10                3456
function.mailparse-msg-get-part-data.php           30-Sep-2022 11:10                2443
function.mailparse-msg-get-part.php                30-Sep-2022 11:10                2664
function.mailparse-msg-get-structure.php           30-Sep-2022 11:10                2463
function.mailparse-msg-parse-file.php              30-Sep-2022 11:10                4114
function.mailparse-msg-parse.php                   30-Sep-2022 11:10                3285
function.mailparse-rfc822-parse-addresses.php      30-Sep-2022 11:10                5468
function.mailparse-stream-encode.php               30-Sep-2022 11:10                5668
function.mailparse-uudecode-all.php                30-Sep-2022 11:10                6894
function.max.php                                   30-Sep-2022 11:10               12914
function.mb-check-encoding.php                     30-Sep-2022 11:10                4978
function.mb-chr.php                                30-Sep-2022 11:10                7084
function.mb-convert-case.php                       30-Sep-2022 11:10               11339
function.mb-convert-encoding.php                   30-Sep-2022 11:10               10591
function.mb-convert-kana.php                       30-Sep-2022 11:10                9660
function.mb-convert-variables.php                  30-Sep-2022 11:10                6316
function.mb-decode-mimeheader.php                  30-Sep-2022 11:10                3003
function.mb-decode-numericentity.php               30-Sep-2022 11:10               36747
function.mb-detect-encoding.php                    30-Sep-2022 11:10               15398
function.mb-detect-order.php                       30-Sep-2022 11:10                8965
function.mb-encode-mimeheader.php                  30-Sep-2022 11:10                9473
function.mb-encode-numericentity.php               30-Sep-2022 11:10               13413
function.mb-encoding-aliases.php                   30-Sep-2022 11:10                5774
function.mb-ereg-match.php                         30-Sep-2022 11:10                5441
function.mb-ereg-replace-callback.php              30-Sep-2022 11:10               12017
function.mb-ereg-replace.php                       30-Sep-2022 11:10                7010
function.mb-ereg-search-getpos.php                 30-Sep-2022 11:10                4165
function.mb-ereg-search-getregs.php                30-Sep-2022 11:10                4377
function.mb-ereg-search-init.php                   30-Sep-2022 11:10                6022
function.mb-ereg-search-pos.php                    30-Sep-2022 11:10                5988
function.mb-ereg-search-regs.php                   30-Sep-2022 11:10                5643
function.mb-ereg-search-setpos.php                 30-Sep-2022 11:10                4703
function.mb-ereg-search.php                        30-Sep-2022 11:10                5556
function.mb-ereg.php                               30-Sep-2022 11:10                6459
function.mb-eregi-replace.php                      30-Sep-2022 11:10                6940
function.mb-eregi.php                              30-Sep-2022 11:10                6528
function.mb-get-info.php                           30-Sep-2022 11:10                6066
function.mb-http-input.php                         30-Sep-2022 11:10                4844
function.mb-http-output.php                        30-Sep-2022 11:10                4505
function.mb-internal-encoding.php                  30-Sep-2022 11:10                6763
function.mb-language.php                           30-Sep-2022 11:10                6156
function.mb-list-encodings.php                     30-Sep-2022 11:10                5111
function.mb-ord.php                                30-Sep-2022 11:10                6744
function.mb-output-handler.php                     30-Sep-2022 11:10                5319
function.mb-parse-str.php                          30-Sep-2022 11:10                4465
function.mb-preferred-mime-name.php                30-Sep-2022 11:10                4315
function.mb-regex-encoding.php                     30-Sep-2022 11:10                4593
function.mb-regex-set-options.php                  30-Sep-2022 11:10                7259
function.mb-scrub.php                              30-Sep-2022 11:10                3169
function.mb-send-mail.php                          30-Sep-2022 11:10                9486
function.mb-split.php                              30-Sep-2022 11:10                4462
function.mb-str-split.php                          30-Sep-2022 11:10                4982
function.mb-strcut.php                             30-Sep-2022 11:10                7215
function.mb-strimwidth.php                         30-Sep-2022 11:10                7628
function.mb-stripos.php                            30-Sep-2022 11:10                6451
function.mb-stristr.php                            30-Sep-2022 11:10                6969
function.mb-strlen.php                             30-Sep-2022 11:10                4860
function.mb-strpos.php                             30-Sep-2022 11:10                6265
function.mb-strrchr.php                            30-Sep-2022 11:10                6792
function.mb-strrichr.php                           30-Sep-2022 11:10                6768
function.mb-strripos.php                           30-Sep-2022 11:10                6292
function.mb-strrpos.php                            30-Sep-2022 11:10                6386
function.mb-strstr.php                             30-Sep-2022 11:10                6661
function.mb-strtolower.php                         30-Sep-2022 11:10                7535
function.mb-strtoupper.php                         30-Sep-2022 11:10                7540
function.mb-strwidth.php                           30-Sep-2022 11:10                9111
function.mb-substitute-character.php               30-Sep-2022 11:10                6833
function.mb-substr-count.php                       30-Sep-2022 11:10                5862
function.mb-substr.php                             30-Sep-2022 11:10                6386
function.mcrypt-create-iv.php                      30-Sep-2022 11:10                6882
function.mcrypt-decrypt.php                        30-Sep-2022 11:10                5645
function.mcrypt-enc-get-algorithms-name.php        30-Sep-2022 11:10                5472
function.mcrypt-enc-get-block-size.php             30-Sep-2022 11:10                3116
function.mcrypt-enc-get-iv-size.php                30-Sep-2022 11:10                3290
function.mcrypt-enc-get-key-size.php               30-Sep-2022 11:10                3147
function.mcrypt-enc-get-modes-name.php             30-Sep-2022 11:10                5385
function.mcrypt-enc-get-supported-key-sizes.php    30-Sep-2022 11:10                5220
function.mcrypt-enc-is-block-algorithm-mode.php    30-Sep-2022 11:10                3491
function.mcrypt-enc-is-block-algorithm.php         30-Sep-2022 11:10                3300
function.mcrypt-enc-is-block-mode.php              30-Sep-2022 11:10                3349
function.mcrypt-enc-self-test.php                  30-Sep-2022 11:10                3175
function.mcrypt-encrypt.php                        30-Sep-2022 11:10               15759
function.mcrypt-generic-deinit.php                 30-Sep-2022 11:10                4182
function.mcrypt-generic-init.php                   30-Sep-2022 11:10                5314
function.mcrypt-generic.php                        30-Sep-2022 11:10                6096
function.mcrypt-get-block-size.php                 30-Sep-2022 11:10                6463
function.mcrypt-get-cipher-name.php                30-Sep-2022 11:10                4797
function.mcrypt-get-iv-size.php                    30-Sep-2022 11:10                6446
function.mcrypt-get-key-size.php                   30-Sep-2022 11:10                6617
function.mcrypt-list-algorithms.php                30-Sep-2022 11:10                4813
function.mcrypt-list-modes.php                     30-Sep-2022 11:10                4827
function.mcrypt-module-close.php                   30-Sep-2022 11:10                3528
function.mcrypt-module-get-algo-block-size.php     30-Sep-2022 11:10                3602
function.mcrypt-module-get-algo-key-size.php       30-Sep-2022 11:10                3706
function.mcrypt-module-get-supported-key-sizes.php 30-Sep-2022 11:10                4767
function.mcrypt-module-is-block-algorithm-mode.php 30-Sep-2022 11:10                4158
function.mcrypt-module-is-block-algorithm.php      30-Sep-2022 11:10                3834
function.mcrypt-module-is-block-mode.php           30-Sep-2022 11:10                4174
function.mcrypt-module-open.php                    30-Sep-2022 11:10               14923
function.mcrypt-module-self-test.php               30-Sep-2022 11:10                4953
function.md5-file.php                              30-Sep-2022 11:11                4784
function.md5.php                                   30-Sep-2022 11:11                5949
function.mdecrypt-generic.php                      30-Sep-2022 11:10               12162
function.memcache-debug.php                        30-Sep-2022 11:11                3212
function.memory-get-peak-usage.php                 30-Sep-2022 11:10                3612
function.memory-get-usage.php                      30-Sep-2022 11:10                5596
function.memory-reset-peak-usage.php               30-Sep-2022 11:10                5005
function.metaphone.php                             30-Sep-2022 11:11                8259
function.method-exists.php                         30-Sep-2022 11:11                6372
function.mhash-count.php                           30-Sep-2022 11:10                4938
function.mhash-get-block-size.php                  30-Sep-2022 11:10                4475
function.mhash-get-hash-name.php                   30-Sep-2022 11:10                4459
function.mhash-keygen-s2k.php                      30-Sep-2022 11:10                5545
function.mhash.php                                 30-Sep-2022 11:10                4650
function.microtime.php                             30-Sep-2022 11:10                7787
function.mime-content-type.php                     30-Sep-2022 11:10                4894
function.min.php                                   30-Sep-2022 11:10               13537
function.mkdir.php                                 30-Sep-2022 11:10                9158
function.mktime.php                                30-Sep-2022 11:10               18616
function.money-format.php                          30-Sep-2022 11:11               18928
function.mongodb.bson-fromjson.php                 30-Sep-2022 11:10                5862
function.mongodb.bson-fromphp.php                  30-Sep-2022 11:10                5843
function.mongodb.bson-tocanonicalextendedjson.php  30-Sep-2022 11:10               16243
function.mongodb.bson-tojson.php                   30-Sep-2022 11:10               17733
function.mongodb.bson-tophp.php                    30-Sep-2022 11:10                8754
function.mongodb.bson-torelaxedextendedjson.php    30-Sep-2022 11:10               15942
function.mongodb.driver.monitoring.addsubscribe..> 30-Sep-2022 11:10                5139
function.mongodb.driver.monitoring.removesubscr..> 30-Sep-2022 11:10                4994
function.move-uploaded-file.php                    30-Sep-2022 11:10                8734
function.mqseries-back.php                         30-Sep-2022 11:11                6475
function.mqseries-begin.php                        30-Sep-2022 11:11                7947
function.mqseries-close.php                        30-Sep-2022 11:11                6551
function.mqseries-cmit.php                         30-Sep-2022 11:11                6420
function.mqseries-conn.php                         30-Sep-2022 11:11                5939
function.mqseries-connx.php                        30-Sep-2022 11:11               14370
function.mqseries-disc.php                         30-Sep-2022 11:11                5667
function.mqseries-get.php                          30-Sep-2022 11:11               13153
function.mqseries-inq.php                          30-Sep-2022 11:11                9192
function.mqseries-open.php                         30-Sep-2022 11:11                7663
function.mqseries-put.php                          30-Sep-2022 11:11               14130
function.mqseries-put1.php                         30-Sep-2022 11:11                5925
function.mqseries-set.php                          30-Sep-2022 11:11                5662
function.mqseries-strerror.php                     30-Sep-2022 11:11                4313
function.msg-get-queue.php                         30-Sep-2022 11:10                5488
function.msg-queue-exists.php                      30-Sep-2022 11:10                3253
function.msg-receive.php                           30-Sep-2022 11:10               10542
function.msg-remove-queue.php                      30-Sep-2022 11:10                4461
function.msg-send.php                              30-Sep-2022 11:10                8329
function.msg-set-queue.php                         30-Sep-2022 11:10                5065
function.msg-stat-queue.php                        30-Sep-2022 11:10                6510
function.mt-getrandmax.php                         30-Sep-2022 11:10                5465
function.mt-rand.php                               30-Sep-2022 11:10                9978
function.mt-srand.php                              30-Sep-2022 11:10                7889
function.mysql-affected-rows.php                   30-Sep-2022 11:10               12504
function.mysql-client-encoding.php                 30-Sep-2022 11:10                6238
function.mysql-close.php                           30-Sep-2022 11:10                7313
function.mysql-connect.php                         30-Sep-2022 11:10               17372
function.mysql-create-db.php                       30-Sep-2022 11:10                8576
function.mysql-data-seek.php                       30-Sep-2022 11:10               12241
function.mysql-db-name.php                         30-Sep-2022 11:10                7118
function.mysql-db-query.php                        30-Sep-2022 11:10               10179
function.mysql-drop-db.php                         30-Sep-2022 11:10                7730
function.mysql-errno.php                           30-Sep-2022 11:10                8307
function.mysql-error.php                           30-Sep-2022 11:10                8211
function.mysql-escape-string.php                   30-Sep-2022 11:10                6842
function.mysql-fetch-array.php                     30-Sep-2022 11:10               15501
function.mysql-fetch-assoc.php                     30-Sep-2022 11:10               12073
function.mysql-fetch-field.php                     30-Sep-2022 11:10               13518
function.mysql-fetch-lengths.php                   30-Sep-2022 11:10                7640
function.mysql-fetch-object.php                    30-Sep-2022 11:10               11564
function.mysql-fetch-row.php                       30-Sep-2022 11:10                7632
function.mysql-field-flags.php                     30-Sep-2022 11:10                8415
function.mysql-field-len.php                       30-Sep-2022 11:10                6900
function.mysql-field-name.php                      30-Sep-2022 11:10                9125
function.mysql-field-seek.php                      30-Sep-2022 11:10                4784
function.mysql-field-table.php                     30-Sep-2022 11:10                7789
function.mysql-field-type.php                      30-Sep-2022 11:10               11916
function.mysql-free-result.php                     30-Sep-2022 11:10                7878
function.mysql-get-client-info.php                 30-Sep-2022 11:10                5060
function.mysql-get-host-info.php                   30-Sep-2022 11:10                6914
function.mysql-get-proto-info.php                  30-Sep-2022 11:10                6614
function.mysql-get-server-info.php                 30-Sep-2022 11:10                7004
function.mysql-info.php                            30-Sep-2022 11:10                6190
function.mysql-insert-id.php                       30-Sep-2022 11:10                8236
function.mysql-list-dbs.php                        30-Sep-2022 11:10                8926
function.mysql-list-fields.php                     30-Sep-2022 11:10                8894
function.mysql-list-processes.php                  30-Sep-2022 11:10                7647
function.mysql-list-tables.php                     30-Sep-2022 11:10                9837
function.mysql-num-fields.php                      30-Sep-2022 11:10                6634
function.mysql-num-rows.php                        30-Sep-2022 11:10                8123
function.mysql-pconnect.php                        30-Sep-2022 11:10                7819
function.mysql-ping.php                            30-Sep-2022 11:10                8268
function.mysql-query.php                           30-Sep-2022 11:10               14435
function.mysql-real-escape-string.php              30-Sep-2022 11:10               16611
function.mysql-result.php                          30-Sep-2022 11:10                9689
function.mysql-select-db.php                       30-Sep-2022 11:10                7751
function.mysql-set-charset.php                     30-Sep-2022 11:10                5733
function.mysql-stat.php                            30-Sep-2022 11:10                9296
function.mysql-tablename.php                       30-Sep-2022 11:10                8173
function.mysql-thread-id.php                       30-Sep-2022 11:10                6620
function.mysql-unbuffered-query.php                30-Sep-2022 11:10                6886
function.mysql-xdevapi-expression.php              30-Sep-2022 11:10                4781
function.mysql-xdevapi-getsession.php              30-Sep-2022 11:10               13209
function.mysqli-connect.php                        30-Sep-2022 11:10                2280
function.mysqli-escape-string.php                  30-Sep-2022 11:10                1924
function.mysqli-execute.php                        30-Sep-2022 11:10                2504
function.mysqli-get-client-stats.php               30-Sep-2022 11:10                8287
function.mysqli-get-links-stats.php                30-Sep-2022 11:10                3153
function.mysqli-report.php                         30-Sep-2022 11:10                1726
function.mysqli-set-opt.php                        30-Sep-2022 11:10                1827
function.natcasesort.php                           30-Sep-2022 11:11                7419
function.natsort.php                               30-Sep-2022 11:11               10469
function.net-get-interfaces.php                    30-Sep-2022 11:11                4495
function.next.php                                  30-Sep-2022 11:11                9043
function.ngettext.php                              30-Sep-2022 11:10                5676
function.nl-langinfo.php                           30-Sep-2022 11:11               15979
function.nl2br.php                                 30-Sep-2022 11:11                6842
function.number-format.php                         30-Sep-2022 11:11                8719
function.oauth-get-sbs.php                         30-Sep-2022 11:11                2912
function.oauth-urlencode.php                       30-Sep-2022 11:11                2461
function.ob-clean.php                              30-Sep-2022 11:10                3556
function.ob-end-clean.php                          30-Sep-2022 11:10                5289
function.ob-end-flush.php                          30-Sep-2022 11:10                6055
function.ob-flush.php                              30-Sep-2022 11:10                3811
function.ob-get-clean.php                          30-Sep-2022 11:10                5357
function.ob-get-contents.php                       30-Sep-2022 11:10                4751
function.ob-get-flush.php                          30-Sep-2022 11:10                5834
function.ob-get-length.php                         30-Sep-2022 11:10                4741
function.ob-get-level.php                          30-Sep-2022 11:10                2888
function.ob-get-status.php                         30-Sep-2022 11:10                7308
function.ob-gzhandler.php                          30-Sep-2022 11:10                6020
function.ob-iconv-handler.php                      30-Sep-2022 11:10                5205
function.ob-implicit-flush.php                     30-Sep-2022 11:10                4289
function.ob-list-handlers.php                      30-Sep-2022 11:10                6014
function.ob-start.php                              30-Sep-2022 11:10               16813
function.ob-tidyhandler.php                        30-Sep-2022 11:11                4357
function.oci-bind-array-by-name.php                30-Sep-2022 11:10               13848
function.oci-bind-by-name.php                      30-Sep-2022 11:10               84181
function.oci-cancel.php                            30-Sep-2022 11:10                2479
function.oci-client-version.php                    30-Sep-2022 11:10                3991
function.oci-close.php                             30-Sep-2022 11:10               20398
function.oci-commit.php                            30-Sep-2022 11:10               11458
function.oci-connect.php                           30-Sep-2022 11:10               38414
function.oci-define-by-name.php                    30-Sep-2022 11:10               25589
function.oci-error.php                             30-Sep-2022 11:10               11899
function.oci-execute.php                           30-Sep-2022 11:10               21982
function.oci-fetch-all.php                         30-Sep-2022 11:10               26842
function.oci-fetch-array.php                       30-Sep-2022 11:10               71472
function.oci-fetch-assoc.php                       30-Sep-2022 11:10                8817
function.oci-fetch-object.php                      30-Sep-2022 11:10               19730
function.oci-fetch-row.php                         30-Sep-2022 11:10                8760
function.oci-fetch.php                             30-Sep-2022 11:10               14119
function.oci-field-is-null.php                     30-Sep-2022 11:10                8503
function.oci-field-name.php                        30-Sep-2022 11:10               11031
function.oci-field-precision.php                   30-Sep-2022 11:10                9681
function.oci-field-scale.php                       30-Sep-2022 11:10                9643
function.oci-field-size.php                        30-Sep-2022 11:10               11745
function.oci-field-type-raw.php                    30-Sep-2022 11:10                8791
function.oci-field-type.php                        30-Sep-2022 11:10               11984
function.oci-free-descriptor.php                   30-Sep-2022 11:10                3398
function.oci-free-statement.php                    30-Sep-2022 11:10                2759
function.oci-get-implicit-resultset.php            30-Sep-2022 11:10               32361
function.oci-internal-debug.php                    30-Sep-2022 11:10                3592
function.oci-lob-copy.php                          30-Sep-2022 11:10                4314
function.oci-lob-is-equal.php                      30-Sep-2022 11:10                3125
function.oci-new-collection.php                    30-Sep-2022 11:10                5227
function.oci-new-connect.php                       30-Sep-2022 11:10               16575
function.oci-new-cursor.php                        30-Sep-2022 11:10                8567
function.oci-new-descriptor.php                    30-Sep-2022 11:10               21321
function.oci-num-fields.php                        30-Sep-2022 11:10                7737
function.oci-num-rows.php                          30-Sep-2022 11:10                8504
function.oci-parse.php                             30-Sep-2022 11:10               13203
function.oci-password-change.php                   30-Sep-2022 11:10               14281
function.oci-pconnect.php                          30-Sep-2022 11:10               14540
function.oci-register-taf-callback.php             30-Sep-2022 11:10                5325
function.oci-result.php                            30-Sep-2022 11:10                9452
function.oci-rollback.php                          30-Sep-2022 11:10               15039
function.oci-server-version.php                    30-Sep-2022 11:10                5241
function.oci-set-action.php                        30-Sep-2022 11:10                8345
function.oci-set-call-timout.php                   30-Sep-2022 11:10                5725
function.oci-set-client-identifier.php             30-Sep-2022 11:10                8115
function.oci-set-client-info.php                   30-Sep-2022 11:10                8282
function.oci-set-db-operation.php                  30-Sep-2022 11:10                7704
function.oci-set-edition.php                       30-Sep-2022 11:10                9797
function.oci-set-module-name.php                   30-Sep-2022 11:10                8401
function.oci-set-prefetch-lob.php                  30-Sep-2022 11:10                8892
function.oci-set-prefetch.php                      30-Sep-2022 11:10               22872
function.oci-statement-type.php                    30-Sep-2022 11:10                7080
function.oci-unregister-taf-callback.php           30-Sep-2022 11:10                3440
function.ocibindbyname.php                         30-Sep-2022 11:10                1981
function.ocicancel.php                             30-Sep-2022 11:10                1923
function.ocicloselob.php                           30-Sep-2022 11:10                1922
function.ocicollappend.php                         30-Sep-2022 11:10                1987
function.ocicollassign.php                         30-Sep-2022 11:10                1992
function.ocicollassignelem.php                     30-Sep-2022 11:10                2037
function.ocicollgetelem.php                        30-Sep-2022 11:10                2004
function.ocicollmax.php                            30-Sep-2022 11:10                1956
function.ocicollsize.php                           30-Sep-2022 11:10                1959
function.ocicolltrim.php                           30-Sep-2022 11:10                1969
function.ocicolumnisnull.php                       30-Sep-2022 11:10                1993
function.ocicolumnname.php                         30-Sep-2022 11:10                1985
function.ocicolumnprecision.php                    30-Sep-2022 11:10                2028
function.ocicolumnscale.php                        30-Sep-2022 11:10                1992
function.ocicolumnsize.php                         30-Sep-2022 11:10                1973
function.ocicolumntype.php                         30-Sep-2022 11:10                1977
function.ocicolumntyperaw.php                      30-Sep-2022 11:10                2000
function.ocicommit.php                             30-Sep-2022 11:10                1937
function.ocidefinebyname.php                       30-Sep-2022 11:10                1983
function.ocierror.php                              30-Sep-2022 11:10                1914
function.ociexecute.php                            30-Sep-2022 11:10                1918
function.ocifetch.php                              30-Sep-2022 11:10                1908
function.ocifetchinto.php                          30-Sep-2022 11:10                2649
function.ocifetchstatement.php                     30-Sep-2022 11:10                2001
function.ocifreecollection.php                     30-Sep-2022 11:10                2019
function.ocifreecursor.php                         30-Sep-2022 11:10                1991
function.ocifreedesc.php                           30-Sep-2022 11:10                1935
function.ocifreestatement.php                      30-Sep-2022 11:10                2010
function.ociinternaldebug.php                      30-Sep-2022 11:10                2024
function.ociloadlob.php                            30-Sep-2022 11:10                1920
function.ocilogoff.php                             30-Sep-2022 11:10                1907
function.ocilogon.php                              30-Sep-2022 11:10                1922
function.ocinewcollection.php                      30-Sep-2022 11:10                2008
function.ocinewcursor.php                          30-Sep-2022 11:10                1976
function.ocinewdescriptor.php                      30-Sep-2022 11:10                1998
function.ocinlogon.php                             30-Sep-2022 11:10                1947
function.ocinumcols.php                            30-Sep-2022 11:10                1932
function.ociparse.php                              30-Sep-2022 11:10                1902
function.ociplogon.php                             30-Sep-2022 11:10                1917
function.ociresult.php                             30-Sep-2022 11:10                1915
function.ocirollback.php                           30-Sep-2022 11:10                1937
function.ocirowcount.php                           30-Sep-2022 11:10                1939
function.ocisavelob.php                            30-Sep-2022 11:10                1920
function.ocisavelobfile.php                        30-Sep-2022 11:10                1958
function.ociserverversion.php                      30-Sep-2022 11:10                2012
function.ocisetprefetch.php                        30-Sep-2022 11:10                1998
function.ocistatementtype.php                      30-Sep-2022 11:10                2018
function.ociwritelobtofile.php                     30-Sep-2022 11:10                1999
function.ociwritetemporarylob.php                  30-Sep-2022 11:10                2022
function.octdec.php                                30-Sep-2022 11:10                5652
function.odbc-autocommit.php                       30-Sep-2022 11:10                4160
function.odbc-binmode.php                          30-Sep-2022 11:10                7003
function.odbc-close-all.php                        30-Sep-2022 11:10                2601
function.odbc-close.php                            30-Sep-2022 11:10                2853
function.odbc-columnprivileges.php                 30-Sep-2022 11:10                8297
function.odbc-columns.php                          30-Sep-2022 11:10               10889
function.odbc-commit.php                           30-Sep-2022 11:10                2544
function.odbc-connect.php                          30-Sep-2022 11:10                9073
function.odbc-cursor.php                           30-Sep-2022 11:10                2484
function.odbc-data-source.php                      30-Sep-2022 11:10                5690
function.odbc-do.php                               30-Sep-2022 11:10                1671
function.odbc-error.php                            30-Sep-2022 11:10                4055
function.odbc-errormsg.php                         30-Sep-2022 11:10                4163
function.odbc-exec.php                             30-Sep-2022 11:10                3918
function.odbc-execute.php                          30-Sep-2022 11:10                6874
function.odbc-fetch-array.php                      30-Sep-2022 11:10                4193
function.odbc-fetch-into.php                       30-Sep-2022 11:10                4903
function.odbc-fetch-object.php                     30-Sep-2022 11:10                4352
function.odbc-fetch-row.php                        30-Sep-2022 11:10                4331
function.odbc-field-len.php                        30-Sep-2022 11:10                3357
function.odbc-field-name.php                       30-Sep-2022 11:10                2966
function.odbc-field-num.php                        30-Sep-2022 11:10                2968
function.odbc-field-precision.php                  30-Sep-2022 11:10                2194
function.odbc-field-scale.php                      30-Sep-2022 11:10                2982
function.odbc-field-type.php                       30-Sep-2022 11:10                2962
function.odbc-foreignkeys.php                      30-Sep-2022 11:10                8465
function.odbc-free-result.php                      30-Sep-2022 11:10                3340
function.odbc-gettypeinfo.php                      30-Sep-2022 11:10                4444
function.odbc-longreadlen.php                      30-Sep-2022 11:10                3829
function.odbc-next-result.php                      30-Sep-2022 11:10                9304
function.odbc-num-fields.php                       30-Sep-2022 11:10                2606
function.odbc-num-rows.php                         30-Sep-2022 11:10                3203
function.odbc-pconnect.php                         30-Sep-2022 11:10                4499
function.odbc-prepare.php                          30-Sep-2022 11:10                6363
function.odbc-primarykeys.php                      30-Sep-2022 11:10                7683
function.odbc-procedurecolumns.php                 30-Sep-2022 11:10               11227
function.odbc-procedures.php                       30-Sep-2022 11:10                9161
function.odbc-result-all.php                       30-Sep-2022 11:10                3952
function.odbc-result.php                           30-Sep-2022 11:10                5137
function.odbc-rollback.php                         30-Sep-2022 11:10                2585
function.odbc-setoption.php                        30-Sep-2022 11:10                7098
function.odbc-specialcolumns.php                   30-Sep-2022 11:10                6944
function.odbc-statistics.php                       30-Sep-2022 11:10                9462
function.odbc-tableprivileges.php                  30-Sep-2022 11:10                7948
function.odbc-tables.php                           30-Sep-2022 11:10               11973
function.opcache-compile-file.php                  30-Sep-2022 11:10                3617
function.opcache-get-configuration.php             30-Sep-2022 11:10                3216
function.opcache-get-status.php                    30-Sep-2022 11:10                3624
function.opcache-invalidate.php                    30-Sep-2022 11:10                3982
function.opcache-is-script-cached.php              30-Sep-2022 11:10                3231
function.opcache-reset.php                         30-Sep-2022 11:10                2874
function.openal-buffer-create.php                  30-Sep-2022 11:10                2780
function.openal-buffer-data.php                    30-Sep-2022 11:10                4404
function.openal-buffer-destroy.php                 30-Sep-2022 11:10                2993
function.openal-buffer-get.php                     30-Sep-2022 11:10                3549
function.openal-buffer-loadwav.php                 30-Sep-2022 11:10                3510
function.openal-context-create.php                 30-Sep-2022 11:10                3240
function.openal-context-current.php                30-Sep-2022 11:10                3048
function.openal-context-destroy.php                30-Sep-2022 11:10                3034
function.openal-context-process.php                30-Sep-2022 11:10                3452
function.openal-context-suspend.php                30-Sep-2022 11:10                3446
function.openal-device-close.php                   30-Sep-2022 11:10                3000
function.openal-device-open.php                    30-Sep-2022 11:10                3237
function.openal-listener-get.php                   30-Sep-2022 11:10                3164
function.openal-listener-set.php                   30-Sep-2022 11:10                3458
function.openal-source-create.php                  30-Sep-2022 11:10                2986
function.openal-source-destroy.php                 30-Sep-2022 11:10                3001
function.openal-source-get.php                     30-Sep-2022 11:10                4659
function.openal-source-pause.php                   30-Sep-2022 11:10                3332
function.openal-source-play.php                    30-Sep-2022 11:10                3331
function.openal-source-rewind.php                  30-Sep-2022 11:10                3341
function.openal-source-set.php                     30-Sep-2022 11:10                5184
function.openal-source-stop.php                    30-Sep-2022 11:10                3313
function.openal-stream.php                         30-Sep-2022 11:10                3909
function.opendir.php                               30-Sep-2022 11:10                8584
function.openlog.php                               30-Sep-2022 11:11                8760
function.openssl-cipher-iv-length.php              30-Sep-2022 11:10                4293
function.openssl-cipher-key-length.php             30-Sep-2022 11:10                4180
function.openssl-cms-decrypt.php                   30-Sep-2022 11:10                4577
function.openssl-cms-encrypt.php                   30-Sep-2022 11:10                5578
function.openssl-cms-read.php                      30-Sep-2022 11:10                2960
function.openssl-cms-sign.php                      30-Sep-2022 11:10                7329
function.openssl-cms-verify.php                    30-Sep-2022 11:10                6167
function.openssl-csr-export-to-file.php            30-Sep-2022 11:10                8236
function.openssl-csr-export.php                    30-Sep-2022 11:10                8068
function.openssl-csr-get-public-key.php            30-Sep-2022 11:10                8941
function.openssl-csr-get-subject.php               30-Sep-2022 11:10                9702
function.openssl-csr-new.php                       30-Sep-2022 11:10               21468
function.openssl-csr-sign.php                      30-Sep-2022 11:10               12614
function.openssl-decrypt.php                       30-Sep-2022 11:10                7491
function.openssl-dh-compute-key.php                30-Sep-2022 11:10               16773
function.openssl-digest.php                        30-Sep-2022 11:10                4270
function.openssl-encrypt.php                       30-Sep-2022 11:10               18401
function.openssl-error-string.php                  30-Sep-2022 11:10                3708
function.openssl-free-key.php                      30-Sep-2022 11:10                3711
function.openssl-get-cert-locations.php            30-Sep-2022 11:10                3973
function.openssl-get-cipher-methods.php            30-Sep-2022 11:10               14270
function.openssl-get-curve-names.php               30-Sep-2022 11:10                7012
function.openssl-get-md-methods.php                30-Sep-2022 11:10                6925
function.openssl-get-privatekey.php                30-Sep-2022 11:10                1898
function.openssl-get-publickey.php                 30-Sep-2022 11:10                1869
function.openssl-open.php                          30-Sep-2022 11:10                9983
function.openssl-pbkdf2.php                        30-Sep-2022 11:10                7323
function.openssl-pkcs12-export-to-file.php         30-Sep-2022 11:10                6648
function.openssl-pkcs12-export.php                 30-Sep-2022 11:10                6632
function.openssl-pkcs12-read.php                   30-Sep-2022 11:10                5337
function.openssl-pkcs7-decrypt.php                 30-Sep-2022 11:10                7323
function.openssl-pkcs7-encrypt.php                 30-Sep-2022 11:10               10461
function.openssl-pkcs7-read.php                    30-Sep-2022 11:10                6904
function.openssl-pkcs7-sign.php                    30-Sep-2022 11:10               11500
function.openssl-pkcs7-verify.php                  30-Sep-2022 11:10                7283
function.openssl-pkey-derive.php                   30-Sep-2022 11:10                7881
function.openssl-pkey-export-to-file.php           30-Sep-2022 11:10                5815
function.openssl-pkey-export.php                   30-Sep-2022 11:10                5757
function.openssl-pkey-free.php                     30-Sep-2022 11:10                4201
function.openssl-pkey-get-details.php              30-Sep-2022 11:10                9119
function.openssl-pkey-get-private.php              30-Sep-2022 11:10                5581
function.openssl-pkey-get-public.php               30-Sep-2022 11:10                5067
function.openssl-pkey-new.php                      30-Sep-2022 11:10                6688
function.openssl-private-decrypt.php               30-Sep-2022 11:10                6136
function.openssl-private-encrypt.php               30-Sep-2022 11:10                6063
function.openssl-public-decrypt.php                30-Sep-2022 11:10                6044
function.openssl-public-encrypt.php                30-Sep-2022 11:10                6274
function.openssl-random-pseudo-bytes.php           30-Sep-2022 11:10                7011
function.openssl-seal.php                          30-Sep-2022 11:10               11612
function.openssl-sign.php                          30-Sep-2022 11:10               12307
function.openssl-spki-export-challenge.php         30-Sep-2022 11:10                7694
function.openssl-spki-export.php                   30-Sep-2022 11:10                8322
function.openssl-spki-new.php                      30-Sep-2022 11:10                9093
function.openssl-spki-verify.php                   30-Sep-2022 11:10                7978
function.openssl-verify.php                        30-Sep-2022 11:10               12990
function.openssl-x509-check-private-key.php        30-Sep-2022 11:10                5414
function.openssl-x509-checkpurpose.php             30-Sep-2022 11:10                7038
function.openssl-x509-export-to-file.php           30-Sep-2022 11:10                4592
function.openssl-x509-export.php                   30-Sep-2022 11:10                4525
function.openssl-x509-fingerprint.php              30-Sep-2022 11:10                4936
function.openssl-x509-free.php                     30-Sep-2022 11:10                4197
function.openssl-x509-parse.php                    30-Sep-2022 11:10                4298
function.openssl-x509-read.php                     30-Sep-2022 11:10                4334
function.openssl-x509-verify.php                   30-Sep-2022 11:10               12918
function.ord.php                                   30-Sep-2022 11:11                7207
function.output-add-rewrite-var.php                30-Sep-2022 11:10                8432
function.output-reset-rewrite-vars.php             30-Sep-2022 11:10                6700
function.pack.php                                  30-Sep-2022 11:10               13125
function.parse-ini-file.php                        30-Sep-2022 11:10               20180
function.parse-ini-string.php                      30-Sep-2022 11:10                6602
function.parse-str.php                             30-Sep-2022 11:11               10026
function.parse-url.php                             30-Sep-2022 11:11               15535
function.passthru.php                              30-Sep-2022 11:10                5851
function.password-algos.php                        30-Sep-2022 11:10                3207
function.password-get-info.php                     30-Sep-2022 11:10                3370
function.password-hash.php                         30-Sep-2022 11:10               22027
function.password-needs-rehash.php                 30-Sep-2022 11:10                7782
function.password-verify.php                       30-Sep-2022 11:10                6182
function.pathinfo.php                              30-Sep-2022 11:10               11895
function.pclose.php                                30-Sep-2022 11:10                4832
function.pcntl-alarm.php                           30-Sep-2022 11:10                2803
function.pcntl-async-signals.php                   30-Sep-2022 11:10                3911
function.pcntl-errno.php                           30-Sep-2022 11:10                1782
function.pcntl-exec.php                            30-Sep-2022 11:10                3485
function.pcntl-fork.php                            30-Sep-2022 11:10                5104
function.pcntl-get-last-error.php                  30-Sep-2022 11:10                2759
function.pcntl-getpriority.php                     30-Sep-2022 11:10                5163
function.pcntl-rfork.php                           30-Sep-2022 11:10                7664
function.pcntl-setpriority.php                     30-Sep-2022 11:10                4986
function.pcntl-signal-dispatch.php                 30-Sep-2022 11:10                5679
function.pcntl-signal-get-handler.php              30-Sep-2022 11:10                6767
function.pcntl-signal.php                          30-Sep-2022 11:10               11757
function.pcntl-sigprocmask.php                     30-Sep-2022 11:10                5653
function.pcntl-sigtimedwait.php                    30-Sep-2022 11:10                4633
function.pcntl-sigwaitinfo.php                     30-Sep-2022 11:10                7267
function.pcntl-strerror.php                        30-Sep-2022 11:10                2945
function.pcntl-unshare.php                         30-Sep-2022 11:10                4300
function.pcntl-wait.php                            30-Sep-2022 11:10                8023
function.pcntl-waitpid.php                         30-Sep-2022 11:10                9226
function.pcntl-wexitstatus.php                     30-Sep-2022 11:10                3718
function.pcntl-wifexited.php                       30-Sep-2022 11:10                3483
function.pcntl-wifsignaled.php                     30-Sep-2022 11:10                3431
function.pcntl-wifstopped.php                      30-Sep-2022 11:10                3414
function.pcntl-wstopsig.php                        30-Sep-2022 11:10                3675
function.pcntl-wtermsig.php                        30-Sep-2022 11:10                3888
function.pfsockopen.php                            30-Sep-2022 11:11                5120
function.pg-affected-rows.php                      30-Sep-2022 11:10                6842
function.pg-cancel-query.php                       30-Sep-2022 11:10                7608
function.pg-client-encoding.php                    30-Sep-2022 11:10                6747
function.pg-close.php                              30-Sep-2022 11:10                6499
function.pg-connect-poll.php                       30-Sep-2022 11:10                3586
function.pg-connect.php                            30-Sep-2022 11:10               11234
function.pg-connection-busy.php                    30-Sep-2022 11:10                5736
function.pg-connection-reset.php                   30-Sep-2022 11:10                5751
function.pg-connection-status.php                  30-Sep-2022 11:10                5542
function.pg-consume-input.php                      30-Sep-2022 11:10                3352
function.pg-convert.php                            30-Sep-2022 11:10                8504
function.pg-copy-from.php                          30-Sep-2022 11:10                7800
function.pg-copy-to.php                            30-Sep-2022 11:10                7234
function.pg-dbname.php                             30-Sep-2022 11:10                5183
function.pg-delete.php                             30-Sep-2022 11:10                8876
function.pg-end-copy.php                           30-Sep-2022 11:10                7301
function.pg-escape-bytea.php                       30-Sep-2022 11:10                7921
function.pg-escape-identifier.php                  30-Sep-2022 11:10                7840
function.pg-escape-literal.php                     30-Sep-2022 11:10                8345
function.pg-escape-string.php                      30-Sep-2022 11:10                7800
function.pg-execute.php                            30-Sep-2022 11:10               10526
function.pg-fetch-all-columns.php                  30-Sep-2022 11:10                7051
function.pg-fetch-all.php                          30-Sep-2022 11:10                8645
function.pg-fetch-array.php                        30-Sep-2022 11:10               12181
function.pg-fetch-assoc.php                        30-Sep-2022 11:10                9073
function.pg-fetch-object.php                       30-Sep-2022 11:10               10700
function.pg-fetch-result.php                       30-Sep-2022 11:10                8707
function.pg-fetch-row.php                          30-Sep-2022 11:10                9114
function.pg-field-is-null.php                      30-Sep-2022 11:10                8396
function.pg-field-name.php                         30-Sep-2022 11:10                9351
function.pg-field-num.php                          30-Sep-2022 11:10                6580
function.pg-field-prtlen.php                       30-Sep-2022 11:10               10750
function.pg-field-size.php                         30-Sep-2022 11:10                9598
function.pg-field-table.php                        30-Sep-2022 11:10                8350
function.pg-field-type-oid.php                     30-Sep-2022 11:10                7481
function.pg-field-type.php                         30-Sep-2022 11:10                7271
function.pg-flush.php                              30-Sep-2022 11:10                3367
function.pg-free-result.php                        30-Sep-2022 11:10                7328
function.pg-get-notify.php                         30-Sep-2022 11:10                6919
function.pg-get-pid.php                            30-Sep-2022 11:10                5102
function.pg-get-result.php                         30-Sep-2022 11:10                8823
function.pg-host.php                               30-Sep-2022 11:10                6301
function.pg-insert.php                             30-Sep-2022 11:10                9310
function.pg-last-error.php                         30-Sep-2022 11:10                7368
function.pg-last-notice.php                        30-Sep-2022 11:10                7642
function.pg-last-oid.php                           30-Sep-2022 11:10                7496
function.pg-lo-close.php                           30-Sep-2022 11:10                7247
function.pg-lo-create.php                          30-Sep-2022 11:10                8813
function.pg-lo-export.php                          30-Sep-2022 11:10                8184
function.pg-lo-import.php                          30-Sep-2022 11:10                7498
function.pg-lo-open.php                            30-Sep-2022 11:10                9116
function.pg-lo-read-all.php                        30-Sep-2022 11:10                6485
function.pg-lo-read.php                            30-Sep-2022 11:10                7019
function.pg-lo-seek.php                            30-Sep-2022 11:10                7746
function.pg-lo-tell.php                            30-Sep-2022 11:10                7123
function.pg-lo-truncate.php                        30-Sep-2022 11:10                6636
function.pg-lo-unlink.php                          30-Sep-2022 11:10                7118
function.pg-lo-write.php                           30-Sep-2022 11:10                8103
function.pg-meta-data.php                          30-Sep-2022 11:10                7271
function.pg-num-fields.php                         30-Sep-2022 11:10                5969
function.pg-num-rows.php                           30-Sep-2022 11:10                5937
function.pg-options.php                            30-Sep-2022 11:10                5540
function.pg-parameter-status.php                   30-Sep-2022 11:10                8277
function.pg-pconnect.php                           30-Sep-2022 11:10                9822
function.pg-ping.php                               30-Sep-2022 11:10                5966
function.pg-port.php                               30-Sep-2022 11:10                5773
function.pg-prepare.php                            30-Sep-2022 11:10               10472
function.pg-put-line.php                           30-Sep-2022 11:10                8733
function.pg-query-params.php                       30-Sep-2022 11:10               10838
function.pg-query.php                              30-Sep-2022 11:10               12556
function.pg-result-error-field.php                 30-Sep-2022 11:10                8661
function.pg-result-error.php                       30-Sep-2022 11:10                8102
function.pg-result-seek.php                        30-Sep-2022 11:10                7326
function.pg-result-status.php                      30-Sep-2022 11:10                7826
function.pg-select.php                             30-Sep-2022 11:10                9551
function.pg-send-execute.php                       30-Sep-2022 11:10               10659
function.pg-send-prepare.php                       30-Sep-2022 11:10               11032
function.pg-send-query-params.php                  30-Sep-2022 11:10                8013
function.pg-send-query.php                         30-Sep-2022 11:10                9862
function.pg-set-client-encoding.php                30-Sep-2022 11:10                9068
function.pg-set-error-verbosity.php                30-Sep-2022 11:10                8505
function.pg-socket.php                             30-Sep-2022 11:10                3513
function.pg-trace.php                              30-Sep-2022 11:10                8166
function.pg-transaction-status.php                 30-Sep-2022 11:10                6427
function.pg-tty.php                                30-Sep-2022 11:10                6065
function.pg-unescape-bytea.php                     30-Sep-2022 11:10                6384
function.pg-untrace.php                            30-Sep-2022 11:10                6510
function.pg-update.php                             30-Sep-2022 11:10                9750
function.pg-version.php                            30-Sep-2022 11:10                6521
function.php-ini-loaded-file.php                   30-Sep-2022 11:10                4687
function.php-ini-scanned-files.php                 30-Sep-2022 11:10                6672
function.php-sapi-name.php                         30-Sep-2022 11:10                5895
function.php-strip-whitespace.php                  30-Sep-2022 11:10                4810
function.php-uname.php                             30-Sep-2022 11:10                9650
function.phpcredits.php                            30-Sep-2022 11:10                8179
function.phpdbg-break-file.php                     30-Sep-2022 11:10                3654
function.phpdbg-break-function.php                 30-Sep-2022 11:10                3442
function.phpdbg-break-method.php                   30-Sep-2022 11:10                3720
function.phpdbg-break-next.php                     30-Sep-2022 11:10                3136
function.phpdbg-clear.php                          30-Sep-2022 11:10                3392
function.phpdbg-color.php                          30-Sep-2022 11:10                3543
function.phpdbg-end-oplog.php                      30-Sep-2022 11:10                2432
function.phpdbg-exec.php                           30-Sep-2022 11:10                2755
function.phpdbg-get-executable.php                 30-Sep-2022 11:10                2431
function.phpdbg-prompt.php                         30-Sep-2022 11:10                2740
function.phpdbg-start-oplog.php                    30-Sep-2022 11:10                2219
function.phpinfo.php                               30-Sep-2022 11:10                9733
function.phpversion.php                            30-Sep-2022 11:10               10824
function.pi.php                                    30-Sep-2022 11:10                2953
function.png2wbmp.php                              30-Sep-2022 11:10                6466
function.popen.php                                 30-Sep-2022 11:10                8529
function.pos.php                                   30-Sep-2022 11:11                1599
function.posix-access.php                          30-Sep-2022 11:10                6274
function.posix-ctermid.php                         30-Sep-2022 11:10                4257
function.posix-errno.php                           30-Sep-2022 11:10                1778
function.posix-get-last-error.php                  30-Sep-2022 11:10                4086
function.posix-getcwd.php                          30-Sep-2022 11:10                4113
function.posix-getegid.php                         30-Sep-2022 11:10                5343
function.posix-geteuid.php                         30-Sep-2022 11:10                5348
function.posix-getgid.php                          30-Sep-2022 11:10                4759
function.posix-getgrgid.php                        30-Sep-2022 11:10                6150
function.posix-getgrnam.php                        30-Sep-2022 11:10                5911
function.posix-getgroups.php                       30-Sep-2022 11:10                4090
function.posix-getlogin.php                        30-Sep-2022 11:10                3568
function.posix-getpgid.php                         30-Sep-2022 11:10                4470
function.posix-getpgrp.php                         30-Sep-2022 11:10                2458
function.posix-getpid.php                          30-Sep-2022 11:10                3283
function.posix-getppid.php                         30-Sep-2022 11:10                2857
function.posix-getpwnam.php                        30-Sep-2022 11:10                6544
function.posix-getpwuid.php                        30-Sep-2022 11:10                6576
function.posix-getrlimit.php                       30-Sep-2022 11:10                7052
function.posix-getsid.php                          30-Sep-2022 11:10                4643
function.posix-getuid.php                          30-Sep-2022 11:10                3364
function.posix-initgroups.php                      30-Sep-2022 11:10                3061
function.posix-isatty.php                          30-Sep-2022 11:10                3588
function.posix-kill.php                            30-Sep-2022 11:10                3162
function.posix-mkfifo.php                          30-Sep-2022 11:10                3134
function.posix-mknod.php                           30-Sep-2022 11:10                7138
function.posix-setegid.php                         30-Sep-2022 11:10                5049
function.posix-seteuid.php                         30-Sep-2022 11:10                3415
function.posix-setgid.php                          30-Sep-2022 11:10                5268
function.posix-setpgid.php                         30-Sep-2022 11:10                3236
function.posix-setrlimit.php                       30-Sep-2022 11:10                4181
function.posix-setsid.php                          30-Sep-2022 11:10                2519
function.posix-setuid.php                          30-Sep-2022 11:10                5507
function.posix-strerror.php                        30-Sep-2022 11:10                4710
function.posix-times.php                           30-Sep-2022 11:10                4829
function.posix-ttyname.php                         30-Sep-2022 11:10                3103
function.posix-uname.php                           30-Sep-2022 11:10                4994
function.pow.php                                   30-Sep-2022 11:10                6759
function.preg-filter.php                           30-Sep-2022 11:11                9469
function.preg-grep.php                             30-Sep-2022 11:11                5873
function.preg-last-error-msg.php                   30-Sep-2022 11:11                4077
function.preg-last-error.php                       30-Sep-2022 11:11                4930
function.preg-match-all.php                        30-Sep-2022 11:11               26005
function.preg-match.php                            30-Sep-2022 11:11               23468
function.preg-quote.php                            30-Sep-2022 11:11                9364
function.preg-replace-callback-array.php           30-Sep-2022 11:11               10466
function.preg-replace-callback.php                 30-Sep-2022 11:11               17907
function.preg-replace.php                          30-Sep-2022 11:11               24374
function.preg-split.php                            30-Sep-2022 11:11               12448
function.prev.php                                  30-Sep-2022 11:11                8403
function.print-r.php                               30-Sep-2022 11:11                9242
function.print.php                                 30-Sep-2022 11:11               14925
function.printf.php                                30-Sep-2022 11:11               24382
function.proc-close.php                            30-Sep-2022 11:10                3288
function.proc-get-status.php                       30-Sep-2022 11:10                5670
function.proc-nice.php                             30-Sep-2022 11:10                7575
function.proc-open.php                             30-Sep-2022 11:10               22691
function.proc-terminate.php                        30-Sep-2022 11:10                4626
function.property-exists.php                       30-Sep-2022 11:11                8546
function.ps-add-bookmark.php                       30-Sep-2022 11:10                4864
function.ps-add-launchlink.php                     30-Sep-2022 11:10                5370
function.ps-add-locallink.php                      30-Sep-2022 11:10                6100
function.ps-add-note.php                           30-Sep-2022 11:10                6729
function.ps-add-pdflink.php                        30-Sep-2022 11:10                6417
function.ps-add-weblink.php                        30-Sep-2022 11:10                5456
function.ps-arc.php                                30-Sep-2022 11:10                4846
function.ps-arcn.php                               30-Sep-2022 11:10                4852
function.ps-begin-page.php                         30-Sep-2022 11:10                6704
function.ps-begin-pattern.php                      30-Sep-2022 11:10               13297
function.ps-begin-template.php                     30-Sep-2022 11:10               11367
function.ps-circle.php                             30-Sep-2022 11:10                4488
function.ps-clip.php                               30-Sep-2022 11:10                2914
function.ps-close-image.php                        30-Sep-2022 11:10                3779
function.ps-close.php                              30-Sep-2022 11:10                3567
function.ps-closepath-stroke.php                   30-Sep-2022 11:10                2987
function.ps-closepath.php                          30-Sep-2022 11:10                3163
function.ps-continue-text.php                      30-Sep-2022 11:10                3934
function.ps-curveto.php                            30-Sep-2022 11:10                4667
function.ps-delete.php                             30-Sep-2022 11:10                3431
function.ps-end-page.php                           30-Sep-2022 11:10                3157
function.ps-end-pattern.php                        30-Sep-2022 11:10                3088
function.ps-end-template.php                       30-Sep-2022 11:10                3095
function.ps-fill-stroke.php                        30-Sep-2022 11:10                3208
function.ps-fill.php                               30-Sep-2022 11:10                3141
function.ps-findfont.php                           30-Sep-2022 11:10                6845
function.ps-get-buffer.php                         30-Sep-2022 11:10                3131
function.ps-get-parameter.php                      30-Sep-2022 11:10                7584
function.ps-get-value.php                          30-Sep-2022 11:10                9326
function.ps-hyphenate.php                          30-Sep-2022 11:10                7167
function.ps-include-file.php                       30-Sep-2022 11:10                2912
function.ps-lineto.php                             30-Sep-2022 11:10                8182
function.ps-makespotcolor.php                      30-Sep-2022 11:10               10278
function.ps-moveto.php                             30-Sep-2022 11:10                3617
function.ps-new.php                                30-Sep-2022 11:10                2928
function.ps-open-file.php                          30-Sep-2022 11:10                3510
function.ps-open-image-file.php                    30-Sep-2022 11:10                4683
function.ps-open-image.php                         30-Sep-2022 11:10                6498
function.ps-open-memory-image.php                  30-Sep-2022 11:10                2687
function.ps-place-image.php                        30-Sep-2022 11:10                4925
function.ps-rect.php                               30-Sep-2022 11:10                4660
function.ps-restore.php                            30-Sep-2022 11:10                3270
function.ps-rotate.php                             30-Sep-2022 11:10               12352
function.ps-save.php                               30-Sep-2022 11:10                3017
function.ps-scale.php                              30-Sep-2022 11:10                3541
function.ps-set-border-color.php                   30-Sep-2022 11:10                4605
function.ps-set-border-dash.php                    30-Sep-2022 11:10                4247
function.ps-set-border-style.php                   30-Sep-2022 11:10                4309
function.ps-set-info.php                           30-Sep-2022 11:10                5784
function.ps-set-parameter.php                      30-Sep-2022 11:10                3717
function.ps-set-text-pos.php                       30-Sep-2022 11:10                9344
function.ps-set-value.php                          30-Sep-2022 11:10                4552
function.ps-setcolor.php                           30-Sep-2022 11:10                5479
function.ps-setdash.php                            30-Sep-2022 11:10                3413
function.ps-setflat.php                            30-Sep-2022 11:10                2901
function.ps-setfont.php                            30-Sep-2022 11:10                3846
function.ps-setgray.php                            30-Sep-2022 11:10                3140
function.ps-setlinecap.php                         30-Sep-2022 11:10                3696
function.ps-setlinejoin.php                        30-Sep-2022 11:10                3714
function.ps-setlinewidth.php                       30-Sep-2022 11:10                3578
function.ps-setmiterlimit.php                      30-Sep-2022 11:10                3998
function.ps-setoverprintmode.php                   30-Sep-2022 11:10                2938
function.ps-setpolydash.php                        30-Sep-2022 11:10                7747
function.ps-shading-pattern.php                    30-Sep-2022 11:10                4060
function.ps-shading.php                            30-Sep-2022 11:10                6537
function.ps-shfill.php                             30-Sep-2022 11:10                3804
function.ps-show-boxed.php                         30-Sep-2022 11:10               12100
function.ps-show-xy.php                            30-Sep-2022 11:10                3973
function.ps-show-xy2.php                           30-Sep-2022 11:10                2721
function.ps-show.php                               30-Sep-2022 11:10                5626
function.ps-show2.php                              30-Sep-2022 11:10                3057
function.ps-string-geometry.php                    30-Sep-2022 11:10                4673
function.ps-stringwidth.php                        30-Sep-2022 11:10                4135
function.ps-stroke.php                             30-Sep-2022 11:10                3353
function.ps-symbol-name.php                        30-Sep-2022 11:10                3732
function.ps-symbol-width.php                       30-Sep-2022 11:10                4224
function.ps-symbol.php                             30-Sep-2022 11:10                3550
function.ps-translate.php                          30-Sep-2022 11:10               14387
function.pspell-add-to-personal.php                30-Sep-2022 11:10                6282
function.pspell-add-to-session.php                 30-Sep-2022 11:10                3884
function.pspell-check.php                          30-Sep-2022 11:10                4923
function.pspell-clear-session.php                  30-Sep-2022 11:10                5782
function.pspell-config-create.php                  30-Sep-2022 11:10                7927
function.pspell-config-data-dir.php                30-Sep-2022 11:10                3174
function.pspell-config-dict-dir.php                30-Sep-2022 11:10                3173
function.pspell-config-ignore.php                  30-Sep-2022 11:10                5617
function.pspell-config-mode.php                    30-Sep-2022 11:10                6238
function.pspell-config-personal.php                30-Sep-2022 11:10                6363
function.pspell-config-repl.php                    30-Sep-2022 11:10                6671
function.pspell-config-runtogether.php             30-Sep-2022 11:10                6121
function.pspell-config-save-repl.php               30-Sep-2022 11:10                5021
function.pspell-new-config.php                     30-Sep-2022 11:10                6349
function.pspell-new-personal.php                   30-Sep-2022 11:10               10230
function.pspell-new.php                            30-Sep-2022 11:10                8874
function.pspell-save-wordlist.php                  30-Sep-2022 11:10                5941
function.pspell-store-replacement.php              30-Sep-2022 11:10                7514
function.pspell-suggest.php                        30-Sep-2022 11:10                5602
function.putenv.php                                30-Sep-2022 11:10                3901
function.quoted-printable-decode.php               30-Sep-2022 11:11                5190
function.quoted-printable-encode.php               30-Sep-2022 11:11                5172
function.quotemeta.php                             30-Sep-2022 11:11                5964
function.rad2deg.php                               30-Sep-2022 11:10                3498
function.radius-acct-open.php                      30-Sep-2022 11:10                3169
function.radius-add-server.php                     30-Sep-2022 11:10                7402
function.radius-auth-open.php                      30-Sep-2022 11:10                3176
function.radius-close.php                          30-Sep-2022 11:10                2446
function.radius-config.php                         30-Sep-2022 11:10                3827
function.radius-create-request.php                 30-Sep-2022 11:10                5011
function.radius-cvt-addr.php                       30-Sep-2022 11:10                6750
function.radius-cvt-int.php                        30-Sep-2022 11:10                5987
function.radius-cvt-string.php                     30-Sep-2022 11:10                6044
function.radius-demangle-mppe-key.php              30-Sep-2022 11:10                2995
function.radius-demangle.php                       30-Sep-2022 11:10                2726
function.radius-get-attr.php                       30-Sep-2022 11:10                6781
function.radius-get-tagged-attr-data.php           30-Sep-2022 11:10                6763
function.radius-get-tagged-attr-tag.php            30-Sep-2022 11:10                6818
function.radius-get-vendor-attr.php                30-Sep-2022 11:10                8842
function.radius-put-addr.php                       30-Sep-2022 11:10                4970
function.radius-put-attr.php                       30-Sep-2022 11:10                8402
function.radius-put-int.php                        30-Sep-2022 11:10                7071
function.radius-put-string.php                     30-Sep-2022 11:10                7459
function.radius-put-vendor-addr.php                30-Sep-2022 11:10                4981
function.radius-put-vendor-attr.php                30-Sep-2022 11:10                7242
function.radius-put-vendor-int.php                 30-Sep-2022 11:10                5665
function.radius-put-vendor-string.php              30-Sep-2022 11:10                6056
function.radius-request-authenticator.php          30-Sep-2022 11:10                2999
function.radius-salt-encrypt-attr.php              30-Sep-2022 11:10                3994
function.radius-send-request.php                   30-Sep-2022 11:10                3619
function.radius-server-secret.php                  30-Sep-2022 11:10                2510
function.radius-strerror.php                       30-Sep-2022 11:10                2465
function.rand.php                                  30-Sep-2022 11:10                9764
function.random-bytes.php                          30-Sep-2022 11:10                7743
function.random-int.php                            30-Sep-2022 11:10                7859
function.range.php                                 30-Sep-2022 11:11                7900
function.rar-wrapper-cache-stats.php               30-Sep-2022 11:10                2261
function.rawurldecode.php                          30-Sep-2022 11:11                4754
function.rawurlencode.php                          30-Sep-2022 11:11                6444
function.read-exif-data.php                        30-Sep-2022 11:10                2536
function.readdir.php                               30-Sep-2022 11:10               10539
function.readfile.php                              30-Sep-2022 11:10                9972
function.readgzfile.php                            30-Sep-2022 11:10                4382
function.readline-add-history.php                  30-Sep-2022 11:10                2565
function.readline-callback-handler-install.php     30-Sep-2022 11:10               10019
function.readline-callback-handler-remove.php      30-Sep-2022 11:10                3746
function.readline-callback-read-char.php           30-Sep-2022 11:10                3800
function.readline-clear-history.php                30-Sep-2022 11:10                2341
function.readline-completion-function.php          30-Sep-2022 11:10                2890
function.readline-info.php                         30-Sep-2022 11:10                4469
function.readline-list-history.php                 30-Sep-2022 11:10                2258
function.readline-on-new-line.php                  30-Sep-2022 11:10                2627
function.readline-read-history.php                 30-Sep-2022 11:10                3188
function.readline-redisplay.php                    30-Sep-2022 11:10                2198
function.readline-write-history.php                30-Sep-2022 11:10                3144
function.readline.php                              30-Sep-2022 11:10                5015
function.readlink.php                              30-Sep-2022 11:10                4411
function.realpath-cache-get.php                    30-Sep-2022 11:10                4305
function.realpath-cache-size.php                   30-Sep-2022 11:10                3707
function.realpath.php                              30-Sep-2022 11:10                8529
function.recode-file.php                           30-Sep-2022 11:10                5365
function.recode-string.php                         30-Sep-2022 11:10                4866
function.recode.php                                30-Sep-2022 11:10                1713
function.register-shutdown-function.php            30-Sep-2022 11:11                8293
function.register-tick-function.php                30-Sep-2022 11:11                5481
function.rename.php                                30-Sep-2022 11:10                5759
function.require-once.php                          30-Sep-2022 11:10                1739
function.require.php                               30-Sep-2022 11:10                1954
function.reset.php                                 30-Sep-2022 11:11                9005
function.restore-error-handler.php                 30-Sep-2022 11:10                5802
function.restore-exception-handler.php             30-Sep-2022 11:10                6567
function.restore-include-path.php                  30-Sep-2022 11:10                5421
function.return.php                                30-Sep-2022 11:10                4628
function.rewind.php                                30-Sep-2022 11:10                6269
function.rewinddir.php                             30-Sep-2022 11:10                3361
function.rmdir.php                                 30-Sep-2022 11:10                4811
function.round.php                                 30-Sep-2022 11:10               23805
function.rpmaddtag.php                             30-Sep-2022 11:10                3137
function.rpmdbinfo.php                             30-Sep-2022 11:10                4706
function.rpmdbsearch.php                           30-Sep-2022 11:10                5491
function.rpminfo.php                               30-Sep-2022 11:10                4890
function.rpmvercmp.php                             30-Sep-2022 11:10                2547
function.rrd-create.php                            30-Sep-2022 11:11                2652
function.rrd-error.php                             30-Sep-2022 11:11                2005
function.rrd-fetch.php                             30-Sep-2022 11:11                2739
function.rrd-first.php                             30-Sep-2022 11:11                2678
function.rrd-graph.php                             30-Sep-2022 11:11                2930
function.rrd-info.php                              30-Sep-2022 11:11                2317
function.rrd-last.php                              30-Sep-2022 11:11                2306
function.rrd-lastupdate.php                        30-Sep-2022 11:11                2447
function.rrd-restore.php                           30-Sep-2022 11:11                2980
function.rrd-tune.php                              30-Sep-2022 11:11                2718
function.rrd-update.php                            30-Sep-2022 11:11                2791
function.rrd-version.php                           30-Sep-2022 11:11                2099
function.rrd-xport.php                             30-Sep-2022 11:11                2493
function.rrdc-disconnect.php                       30-Sep-2022 11:11                2486
function.rsort.php                                 30-Sep-2022 11:11                7950
function.rtrim.php                                 30-Sep-2022 11:11                9652
function.runkit7-constant-add.php                  30-Sep-2022 11:10                4225
function.runkit7-constant-redefine.php             30-Sep-2022 11:10                4097
function.runkit7-constant-remove.php               30-Sep-2022 11:10                3439
function.runkit7-function-add.php                  30-Sep-2022 11:10                8848
function.runkit7-function-copy.php                 30-Sep-2022 11:10                5273
function.runkit7-function-redefine.php             30-Sep-2022 11:10                9278
function.runkit7-function-remove.php               30-Sep-2022 11:10                3968
function.runkit7-function-rename.php               30-Sep-2022 11:10                4189
function.runkit7-import.php                        30-Sep-2022 11:10                3545
function.runkit7-method-add.php                    30-Sep-2022 11:10               10720
function.runkit7-method-copy.php                   30-Sep-2022 11:10                7051
function.runkit7-method-redefine.php               30-Sep-2022 11:10               11186
function.runkit7-method-remove.php                 30-Sep-2022 11:10                6447
function.runkit7-method-rename.php                 30-Sep-2022 11:10                6498
function.runkit7-object-id.php                     30-Sep-2022 11:10                3626
function.runkit7-superglobals.php                  30-Sep-2022 11:10                2556
function.runkit7-zval-inspect.php                  30-Sep-2022 11:10                5052
function.sapi-windows-cp-conv.php                  30-Sep-2022 11:10                4438
function.sapi-windows-cp-get.php                   30-Sep-2022 11:10                3462
function.sapi-windows-cp-is-utf8.php               30-Sep-2022 11:10                2782
function.sapi-windows-cp-set.php                   30-Sep-2022 11:10                2930
function.sapi-windows-generate-ctrl-event.php      30-Sep-2022 11:10                7718
function.sapi-windows-set-ctrl-handler.php         30-Sep-2022 11:10                7512
function.sapi-windows-vt100-support.php            30-Sep-2022 11:10               10118
function.scandir.php                               30-Sep-2022 11:10                8383
function.scoutapm-get-calls.php                    30-Sep-2022 11:11                4352
function.scoutapm-list-instrumented-functions.php  30-Sep-2022 11:11                3687
function.seaslog-get-author.php                    30-Sep-2022 11:10                3007
function.seaslog-get-version.php                   30-Sep-2022 11:10                3003
function.sem-acquire.php                           30-Sep-2022 11:10                4863
function.sem-get.php                               30-Sep-2022 11:10                6624
function.sem-release.php                           30-Sep-2022 11:10                4089
function.sem-remove.php                            30-Sep-2022 11:10                4070
function.serialize.php                             30-Sep-2022 11:11               11242
function.session-abort.php                         30-Sep-2022 11:11                4022
function.session-cache-expire.php                  30-Sep-2022 11:11                7846
function.session-cache-limiter.php                 30-Sep-2022 11:11                9061
function.session-commit.php                        30-Sep-2022 11:11                1805
function.session-create-id.php                     30-Sep-2022 11:11               11229
function.session-decode.php                        30-Sep-2022 11:11                3635
function.session-destroy.php                       30-Sep-2022 11:11                9851
function.session-encode.php                        30-Sep-2022 11:11                3839
function.session-gc.php                            30-Sep-2022 11:11                8324
function.session-get-cookie-params.php             30-Sep-2022 11:11                5630
function.session-id.php                            30-Sep-2022 11:11                6060
function.session-module-name.php                   30-Sep-2022 11:11                4119
function.session-name.php                          30-Sep-2022 11:11                7787
function.session-regenerate-id.php                 30-Sep-2022 11:11               18330
function.session-register-shutdown.php             30-Sep-2022 11:11                2682
function.session-reset.php                         30-Sep-2022 11:11                4110
function.session-save-path.php                     30-Sep-2022 11:11                4662
function.session-set-cookie-params.php             30-Sep-2022 11:11                9686
function.session-set-save-handler.php              30-Sep-2022 11:11               22633
function.session-start.php                         30-Sep-2022 11:11               15148
function.session-status.php                        30-Sep-2022 11:11                3063
function.session-unset.php                         30-Sep-2022 11:11                3875
function.session-write-close.php                   30-Sep-2022 11:11                3978
function.set-error-handler.php                     30-Sep-2022 11:10               29206
function.set-exception-handler.php                 30-Sep-2022 11:10                7808
function.set-file-buffer.php                       30-Sep-2022 11:10                1780
function.set-include-path.php                      30-Sep-2022 11:10                6188
function.set-time-limit.php                        30-Sep-2022 11:10                4631
function.setcookie.php                             30-Sep-2022 11:11               26379
function.setlocale.php                             30-Sep-2022 11:11               15110
function.setrawcookie.php                          30-Sep-2022 11:11                5476
function.settype.php                               30-Sep-2022 11:11                6178
function.sha1-file.php                             30-Sep-2022 11:11                5576
function.sha1.php                                  30-Sep-2022 11:11                5822
function.shell-exec.php                            30-Sep-2022 11:10                5419
function.shm-attach.php                            30-Sep-2022 11:10                5642
function.shm-detach.php                            30-Sep-2022 11:10                4331
function.shm-get-var.php                           30-Sep-2022 11:10                4286
function.shm-has-var.php                           30-Sep-2022 11:10                4106
function.shm-put-var.php                           30-Sep-2022 11:10                5155
function.shm-remove-var.php                        30-Sep-2022 11:10                3990
function.shm-remove.php                            30-Sep-2022 11:10                3771
function.shmop-close.php                           30-Sep-2022 11:10                4800
function.shmop-delete.php                          30-Sep-2022 11:10                4019
function.shmop-open.php                            30-Sep-2022 11:10                8154
function.shmop-read.php                            30-Sep-2022 11:10                5247
function.shmop-size.php                            30-Sep-2022 11:10                4140
function.shmop-write.php                           30-Sep-2022 11:10                5421
function.show-source.php                           30-Sep-2022 11:10                1741
function.shuffle.php                               30-Sep-2022 11:11                5530
function.similar-text.php                          30-Sep-2022 11:11                7037
function.simplexml-import-dom.php                  30-Sep-2022 11:11                6560
function.simplexml-load-file.php                   30-Sep-2022 11:11                9627
function.simplexml-load-string.php                 30-Sep-2022 11:11                8647
function.sin.php                                   30-Sep-2022 11:10                4611
function.sinh.php                                  30-Sep-2022 11:10                3093
function.sizeof.php                                30-Sep-2022 11:11                1618
function.sleep.php                                 30-Sep-2022 11:10                7251
function.snmp-get-quick-print.php                  30-Sep-2022 11:11                3540
function.snmp-get-valueretrieval.php               30-Sep-2022 11:11                4388
function.snmp-read-mib.php                         30-Sep-2022 11:11                4685
function.snmp-set-enum-print.php                   30-Sep-2022 11:11                4591
function.snmp-set-oid-numeric-print.php            30-Sep-2022 11:11                2318
function.snmp-set-oid-output-format.php            30-Sep-2022 11:11                6665
function.snmp-set-quick-print.php                  30-Sep-2022 11:11                6442
function.snmp-set-valueretrieval.php               30-Sep-2022 11:11                9155
function.snmp2-get.php                             30-Sep-2022 11:11                5469
function.snmp2-getnext.php                         30-Sep-2022 11:11                5852
function.snmp2-real-walk.php                       30-Sep-2022 11:11                6123
function.snmp2-set.php                             30-Sep-2022 11:11               10380
function.snmp2-walk.php                            30-Sep-2022 11:11                6630
function.snmp3-get.php                             30-Sep-2022 11:11                8317
function.snmp3-getnext.php                         30-Sep-2022 11:11                8660
function.snmp3-real-walk.php                       30-Sep-2022 11:11                9173
function.snmp3-set.php                             30-Sep-2022 11:11               12930
function.snmp3-walk.php                            30-Sep-2022 11:11                9593
function.snmpget.php                               30-Sep-2022 11:11                5463
function.snmpgetnext.php                           30-Sep-2022 11:11                5727
function.snmprealwalk.php                          30-Sep-2022 11:11                5998
function.snmpset.php                               30-Sep-2022 11:11               10411
function.snmpwalk.php                              30-Sep-2022 11:11                6656
function.snmpwalkoid.php                           30-Sep-2022 11:11                7336
function.socket-accept.php                         30-Sep-2022 11:11                6751
function.socket-addrinfo-bind.php                  30-Sep-2022 11:11                5275
function.socket-addrinfo-connect.php               30-Sep-2022 11:11                5052
function.socket-addrinfo-explain.php               30-Sep-2022 11:11                4376
function.socket-addrinfo-lookup.php                30-Sep-2022 11:11                5558
function.socket-bind.php                           30-Sep-2022 11:11               11342
function.socket-clear-error.php                    30-Sep-2022 11:11                4610
function.socket-close.php                          30-Sep-2022 11:11                4397
function.socket-cmsg-space.php                     30-Sep-2022 11:11                3476
function.socket-connect.php                        30-Sep-2022 11:11                6850
function.socket-create-listen.php                  30-Sep-2022 11:11                6926
function.socket-create-pair.php                    30-Sep-2022 11:11               21186
function.socket-create.php                         30-Sep-2022 11:11               11436
function.socket-export-stream.php                  30-Sep-2022 11:11                3295
function.socket-get-option.php                     30-Sep-2022 11:11               24267
function.socket-get-status.php                     30-Sep-2022 11:11                1790
function.socket-getopt.php                         30-Sep-2022 11:11                1777
function.socket-getpeername.php                    30-Sep-2022 11:11                7345
function.socket-getsockname.php                    30-Sep-2022 11:11                6798
function.socket-import-stream.php                  30-Sep-2022 11:11                5016
function.socket-last-error.php                     30-Sep-2022 11:11                7308
function.socket-listen.php                         30-Sep-2022 11:11                6919
function.socket-read.php                           30-Sep-2022 11:11                7489
function.socket-recv.php                           30-Sep-2022 11:11               16416
function.socket-recvfrom.php                       30-Sep-2022 11:11               12392
function.socket-recvmsg.php                        30-Sep-2022 11:11                4172
function.socket-select.php                         30-Sep-2022 11:11               15797
function.socket-send.php                           30-Sep-2022 11:11                6158
function.socket-sendmsg.php                        30-Sep-2022 11:11                4262
function.socket-sendto.php                         30-Sep-2022 11:11                9203
function.socket-set-block.php                      30-Sep-2022 11:11                5947
function.socket-set-blocking.php                   30-Sep-2022 11:11                1808
function.socket-set-nonblock.php                   30-Sep-2022 11:11                6395
function.socket-set-option.php                     30-Sep-2022 11:11               12140
function.socket-set-timeout.php                    30-Sep-2022 11:11                1777
function.socket-setopt.php                         30-Sep-2022 11:11                1771
function.socket-shutdown.php                       30-Sep-2022 11:11                4570
function.socket-strerror.php                       30-Sep-2022 11:11                7370
function.socket-write.php                          30-Sep-2022 11:11                7013
function.socket-wsaprotocol-info-export.php        30-Sep-2022 11:11                4838
function.socket-wsaprotocol-info-import.php        30-Sep-2022 11:11                4267
function.socket-wsaprotocol-info-release.php       30-Sep-2022 11:11                3423
function.sodium-add.php                            30-Sep-2022 11:10                3017
function.sodium-base642bin.php                     30-Sep-2022 11:10                4208
function.sodium-bin2base64.php                     30-Sep-2022 11:10                3854
function.sodium-bin2hex.php                        30-Sep-2022 11:10                2545
function.sodium-compare.php                        30-Sep-2022 11:10                3018
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-Sep-2022 11:10                4260
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-Sep-2022 11:10                4033
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-Sep-2022 11:10                2639
function.sodium-crypto-aead-aes256gcm-keygen.php   30-Sep-2022 11:10                2731
function.sodium-crypto-aead-chacha20poly1305-de..> 30-Sep-2022 11:10                4176
function.sodium-crypto-aead-chacha20poly1305-en..> 30-Sep-2022 11:10                3921
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:10                4406
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:10                4087
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:10                2925
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-Sep-2022 11:10                2860
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:10                4584
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:10                4305
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:10                2901
function.sodium-crypto-auth-keygen.php             30-Sep-2022 11:10                2552
function.sodium-crypto-auth-verify.php             30-Sep-2022 11:10                3528
function.sodium-crypto-auth.php                    30-Sep-2022 11:10                3145
function.sodium-crypto-box-keypair-from-secretk..> 30-Sep-2022 11:10                3224
function.sodium-crypto-box-keypair.php             30-Sep-2022 11:10                2833
function.sodium-crypto-box-open.php                30-Sep-2022 11:10                3667
function.sodium-crypto-box-publickey-from-secre..> 30-Sep-2022 11:10                3111
function.sodium-crypto-box-publickey.php           30-Sep-2022 11:10                2824
function.sodium-crypto-box-seal-open.php           30-Sep-2022 11:10                5918
function.sodium-crypto-box-seal.php                30-Sep-2022 11:10                7084
function.sodium-crypto-box-secretkey.php           30-Sep-2022 11:10                2791
function.sodium-crypto-box-seed-keypair.php        30-Sep-2022 11:10                2850
function.sodium-crypto-box.php                     30-Sep-2022 11:10                3958
function.sodium-crypto-core-ristretto255-add.php   30-Sep-2022 11:10                5926
function.sodium-crypto-core-ristretto255-from-h..> 30-Sep-2022 11:10                5357
function.sodium-crypto-core-ristretto255-is-val..> 30-Sep-2022 11:10                5431
function.sodium-crypto-core-ristretto255-random..> 30-Sep-2022 11:10                5544
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:10                6194
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:10                3441
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:10                5307
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:10                3644
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:10                5291
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:10                5704
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:10                3385
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:10                6185
function.sodium-crypto-core-ristretto255-sub.php   30-Sep-2022 11:10                5963
function.sodium-crypto-generichash-final.php       30-Sep-2022 11:10                6727
function.sodium-crypto-generichash-init.php        30-Sep-2022 11:10                6676
function.sodium-crypto-generichash-keygen.php      30-Sep-2022 11:10                2362
function.sodium-crypto-generichash-update.php      30-Sep-2022 11:10                6499
function.sodium-crypto-generichash.php             30-Sep-2022 11:10                3420
function.sodium-crypto-kdf-derive-from-key.php     30-Sep-2022 11:10                3653
function.sodium-crypto-kdf-keygen.php              30-Sep-2022 11:10                2464
function.sodium-crypto-kx-client-session-keys.php  30-Sep-2022 11:10                3179
function.sodium-crypto-kx-keypair.php              30-Sep-2022 11:10                4966
function.sodium-crypto-kx-publickey.php            30-Sep-2022 11:10                2643
function.sodium-crypto-kx-secretkey.php            30-Sep-2022 11:10                2654
function.sodium-crypto-kx-seed-keypair.php         30-Sep-2022 11:10                2581
function.sodium-crypto-kx-server-session-keys.php  30-Sep-2022 11:10                3245
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:10                3131
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:10                3281
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:10                5561
function.sodium-crypto-pwhash-str-needs-rehash.php 30-Sep-2022 11:10                3663
function.sodium-crypto-pwhash-str-verify.php       30-Sep-2022 11:10                4490
function.sodium-crypto-pwhash-str.php              30-Sep-2022 11:10                7931
function.sodium-crypto-pwhash.php                  30-Sep-2022 11:10                9421
function.sodium-crypto-scalarmult-base.php         30-Sep-2022 11:10                2025
function.sodium-crypto-scalarmult-ristretto255-..> 30-Sep-2022 11:10                3354
function.sodium-crypto-scalarmult-ristretto255.php 30-Sep-2022 11:10                3647
function.sodium-crypto-scalarmult.php              30-Sep-2022 11:10                2866
function.sodium-crypto-secretbox-keygen.php        30-Sep-2022 11:10                6294
function.sodium-crypto-secretbox-open.php          30-Sep-2022 11:10                8604
function.sodium-crypto-secretbox.php               30-Sep-2022 11:10                8523
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:10               11641
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:10               10793
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:10                2628
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:10                5501
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:10                5600
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:10                2866
function.sodium-crypto-shorthash-keygen.php        30-Sep-2022 11:10                2601
function.sodium-crypto-shorthash.php               30-Sep-2022 11:10                2978
function.sodium-crypto-sign-detached.php           30-Sep-2022 11:10                2971
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-Sep-2022 11:10                2811
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-Sep-2022 11:10                2867
function.sodium-crypto-sign-keypair-from-secret..> 30-Sep-2022 11:10                3050
function.sodium-crypto-sign-keypair.php            30-Sep-2022 11:10                2350
function.sodium-crypto-sign-open.php               30-Sep-2022 11:10                3089
function.sodium-crypto-sign-publickey-from-secr..> 30-Sep-2022 11:10                2669
function.sodium-crypto-sign-publickey.php          30-Sep-2022 11:10                2679
function.sodium-crypto-sign-secretkey.php          30-Sep-2022 11:10                2655
function.sodium-crypto-sign-seed-keypair.php       30-Sep-2022 11:10                2888
function.sodium-crypto-sign-verify-detached.php    30-Sep-2022 11:10                3305
function.sodium-crypto-sign.php                    30-Sep-2022 11:10                3049
function.sodium-crypto-stream-keygen.php           30-Sep-2022 11:10                2533
function.sodium-crypto-stream-xchacha20-keygen.php 30-Sep-2022 11:10                2691
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-Sep-2022 11:10                9471
function.sodium-crypto-stream-xchacha20-xor.php    30-Sep-2022 11:10                4458
function.sodium-crypto-stream-xchacha20.php        30-Sep-2022 11:10                3451
function.sodium-crypto-stream-xor.php              30-Sep-2022 11:10                3235
function.sodium-crypto-stream.php                  30-Sep-2022 11:10                3170
function.sodium-hex2bin.php                        30-Sep-2022 11:10                3097
function.sodium-increment.php                      30-Sep-2022 11:10                2406
function.sodium-memcmp.php                         30-Sep-2022 11:10                3205
function.sodium-memzero.php                        30-Sep-2022 11:10                2401
function.sodium-pad.php                            30-Sep-2022 11:10                2548
function.sodium-unpad.php                          30-Sep-2022 11:10                2503
function.solr-get-version.php                      30-Sep-2022 11:11                3835
function.sort.php                                  30-Sep-2022 11:11               11408
function.soundex.php                               30-Sep-2022 11:11                7506
function.spl-autoload-call.php                     30-Sep-2022 11:11                2535
function.spl-autoload-extensions.php               30-Sep-2022 11:11                4732
function.spl-autoload-functions.php                30-Sep-2022 11:11                2445
function.spl-autoload-register.php                 30-Sep-2022 11:11               10650
function.spl-autoload-unregister.php               30-Sep-2022 11:11                2919
function.spl-autoload.php                          30-Sep-2022 11:11                4292
function.spl-classes.php                           30-Sep-2022 11:11                3643
function.spl-object-hash.php                       30-Sep-2022 11:11                4509
function.spl-object-id.php                         30-Sep-2022 11:11                4029
function.sprintf.php                               30-Sep-2022 11:11               25663
function.sqlsrv-begin-transaction.php              30-Sep-2022 11:10               12071
function.sqlsrv-cancel.php                         30-Sep-2022 11:10               10746
function.sqlsrv-client-info.php                    30-Sep-2022 11:10                6914
function.sqlsrv-close.php                          30-Sep-2022 11:10                5565
function.sqlsrv-commit.php                         30-Sep-2022 11:10               11910
function.sqlsrv-configure.php                      30-Sep-2022 11:10                4480
function.sqlsrv-connect.php                        30-Sep-2022 11:10               12731
function.sqlsrv-errors.php                         30-Sep-2022 11:10               10672
function.sqlsrv-execute.php                        30-Sep-2022 11:10               10864
function.sqlsrv-fetch-array.php                    30-Sep-2022 11:10               15236
function.sqlsrv-fetch-object.php                   30-Sep-2022 11:10               12464
function.sqlsrv-fetch.php                          30-Sep-2022 11:10               11192
function.sqlsrv-field-metadata.php                 30-Sep-2022 11:10                9006
function.sqlsrv-free-stmt.php                      30-Sep-2022 11:10                7771
function.sqlsrv-get-config.php                     30-Sep-2022 11:10                3269
function.sqlsrv-get-field.php                      30-Sep-2022 11:10               10710
function.sqlsrv-has-rows.php                       30-Sep-2022 11:10                6471
function.sqlsrv-next-result.php                    30-Sep-2022 11:10                9634
function.sqlsrv-num-fields.php                     30-Sep-2022 11:10                8591
function.sqlsrv-num-rows.php                       30-Sep-2022 11:10                8106
function.sqlsrv-prepare.php                        30-Sep-2022 11:10               14959
function.sqlsrv-query.php                          30-Sep-2022 11:10               11697
function.sqlsrv-rollback.php                       30-Sep-2022 11:10               11380
function.sqlsrv-rows-affected.php                  30-Sep-2022 11:10                8223
function.sqlsrv-send-stream-data.php               30-Sep-2022 11:10                8976
function.sqlsrv-server-info.php                    30-Sep-2022 11:10                6345
function.sqrt.php                                  30-Sep-2022 11:10                4314
function.srand.php                                 30-Sep-2022 11:10                6562
function.sscanf.php                                30-Sep-2022 11:11               12155
function.ssdeep-fuzzy-compare.php                  30-Sep-2022 11:11                3035
function.ssdeep-fuzzy-hash-filename.php            30-Sep-2022 11:11                2809
function.ssdeep-fuzzy-hash.php                     30-Sep-2022 11:11                2651
function.ssh2-auth-agent.php                       30-Sep-2022 11:11                4566
function.ssh2-auth-hostbased-file.php              30-Sep-2022 11:11                7800
function.ssh2-auth-none.php                        30-Sep-2022 11:11                4891
function.ssh2-auth-password.php                    30-Sep-2022 11:11                4824
function.ssh2-auth-pubkey-file.php                 30-Sep-2022 11:11                7464
function.ssh2-connect.php                          30-Sep-2022 11:11               16395
function.ssh2-disconnect.php                       30-Sep-2022 11:11                2895
function.ssh2-exec.php                             30-Sep-2022 11:11                7047
function.ssh2-fetch-stream.php                     30-Sep-2022 11:11                5376
function.ssh2-fingerprint.php                      30-Sep-2022 11:11                5190
function.ssh2-forward-accept.php                   30-Sep-2022 11:11                2854
function.ssh2-forward-listen.php                   30-Sep-2022 11:11                4155
function.ssh2-methods-negotiated.php               30-Sep-2022 11:11                8272
function.ssh2-poll.php                             30-Sep-2022 11:11                3361
function.ssh2-publickey-add.php                    30-Sep-2022 11:11                8275
function.ssh2-publickey-init.php                   30-Sep-2022 11:11                4517
function.ssh2-publickey-list.php                   30-Sep-2022 11:11                9177
function.ssh2-publickey-remove.php                 30-Sep-2022 11:11                4639
function.ssh2-scp-recv.php                         30-Sep-2022 11:11                5235
function.ssh2-scp-send.php                         30-Sep-2022 11:11                5716
function.ssh2-send-eof.php                         30-Sep-2022 11:11                3261
function.ssh2-sftp-chmod.php                       30-Sep-2022 11:11                5762
function.ssh2-sftp-lstat.php                       30-Sep-2022 11:11                7452
function.ssh2-sftp-mkdir.php                       30-Sep-2022 11:11                6423
function.ssh2-sftp-readlink.php                    30-Sep-2022 11:11                5315
function.ssh2-sftp-realpath.php                    30-Sep-2022 11:11                5595
function.ssh2-sftp-rename.php                      30-Sep-2022 11:11                5275
function.ssh2-sftp-rmdir.php                       30-Sep-2022 11:11                5451
function.ssh2-sftp-stat.php                        30-Sep-2022 11:11                7420
function.ssh2-sftp-symlink.php                     30-Sep-2022 11:11                5619
function.ssh2-sftp-unlink.php                      30-Sep-2022 11:11                4887
function.ssh2-sftp.php                             30-Sep-2022 11:11                5412
function.ssh2-shell.php                            30-Sep-2022 11:11                7390
function.ssh2-tunnel.php                           30-Sep-2022 11:11                5177
function.stat.php                                  30-Sep-2022 11:10               17051
function.stats-absolute-deviation.php              30-Sep-2022 11:10                2651
function.stats-cdf-beta.php                        30-Sep-2022 11:10                4903
function.stats-cdf-binomial.php                    30-Sep-2022 11:10                4888
function.stats-cdf-cauchy.php                      30-Sep-2022 11:10                4923
function.stats-cdf-chisquare.php                   30-Sep-2022 11:10                4296
function.stats-cdf-exponential.php                 30-Sep-2022 11:10                4327
function.stats-cdf-f.php                           30-Sep-2022 11:10                4828
function.stats-cdf-gamma.php                       30-Sep-2022 11:10                4887
function.stats-cdf-laplace.php                     30-Sep-2022 11:10                4908
function.stats-cdf-logistic.php                    30-Sep-2022 11:10                4943
function.stats-cdf-negative-binomial.php           30-Sep-2022 11:10                5031
function.stats-cdf-noncentral-chisquare.php        30-Sep-2022 11:10                5133
function.stats-cdf-noncentral-f.php                30-Sep-2022 11:10                5653
function.stats-cdf-noncentral-t.php                30-Sep-2022 11:10                4993
function.stats-cdf-normal.php                      30-Sep-2022 11:10                4925
function.stats-cdf-poisson.php                     30-Sep-2022 11:10                4261
function.stats-cdf-t.php                           30-Sep-2022 11:10                4189
function.stats-cdf-uniform.php                     30-Sep-2022 11:10                4888
function.stats-cdf-weibull.php                     30-Sep-2022 11:10                4925
function.stats-covariance.php                      30-Sep-2022 11:10                2792
function.stats-dens-beta.php                       30-Sep-2022 11:10                3224
function.stats-dens-cauchy.php                     30-Sep-2022 11:10                3282
function.stats-dens-chisquare.php                  30-Sep-2022 11:10                3006
function.stats-dens-exponential.php                30-Sep-2022 11:10                2996
function.stats-dens-f.php                          30-Sep-2022 11:10                3222
function.stats-dens-gamma.php                      30-Sep-2022 11:10                3275
function.stats-dens-laplace.php                    30-Sep-2022 11:10                3309
function.stats-dens-logistic.php                   30-Sep-2022 11:10                3321
function.stats-dens-normal.php                     30-Sep-2022 11:10                3292
function.stats-dens-pmf-binomial.php               30-Sep-2022 11:10                3346
function.stats-dens-pmf-hypergeometric.php         30-Sep-2022 11:10                3944
function.stats-dens-pmf-negative-binomial.php      30-Sep-2022 11:10                3475
function.stats-dens-pmf-poisson.php                30-Sep-2022 11:10                2997
function.stats-dens-t.php                          30-Sep-2022 11:10                2910
function.stats-dens-uniform.php                    30-Sep-2022 11:10                3257
function.stats-dens-weibull.php                    30-Sep-2022 11:10                3289
function.stats-harmonic-mean.php                   30-Sep-2022 11:10                2636
function.stats-kurtosis.php                        30-Sep-2022 11:10                2553
function.stats-rand-gen-beta.php                   30-Sep-2022 11:10                2857
function.stats-rand-gen-chisquare.php              30-Sep-2022 11:10                2584
function.stats-rand-gen-exponential.php            30-Sep-2022 11:10                2582
function.stats-rand-gen-f.php                      30-Sep-2022 11:10                2911
function.stats-rand-gen-funiform.php               30-Sep-2022 11:10                2838
function.stats-rand-gen-gamma.php                  30-Sep-2022 11:10                2924
function.stats-rand-gen-ibinomial-negative.php     30-Sep-2022 11:10                3004
function.stats-rand-gen-ibinomial.php              30-Sep-2022 11:10                2928
function.stats-rand-gen-int.php                    30-Sep-2022 11:10                2205
function.stats-rand-gen-ipoisson.php               30-Sep-2022 11:10                2557
function.stats-rand-gen-iuniform.php               30-Sep-2022 11:10                2905
function.stats-rand-gen-noncentral-chisquare.php   30-Sep-2022 11:10                3046
function.stats-rand-gen-noncentral-f.php           30-Sep-2022 11:10                3345
function.stats-rand-gen-noncentral-t.php           30-Sep-2022 11:10                2959
function.stats-rand-gen-normal.php                 30-Sep-2022 11:10                2872
function.stats-rand-gen-t.php                      30-Sep-2022 11:10                2476
function.stats-rand-get-seeds.php                  30-Sep-2022 11:10                2248
function.stats-rand-phrase-to-seeds.php            30-Sep-2022 11:10                2563
function.stats-rand-ranf.php                       30-Sep-2022 11:10                2249
function.stats-rand-setall.php                     30-Sep-2022 11:10                2813
function.stats-skew.php                            30-Sep-2022 11:10                2519
function.stats-standard-deviation.php              30-Sep-2022 11:10                3417
function.stats-stat-binomial-coef.php              30-Sep-2022 11:10                2817
function.stats-stat-correlation.php                30-Sep-2022 11:10                2972
function.stats-stat-factorial.php                  30-Sep-2022 11:10                2444
function.stats-stat-independent-t.php              30-Sep-2022 11:10                3079
function.stats-stat-innerproduct.php               30-Sep-2022 11:10                2914
function.stats-stat-paired-t.php                   30-Sep-2022 11:10                2851
function.stats-stat-percentile.php                 30-Sep-2022 11:10                2769
function.stats-stat-powersum.php                   30-Sep-2022 11:10                2761
function.stats-variance.php                        30-Sep-2022 11:10                2973
function.stomp-connect-error.php                   30-Sep-2022 11:11                3615
function.stomp-version.php                         30-Sep-2022 11:11                3037
function.str-contains.php                          30-Sep-2022 11:11                8389
function.str-ends-with.php                         30-Sep-2022 11:11                8452
function.str-getcsv.php                            30-Sep-2022 11:11                7465
function.str-ireplace.php                          30-Sep-2022 11:11                8437
function.str-pad.php                               30-Sep-2022 11:11                7776
function.str-repeat.php                            30-Sep-2022 11:11                4557
function.str-replace.php                           30-Sep-2022 11:11               17535
function.str-rot13.php                             30-Sep-2022 11:11                3603
function.str-shuffle.php                           30-Sep-2022 11:11                5563
function.str-split.php                             30-Sep-2022 11:11                8592
function.str-starts-with.php                       30-Sep-2022 11:11                8509
function.str-word-count.php                        30-Sep-2022 11:11                9094
function.strcasecmp.php                            30-Sep-2022 11:11                6049
function.strchr.php                                30-Sep-2022 11:11                1641
function.strcmp.php                                30-Sep-2022 11:11                5787
function.strcoll.php                               30-Sep-2022 11:11                5456
function.strcspn.php                               30-Sep-2022 11:11               11249
function.stream-bucket-append.php                  30-Sep-2022 11:11                2102
function.stream-bucket-make-writeable.php          30-Sep-2022 11:11                4081
function.stream-bucket-new.php                     30-Sep-2022 11:11                2100
function.stream-bucket-prepend.php                 30-Sep-2022 11:11                6554
function.stream-context-create.php                 30-Sep-2022 11:11                7776
function.stream-context-get-default.php            30-Sep-2022 11:11                9311
function.stream-context-get-options.php            30-Sep-2022 11:11                4448
function.stream-context-get-params.php             30-Sep-2022 11:11                5638
function.stream-context-set-default.php            30-Sep-2022 11:11                6556
function.stream-context-set-option.php             30-Sep-2022 11:11                5136
function.stream-context-set-params.php             30-Sep-2022 11:11                4623
function.stream-copy-to-stream.php                 30-Sep-2022 11:11                7592
function.stream-filter-append.php                  30-Sep-2022 11:11               10887
function.stream-filter-prepend.php                 30-Sep-2022 11:11                7928
function.stream-filter-register.php                30-Sep-2022 11:11               19784
function.stream-filter-remove.php                  30-Sep-2022 11:11                6649
function.stream-get-contents.php                   30-Sep-2022 11:11                8414
function.stream-get-filters.php                    30-Sep-2022 11:11                4164
function.stream-get-line.php                       30-Sep-2022 11:11                4739
function.stream-get-meta-data.php                  30-Sep-2022 11:11               15633
function.stream-get-transports.php                 30-Sep-2022 11:11                4161
function.stream-get-wrappers.php                   30-Sep-2022 11:11                5030
function.stream-is-local.php                       30-Sep-2022 11:11                4005
function.stream-isatty.php                         30-Sep-2022 11:11                3832
function.stream-notification-callback.php          30-Sep-2022 11:11               25871
function.stream-register-wrapper.php               30-Sep-2022 11:11                1911
function.stream-resolve-include-path.php           30-Sep-2022 11:11                4006
function.stream-select.php                         30-Sep-2022 11:11               15551
function.stream-set-blocking.php                   30-Sep-2022 11:11                4399
function.stream-set-chunk-size.php                 30-Sep-2022 11:11                3221
function.stream-set-read-buffer.php                30-Sep-2022 11:11                3633
function.stream-set-timeout.php                    30-Sep-2022 11:11                8310
function.stream-set-write-buffer.php               30-Sep-2022 11:11                5996
function.stream-socket-accept.php                  30-Sep-2022 11:11                7470
function.stream-socket-client.php                  30-Sep-2022 11:11               17615
function.stream-socket-enable-crypto.php           30-Sep-2022 11:11               11517
function.stream-socket-get-name.php                30-Sep-2022 11:11                3549
function.stream-socket-pair.php                    30-Sep-2022 11:11                9137
function.stream-socket-recvfrom.php                30-Sep-2022 11:11               10774
function.stream-socket-sendto.php                  30-Sep-2022 11:11                7364
function.stream-socket-server.php                  30-Sep-2022 11:11               15736
function.stream-socket-shutdown.php                30-Sep-2022 11:11                6208
function.stream-supports-lock.php                  30-Sep-2022 11:11                3072
function.stream-wrapper-register.php               30-Sep-2022 11:11                9230
function.stream-wrapper-restore.php                30-Sep-2022 11:11                2789
function.stream-wrapper-unregister.php             30-Sep-2022 11:11                2994
function.strftime.php                              30-Sep-2022 11:10               61140
function.strip-tags.php                            30-Sep-2022 11:11                9425
function.stripcslashes.php                         30-Sep-2022 11:11                3970
function.stripos.php                               30-Sep-2022 11:11               12005
function.stripslashes.php                          30-Sep-2022 11:11                7892
function.stristr.php                               30-Sep-2022 11:11                9914
function.strlen.php                                30-Sep-2022 11:11                5369
function.strnatcasecmp.php                         30-Sep-2022 11:11                7274
function.strnatcmp.php                             30-Sep-2022 11:11                8754
function.strncasecmp.php                           30-Sep-2022 11:11                6572
function.strncmp.php                               30-Sep-2022 11:11                6502
function.strpbrk.php                               30-Sep-2022 11:11                5327
function.strpos.php                                30-Sep-2022 11:11               14456
function.strptime.php                              30-Sep-2022 11:10               11465
function.strrchr.php                               30-Sep-2022 11:11                6842
function.strrev.php                                30-Sep-2022 11:11                3089
function.strripos.php                              30-Sep-2022 11:11               10271
function.strrpos.php                               30-Sep-2022 11:11               13359
function.strspn.php                                30-Sep-2022 11:11                9986
function.strstr.php                                30-Sep-2022 11:11                8318
function.strtok.php                                30-Sep-2022 11:11               12431
function.strtolower.php                            30-Sep-2022 11:11                5231
function.strtotime.php                             30-Sep-2022 11:10               12896
function.strtoupper.php                            30-Sep-2022 11:11                5162
function.strtr.php                                 30-Sep-2022 11:11               10951
function.strval.php                                30-Sep-2022 11:11                6521
function.substr-compare.php                        30-Sep-2022 11:11               10561
function.substr-count.php                          30-Sep-2022 11:11                9731
function.substr-replace.php                        30-Sep-2022 11:11               16190
function.substr.php                                30-Sep-2022 11:11               23790
function.svn-add.php                               30-Sep-2022 11:11                5988
function.svn-auth-get-parameter.php                30-Sep-2022 11:11                3857
function.svn-auth-set-parameter.php                30-Sep-2022 11:11                5352
function.svn-blame.php                             30-Sep-2022 11:11                4809
function.svn-cat.php                               30-Sep-2022 11:11                4695
function.svn-checkout.php                          30-Sep-2022 11:11                7214
function.svn-cleanup.php                           30-Sep-2022 11:11                5088
function.svn-client-version.php                    30-Sep-2022 11:11                3440
function.svn-commit.php                            30-Sep-2022 11:11                7804
function.svn-delete.php                            30-Sep-2022 11:11                4409
function.svn-diff.php                              30-Sep-2022 11:11               13389
function.svn-export.php                            30-Sep-2022 11:11                4950
function.svn-fs-abort-txn.php                      30-Sep-2022 11:11                3006
function.svn-fs-apply-text.php                     30-Sep-2022 11:11                2605
function.svn-fs-begin-txn2.php                     30-Sep-2022 11:11                2550
function.svn-fs-change-node-prop.php               30-Sep-2022 11:11                2961
function.svn-fs-check-path.php                     30-Sep-2022 11:11                2656
function.svn-fs-contents-changed.php               30-Sep-2022 11:11                2962
function.svn-fs-copy.php                           30-Sep-2022 11:11                3827
function.svn-fs-delete.php                         30-Sep-2022 11:11                3228
function.svn-fs-dir-entries.php                    30-Sep-2022 11:11                2669
function.svn-fs-file-contents.php                  30-Sep-2022 11:11                2686
function.svn-fs-file-length.php                    30-Sep-2022 11:11                2615
function.svn-fs-is-dir.php                         30-Sep-2022 11:11                3267
function.svn-fs-is-file.php                        30-Sep-2022 11:11                3255
function.svn-fs-make-dir.php                       30-Sep-2022 11:11                3252
function.svn-fs-make-file.php                      30-Sep-2022 11:11                3269
function.svn-fs-node-created-rev.php               30-Sep-2022 11:11                2658
function.svn-fs-node-prop.php                      30-Sep-2022 11:11                2694
function.svn-fs-props-changed.php                  30-Sep-2022 11:11                2949
function.svn-fs-revision-prop.php                  30-Sep-2022 11:11                2709
function.svn-fs-revision-root.php                  30-Sep-2022 11:11                2633
function.svn-fs-txn-root.php                       30-Sep-2022 11:11                2456
function.svn-fs-youngest-rev.php                   30-Sep-2022 11:11                2504
function.svn-import.php                            30-Sep-2022 11:11                5825
function.svn-log.php                               30-Sep-2022 11:11                8756
function.svn-ls.php                                30-Sep-2022 11:11                7025
function.svn-mkdir.php                             30-Sep-2022 11:11                3031
function.svn-repos-create.php                      30-Sep-2022 11:11                2764
function.svn-repos-fs-begin-txn-for-commit.php     30-Sep-2022 11:11                3018
function.svn-repos-fs-commit-txn.php               30-Sep-2022 11:11                2559
function.svn-repos-fs.php                          30-Sep-2022 11:11                2453
function.svn-repos-hotcopy.php                     30-Sep-2022 11:11                2712
function.svn-repos-open.php                        30-Sep-2022 11:11                2429
function.svn-repos-recover.php                     30-Sep-2022 11:11                2478
function.svn-revert.php                            30-Sep-2022 11:11                3321
function.svn-status.php                            30-Sep-2022 11:11               14605
function.svn-update.php                            30-Sep-2022 11:11                5943
function.swoole-async-dns-lookup.php               30-Sep-2022 11:11                3573
function.swoole-async-read.php                     30-Sep-2022 11:11                4166
function.swoole-async-readfile.php                 30-Sep-2022 11:11                3593
function.swoole-async-set.php                      30-Sep-2022 11:11                2325
function.swoole-async-write.php                    30-Sep-2022 11:11                3433
function.swoole-async-writefile.php                30-Sep-2022 11:11                3461
function.swoole-clear-error.php                    30-Sep-2022 11:11                2238
function.swoole-client-select.php                  30-Sep-2022 11:11                3213
function.swoole-cpu-num.php                        30-Sep-2022 11:11                2057
function.swoole-errno.php                          30-Sep-2022 11:11                2034
function.swoole-error-log.php                      30-Sep-2022 11:11                2992
function.swoole-event-add.php                      30-Sep-2022 11:11                3336
function.swoole-event-defer.php                    30-Sep-2022 11:11                2482
function.swoole-event-del.php                      30-Sep-2022 11:11                2390
function.swoole-event-exit.php                     30-Sep-2022 11:11                2133
function.swoole-event-set.php                      30-Sep-2022 11:11                3323
function.swoole-event-wait.php                     30-Sep-2022 11:11                2104
function.swoole-event-write.php                    30-Sep-2022 11:11                2606
function.swoole-get-local-ip.php                   30-Sep-2022 11:11                2128
function.swoole-last-error.php                     30-Sep-2022 11:11                2083
function.swoole-load-module.php                    30-Sep-2022 11:11                2280
function.swoole-select.php                         30-Sep-2022 11:11                3180
function.swoole-set-process-name.php               30-Sep-2022 11:11                2488
function.swoole-strerror.php                       30-Sep-2022 11:11                2409
function.swoole-timer-after.php                    30-Sep-2022 11:11                2942
function.swoole-timer-exists.php                   30-Sep-2022 11:11                2305
function.swoole-timer-tick.php                     30-Sep-2022 11:11                2815
function.swoole-version.php                        30-Sep-2022 11:11                2060
function.symlink.php                               30-Sep-2022 11:10                5401
function.sys-get-temp-dir.php                      30-Sep-2022 11:10                4169
function.sys-getloadavg.php                        30-Sep-2022 11:10                4095
function.syslog.php                                30-Sep-2022 11:11                9419
function.system.php                                30-Sep-2022 11:10                7694
function.taint.php                                 30-Sep-2022 11:11                2491
function.tan.php                                   30-Sep-2022 11:10                4243
function.tanh.php                                  30-Sep-2022 11:10                3103
function.tcpwrap-check.php                         30-Sep-2022 11:11                5491
function.tempnam.php                               30-Sep-2022 11:10                7070
function.textdomain.php                            30-Sep-2022 11:10                3101
function.tidy-access-count.php                     30-Sep-2022 11:11                6587
function.tidy-config-count.php                     30-Sep-2022 11:11                4299
function.tidy-error-count.php                      30-Sep-2022 11:11                5309
function.tidy-get-output.php                       30-Sep-2022 11:11                4270
function.tidy-warning-count.php                    30-Sep-2022 11:11                4903
function.time-nanosleep.php                        30-Sep-2022 11:10                8874
function.time-sleep-until.php                      30-Sep-2022 11:10                5667
function.time.php                                  30-Sep-2022 11:10                4656
function.timezone-abbreviations-list.php           30-Sep-2022 11:10                1916
function.timezone-identifiers-list.php             30-Sep-2022 11:10                1932
function.timezone-location-get.php                 30-Sep-2022 11:10                1888
function.timezone-name-from-abbr.php               30-Sep-2022 11:10                6265
function.timezone-name-get.php                     30-Sep-2022 11:10                1833
function.timezone-offset-get.php                   30-Sep-2022 11:10                1830
function.timezone-open.php                         30-Sep-2022 11:10                1802
function.timezone-transitions-get.php              30-Sep-2022 11:10                1894
function.timezone-version-get.php                  30-Sep-2022 11:10                4243
function.tmpfile.php                               30-Sep-2022 11:10                5459
function.token-get-all.php                         30-Sep-2022 11:11               12245
function.token-name.php                            30-Sep-2022 11:11                4346
function.touch.php                                 30-Sep-2022 11:10                7599
function.trader-acos.php                           30-Sep-2022 11:10                2351
function.trader-ad.php                             30-Sep-2022 11:10                3101
function.trader-add.php                            30-Sep-2022 11:10                2626
function.trader-adosc.php                          30-Sep-2022 11:10                3853
function.trader-adx.php                            30-Sep-2022 11:10                3187
function.trader-adxr.php                           30-Sep-2022 11:10                3198
function.trader-apo.php                            30-Sep-2022 11:10                3387
function.trader-aroon.php                          30-Sep-2022 11:10                2809
function.trader-aroonosc.php                       30-Sep-2022 11:10                2846
function.trader-asin.php                           30-Sep-2022 11:10                2364
function.trader-atan.php                           30-Sep-2022 11:10                2357
function.trader-atr.php                            30-Sep-2022 11:10                3177
function.trader-avgprice.php                       30-Sep-2022 11:10                3158
function.trader-bbands.php                         30-Sep-2022 11:10                4092
function.trader-beta.php                           30-Sep-2022 11:10                2777
function.trader-bop.php                            30-Sep-2022 11:10                3107
function.trader-cci.php                            30-Sep-2022 11:10                3182
function.trader-cdl2crows.php                      30-Sep-2022 11:10                3180
function.trader-cdl3blackcrows.php                 30-Sep-2022 11:10                3242
function.trader-cdl3inside.php                     30-Sep-2022 11:10                3223
function.trader-cdl3linestrike.php                 30-Sep-2022 11:10                3246
function.trader-cdl3outside.php                    30-Sep-2022 11:10                3238
function.trader-cdl3starsinsouth.php               30-Sep-2022 11:10                3287
function.trader-cdl3whitesoldiers.php              30-Sep-2022 11:10                3311
function.trader-cdlabandonedbaby.php               30-Sep-2022 11:10                3645
function.trader-cdladvanceblock.php                30-Sep-2022 11:10                3264
function.trader-cdlbelthold.php                    30-Sep-2022 11:10                3220
function.trader-cdlbreakaway.php                   30-Sep-2022 11:10                3234
function.trader-cdlclosingmarubozu.php             30-Sep-2022 11:10                3305
function.trader-cdlconcealbabyswall.php            30-Sep-2022 11:10                3328
function.trader-cdlcounterattack.php               30-Sep-2022 11:10                3292
function.trader-cdldarkcloudcover.php              30-Sep-2022 11:10                3639
function.trader-cdldoji.php                        30-Sep-2022 11:10                3177
function.trader-cdldojistar.php                    30-Sep-2022 11:10                3212
function.trader-cdldragonflydoji.php               30-Sep-2022 11:10                3267
function.trader-cdlengulfing.php                   30-Sep-2022 11:10                3252
function.trader-cdleveningdojistar.php             30-Sep-2022 11:10                3656
function.trader-cdleveningstar.php                 30-Sep-2022 11:10                3633
function.trader-cdlgapsidesidewhite.php            30-Sep-2022 11:10                3335
function.trader-cdlgravestonedoji.php              30-Sep-2022 11:10                3288
function.trader-cdlhammer.php                      30-Sep-2022 11:10                3203
function.trader-cdlhangingman.php                  30-Sep-2022 11:10                3224
function.trader-cdlharami.php                      30-Sep-2022 11:10                3205
function.trader-cdlharamicross.php                 30-Sep-2022 11:10                3247
function.trader-cdlhighwave.php                    30-Sep-2022 11:10                3221
function.trader-cdlhikkake.php                     30-Sep-2022 11:10                3210
function.trader-cdlhikkakemod.php                  30-Sep-2022 11:10                3251
function.trader-cdlhomingpigeon.php                30-Sep-2022 11:10                3272
function.trader-cdlidentical3crows.php             30-Sep-2022 11:10                3296
function.trader-cdlinneck.php                      30-Sep-2022 11:10                3222
function.trader-cdlinvertedhammer.php              30-Sep-2022 11:10                3270
function.trader-cdlkicking.php                     30-Sep-2022 11:10                3224
function.trader-cdlkickingbylength.php             30-Sep-2022 11:10                3330
function.trader-cdlladderbottom.php                30-Sep-2022 11:10                3280
function.trader-cdllongleggeddoji.php              30-Sep-2022 11:10                3285
function.trader-cdllongline.php                    30-Sep-2022 11:10                3229
function.trader-cdlmarubozu.php                    30-Sep-2022 11:10                3215
function.trader-cdlmatchinglow.php                 30-Sep-2022 11:10                3241
function.trader-cdlmathold.php                     30-Sep-2022 11:10                3579
function.trader-cdlmorningdojistar.php             30-Sep-2022 11:10                3652
function.trader-cdlmorningstar.php                 30-Sep-2022 11:10                3613
function.trader-cdlonneck.php                      30-Sep-2022 11:10                3202
function.trader-cdlpiercing.php                    30-Sep-2022 11:10                3219
function.trader-cdlrickshawman.php                 30-Sep-2022 11:10                3259
function.trader-cdlrisefall3methods.php            30-Sep-2022 11:10                3329
function.trader-cdlseparatinglines.php             30-Sep-2022 11:10                3311
function.trader-cdlshootingstar.php                30-Sep-2022 11:10                3270
function.trader-cdlshortline.php                   30-Sep-2022 11:10                3242
function.trader-cdlspinningtop.php                 30-Sep-2022 11:10                3257
function.trader-cdlstalledpattern.php              30-Sep-2022 11:10                3292
function.trader-cdlsticksandwich.php               30-Sep-2022 11:10                3273
function.trader-cdltakuri.php                      30-Sep-2022 11:10                3244
function.trader-cdltasukigap.php                   30-Sep-2022 11:10                3219
function.trader-cdlthrusting.php                   30-Sep-2022 11:10                3228
function.trader-cdltristar.php                     30-Sep-2022 11:10                3216
function.trader-cdlunique3river.php                30-Sep-2022 11:10                3267
function.trader-cdlupsidegap2crows.php             30-Sep-2022 11:10                3315
function.trader-cdlxsidegap3methods.php            30-Sep-2022 11:10                3314
function.trader-ceil.php                           30-Sep-2022 11:10                2381
function.trader-cmo.php                            30-Sep-2022 11:10                2544
function.trader-correl.php                         30-Sep-2022 11:10                2829
function.trader-cos.php                            30-Sep-2022 11:10                2347
function.trader-cosh.php                           30-Sep-2022 11:10                2363
function.trader-dema.php                           30-Sep-2022 11:10                2555
function.trader-div.php                            30-Sep-2022 11:10                2642
function.trader-dx.php                             30-Sep-2022 11:10                3163
function.trader-ema.php                            30-Sep-2022 11:10                2538
function.trader-errno.php                          30-Sep-2022 11:10                2127
function.trader-exp.php                            30-Sep-2022 11:10                2391
function.trader-floor.php                          30-Sep-2022 11:10                2373
function.trader-get-compat.php                     30-Sep-2022 11:10                2317
function.trader-get-unstable-period.php            30-Sep-2022 11:10                2595
function.trader-ht-dcperiod.php                    30-Sep-2022 11:10                2361
function.trader-ht-dcphase.php                     30-Sep-2022 11:10                2332
function.trader-ht-phasor.php                      30-Sep-2022 11:10                2313
function.trader-ht-sine.php                        30-Sep-2022 11:10                2292
function.trader-ht-trendline.php                   30-Sep-2022 11:10                2353
function.trader-ht-trendmode.php                   30-Sep-2022 11:10                2343
function.trader-kama.php                           30-Sep-2022 11:10                2593
function.trader-linearreg-angle.php                30-Sep-2022 11:10                2687
function.trader-linearreg-intercept.php            30-Sep-2022 11:10                2745
function.trader-linearreg-slope.php                30-Sep-2022 11:10                2697
function.trader-linearreg.php                      30-Sep-2022 11:10                2609
function.trader-ln.php                             30-Sep-2022 11:10                2349
function.trader-log10.php                          30-Sep-2022 11:10                2353
function.trader-ma.php                             30-Sep-2022 11:10                2905
function.trader-macd.php                           30-Sep-2022 11:10                3372
function.trader-macdext.php                        30-Sep-2022 11:10                4703
function.trader-macdfix.php                        30-Sep-2022 11:10                2639
function.trader-mama.php                           30-Sep-2022 11:10                2926
function.trader-mavp.php                           30-Sep-2022 11:10                3725
function.trader-max.php                            30-Sep-2022 11:10                2559
function.trader-maxindex.php                       30-Sep-2022 11:10                2616
function.trader-medprice.php                       30-Sep-2022 11:10                2530
function.trader-mfi.php                            30-Sep-2022 11:10                3472
function.trader-midpoint.php                       30-Sep-2022 11:10                2590
function.trader-midprice.php                       30-Sep-2022 11:10                2860
function.trader-min.php                            30-Sep-2022 11:10                2566
function.trader-minindex.php                       30-Sep-2022 11:10                2611
function.trader-minmax.php                         30-Sep-2022 11:10                2615
function.trader-minmaxindex.php                    30-Sep-2022 11:10                2666
function.trader-minus-di.php                       30-Sep-2022 11:10                3250
function.trader-minus-dm.php                       30-Sep-2022 11:10                2860
function.trader-mom.php                            30-Sep-2022 11:10                2530
function.trader-mult.php                           30-Sep-2022 11:10                2642
function.trader-natr.php                           30-Sep-2022 11:10                3188
function.trader-obv.php                            30-Sep-2022 11:10                2483
function.trader-plus-di.php                        30-Sep-2022 11:10                3221
function.trader-plus-dm.php                        30-Sep-2022 11:10                2847
function.trader-ppo.php                            30-Sep-2022 11:10                3391
function.trader-roc.php                            30-Sep-2022 11:10                2554
function.trader-rocp.php                           30-Sep-2022 11:10                2582
function.trader-rocr.php                           30-Sep-2022 11:10                2567
function.trader-rocr100.php                        30-Sep-2022 11:10                2607
function.trader-rsi.php                            30-Sep-2022 11:10                2535
function.trader-sar.php                            30-Sep-2022 11:10                3437
function.trader-sarext.php                         30-Sep-2022 11:10                6525
function.trader-set-compat.php                     30-Sep-2022 11:10                2534
function.trader-set-unstable-period.php            30-Sep-2022 11:10                3068
function.trader-sin.php                            30-Sep-2022 11:10                2371
function.trader-sinh.php                           30-Sep-2022 11:10                2359
function.trader-sma.php                            30-Sep-2022 11:10                2535
function.trader-sqrt.php                           30-Sep-2022 11:10                2352
function.trader-stddev.php                         30-Sep-2022 11:10                2825
function.trader-stoch.php                          30-Sep-2022 11:10                4839
function.trader-stochf.php                         30-Sep-2022 11:10                4054
function.trader-stochrsi.php                       30-Sep-2022 11:10                3850
function.trader-sub.php                            30-Sep-2022 11:10                2647
function.trader-sum.php                            30-Sep-2022 11:10                2517
function.trader-t3.php                             30-Sep-2022 11:10                2842
function.trader-tan.php                            30-Sep-2022 11:10                2340
function.trader-tanh.php                           30-Sep-2022 11:10                2364
function.trader-tema.php                           30-Sep-2022 11:10                2561
function.trader-trange.php                         30-Sep-2022 11:10                2764
function.trader-trima.php                          30-Sep-2022 11:10                2563
function.trader-trix.php                           30-Sep-2022 11:10                2573
function.trader-tsf.php                            30-Sep-2022 11:10                2542
function.trader-typprice.php                       30-Sep-2022 11:10                2787
function.trader-ultosc.php                         30-Sep-2022 11:10                3937
function.trader-var.php                            30-Sep-2022 11:10                2795
function.trader-wclprice.php                       30-Sep-2022 11:10                2792
function.trader-willr.php                          30-Sep-2022 11:10                3194
function.trader-wma.php                            30-Sep-2022 11:10                2571
function.trait-exists.php                          30-Sep-2022 11:11                2779
function.trigger-error.php                         30-Sep-2022 11:10                6368
function.trim.php                                  30-Sep-2022 11:11               13094
function.uasort.php                                30-Sep-2022 11:11                9440
function.ucfirst.php                               30-Sep-2022 11:11                5553
function.ucwords.php                               30-Sep-2022 11:11                9816
function.ui-draw-text-font-fontfamilies.php        30-Sep-2022 11:11                2274
function.ui-quit.php                               30-Sep-2022 11:11                2000
function.ui-run.php                                30-Sep-2022 11:11                2328
function.uksort.php                                30-Sep-2022 11:11                9108
function.umask.php                                 30-Sep-2022 11:10                5674
function.uniqid.php                                30-Sep-2022 11:10                7668
function.unixtojd.php                              30-Sep-2022 11:10                3844
function.unlink.php                                30-Sep-2022 11:10                5781
function.unpack.php                                30-Sep-2022 11:10               10482
function.unregister-tick-function.php              30-Sep-2022 11:11                3258
function.unserialize.php                           30-Sep-2022 11:11               16452
function.unset.php                                 30-Sep-2022 11:11               15530
function.untaint.php                               30-Sep-2022 11:11                2347
function.uopz-add-function.php                     30-Sep-2022 11:10                6585
function.uopz-allow-exit.php                       30-Sep-2022 11:10                4551
function.uopz-backup.php                           30-Sep-2022 11:10                4376
function.uopz-compose.php                          30-Sep-2022 11:10                6873
function.uopz-copy.php                             30-Sep-2022 11:10                5088
function.uopz-del-function.php                     30-Sep-2022 11:10                6128
function.uopz-delete.php                           30-Sep-2022 11:10                5872
function.uopz-extend.php                           30-Sep-2022 11:10                4754
function.uopz-flags.php                            30-Sep-2022 11:10               10706
function.uopz-function.php                         30-Sep-2022 11:10                7064
function.uopz-get-exit-status.php                  30-Sep-2022 11:10                4179
function.uopz-get-hook.php                         30-Sep-2022 11:10                5183
function.uopz-get-mock.php                         30-Sep-2022 11:10                5126
function.uopz-get-property.php                     30-Sep-2022 11:10                6116
function.uopz-get-return.php                       30-Sep-2022 11:10                4324
function.uopz-get-static.php                       30-Sep-2022 11:10                4803
function.uopz-implement.php                        30-Sep-2022 11:10                4779
function.uopz-overload.php                         30-Sep-2022 11:10                3861
function.uopz-redefine.php                         30-Sep-2022 11:10                4818
function.uopz-rename.php                           30-Sep-2022 11:10                6549
function.uopz-restore.php                          30-Sep-2022 11:10                4744
function.uopz-set-hook.php                         30-Sep-2022 11:10                5349
function.uopz-set-mock.php                         30-Sep-2022 11:10               12569
function.uopz-set-property.php                     30-Sep-2022 11:10                7566
function.uopz-set-return.php                       30-Sep-2022 11:10                9363
function.uopz-set-static.php                       30-Sep-2022 11:10                5441
function.uopz-undefine.php                         30-Sep-2022 11:10                4280
function.uopz-unset-hook.php                       30-Sep-2022 11:10                5243
function.uopz-unset-mock.php                       30-Sep-2022 11:10                5466
function.uopz-unset-return.php                     30-Sep-2022 11:10                4620
function.urldecode.php                             30-Sep-2022 11:11                6644
function.urlencode.php                             30-Sep-2022 11:11                8459
function.use-soap-error-handler.php                30-Sep-2022 11:11                3628
function.user-error.php                            30-Sep-2022 11:10                1706
function.usleep.php                                30-Sep-2022 11:10                5930
function.usort.php                                 30-Sep-2022 11:11               27729
function.utf8-decode.php                           30-Sep-2022 11:11                8981
function.utf8-encode.php                           30-Sep-2022 11:11                7468
function.var-dump.php                              30-Sep-2022 11:11                7086
function.var-export.php                            30-Sep-2022 11:11               17765
function.var-representation.php                    30-Sep-2022 11:11               14397
function.variant-abs.php                           30-Sep-2022 11:11                4241
function.variant-add.php                           30-Sep-2022 11:11                5497
function.variant-and.php                           30-Sep-2022 11:11                6250
function.variant-cast.php                          30-Sep-2022 11:11                3513
function.variant-cat.php                           30-Sep-2022 11:11                4804
function.variant-cmp.php                           30-Sep-2022 11:11                7386
function.variant-date-from-timestamp.php           30-Sep-2022 11:11                3640
function.variant-date-to-timestamp.php             30-Sep-2022 11:11                3661
function.variant-div.php                           30-Sep-2022 11:11                6429
function.variant-eqv.php                           30-Sep-2022 11:11                4405
function.variant-fix.php                           30-Sep-2022 11:11                5519
function.variant-get-type.php                      30-Sep-2022 11:11                3444
function.variant-idiv.php                          30-Sep-2022 11:11                5765
function.variant-imp.php                           30-Sep-2022 11:11                5766
function.variant-int.php                           30-Sep-2022 11:11                5070
function.variant-mod.php                           30-Sep-2022 11:11                4926
function.variant-mul.php                           30-Sep-2022 11:11                5827
function.variant-neg.php                           30-Sep-2022 11:11                3881
function.variant-not.php                           30-Sep-2022 11:11                4040
function.variant-or.php                            30-Sep-2022 11:11                6432
function.variant-pow.php                           30-Sep-2022 11:11                4673
function.variant-round.php                         30-Sep-2022 11:11                4378
function.variant-set-type.php                      30-Sep-2022 11:11                3623
function.variant-set.php                           30-Sep-2022 11:11                2897
function.variant-sub.php                           30-Sep-2022 11:11                5478
function.variant-xor.php                           30-Sep-2022 11:11                5803
function.version-compare.php                       30-Sep-2022 11:10               11588
function.vfprintf.php                              30-Sep-2022 11:11               16389
function.virtual.php                               30-Sep-2022 11:11                5321
function.vprintf.php                               30-Sep-2022 11:11               15523
function.vsprintf.php                              30-Sep-2022 11:11               16070
function.wddx-add-vars.php                         30-Sep-2022 11:11                3736
function.wddx-deserialize.php                      30-Sep-2022 11:11                3672
function.wddx-packet-end.php                       30-Sep-2022 11:11                2783
function.wddx-packet-start.php                     30-Sep-2022 11:11                2931
function.wddx-serialize-value.php                  30-Sep-2022 11:11                3206
function.wddx-serialize-vars.php                   30-Sep-2022 11:11                6102
function.win32-continue-service.php                30-Sep-2022 11:11                6450
function.win32-create-service.php                  30-Sep-2022 11:11               32909
function.win32-delete-service.php                  30-Sep-2022 11:11                6843
function.win32-get-last-control-message.php        30-Sep-2022 11:11                7093
function.win32-pause-service.php                   30-Sep-2022 11:11                6446
function.win32-query-service-status.php            30-Sep-2022 11:11                8312
function.win32-send-custom-control.php             30-Sep-2022 11:11                7001
function.win32-set-service-exit-code.php           30-Sep-2022 11:11                5673
function.win32-set-service-exit-mode.php           30-Sep-2022 11:11                5716
function.win32-set-service-status.php              30-Sep-2022 11:11                8244
function.win32-start-service-ctrl-dispatcher.php   30-Sep-2022 11:11               10740
function.win32-start-service.php                   30-Sep-2022 11:11                6555
function.win32-stop-service.php                    30-Sep-2022 11:11                6735
function.wincache-fcache-fileinfo.php              30-Sep-2022 11:10                9164
function.wincache-fcache-meminfo.php               30-Sep-2022 11:10                7090
function.wincache-lock.php                         30-Sep-2022 11:10                8561
function.wincache-ocache-fileinfo.php              30-Sep-2022 11:10                9853
function.wincache-ocache-meminfo.php               30-Sep-2022 11:10                7306
function.wincache-refresh-if-changed.php           30-Sep-2022 11:10                7838
function.wincache-rplist-fileinfo.php              30-Sep-2022 11:10                7529
function.wincache-rplist-meminfo.php               30-Sep-2022 11:10                7205
function.wincache-scache-info.php                  30-Sep-2022 11:10                9432
function.wincache-scache-meminfo.php               30-Sep-2022 11:10                6663
function.wincache-ucache-add.php                   30-Sep-2022 11:10               13224
function.wincache-ucache-cas.php                   30-Sep-2022 11:10                6090
function.wincache-ucache-clear.php                 30-Sep-2022 11:10                7569
function.wincache-ucache-dec.php                   30-Sep-2022 11:10                6120
function.wincache-ucache-delete.php                30-Sep-2022 11:10               11460
function.wincache-ucache-exists.php                30-Sep-2022 11:10                6077
function.wincache-ucache-get.php                   30-Sep-2022 11:10               10533
function.wincache-ucache-inc.php                   30-Sep-2022 11:10                6112
function.wincache-ucache-info.php                  30-Sep-2022 11:10               11151
function.wincache-ucache-meminfo.php               30-Sep-2022 11:10                6867
function.wincache-ucache-set.php                   30-Sep-2022 11:10               13452
function.wincache-unlock.php                       30-Sep-2022 11:10                7930
function.wordwrap.php                              30-Sep-2022 11:11                9115
function.xattr-get.php                             30-Sep-2022 11:10                5931
function.xattr-list.php                            30-Sep-2022 11:10                6534
function.xattr-remove.php                          30-Sep-2022 11:10                6160
function.xattr-set.php                             30-Sep-2022 11:10                7735
function.xattr-supported.php                       30-Sep-2022 11:10                5187
function.xdiff-file-bdiff-size.php                 30-Sep-2022 11:10                4887
function.xdiff-file-bdiff.php                      30-Sep-2022 11:10                5904
function.xdiff-file-bpatch.php                     30-Sep-2022 11:10                6524
function.xdiff-file-diff-binary.php                30-Sep-2022 11:10                6367
function.xdiff-file-diff.php                       30-Sep-2022 11:10                7180
function.xdiff-file-merge3.php                     30-Sep-2022 11:10                6786
function.xdiff-file-patch-binary.php               30-Sep-2022 11:10                6695
function.xdiff-file-patch.php                      30-Sep-2022 11:10                8968
function.xdiff-file-rabdiff.php                    30-Sep-2022 11:10                6333
function.xdiff-string-bdiff-size.php               30-Sep-2022 11:10                5237
function.xdiff-string-bdiff.php                    30-Sep-2022 11:10                3704
function.xdiff-string-bpatch.php                   30-Sep-2022 11:10                3845
function.xdiff-string-diff-binary.php              30-Sep-2022 11:10                4319
function.xdiff-string-diff.php                     30-Sep-2022 11:10                6449
function.xdiff-string-merge3.php                   30-Sep-2022 11:10                4752
function.xdiff-string-patch-binary.php             30-Sep-2022 11:10                4423
function.xdiff-string-patch.php                    30-Sep-2022 11:10                8281
function.xdiff-string-rabdiff.php                  30-Sep-2022 11:10                4279
function.xhprof-disable.php                        30-Sep-2022 11:10                3857
function.xhprof-enable.php                         30-Sep-2022 11:10                7802
function.xhprof-sample-disable.php                 30-Sep-2022 11:10                4662
function.xhprof-sample-enable.php                  30-Sep-2022 11:10                3506
function.xml-error-string.php                      30-Sep-2022 11:11                3245
function.xml-get-current-byte-index.php            30-Sep-2022 11:11                4925
function.xml-get-current-column-number.php         30-Sep-2022 11:11                4824
function.xml-get-current-line-number.php           30-Sep-2022 11:11                4611
function.xml-get-error-code.php                    30-Sep-2022 11:11                4120
function.xml-parse-into-struct.php                 30-Sep-2022 11:11               20765
function.xml-parse.php                             30-Sep-2022 11:11                8187
function.xml-parser-create-ns.php                  30-Sep-2022 11:11                5234
function.xml-parser-create.php                     30-Sep-2022 11:11                5105
function.xml-parser-free.php                       30-Sep-2022 11:11                3938
function.xml-parser-get-option.php                 30-Sep-2022 11:11                4517
function.xml-parser-set-option.php                 30-Sep-2022 11:11                6124
function.xml-set-character-data-handler.php        30-Sep-2022 11:11                5883
function.xml-set-default-handler.php               30-Sep-2022 11:11                5767
function.xml-set-element-handler.php               30-Sep-2022 11:11                8778
function.xml-set-end-namespace-decl-handler.php    30-Sep-2022 11:11                6996
function.xml-set-external-entity-ref-handler.php   30-Sep-2022 11:11                8056
function.xml-set-notation-decl-handler.php         30-Sep-2022 11:11                7831
function.xml-set-object.php                        30-Sep-2022 11:11               10863
function.xml-set-processing-instruction-handler..> 30-Sep-2022 11:11                6895
function.xml-set-start-namespace-decl-handler.php  30-Sep-2022 11:11                7109
function.xml-set-unparsed-entity-decl-handler.php  30-Sep-2022 11:11                8416
function.xmlrpc-decode-request.php                 30-Sep-2022 11:11                2663
function.xmlrpc-decode.php                         30-Sep-2022 11:11                4228
function.xmlrpc-encode-request.php                 30-Sep-2022 11:11                9536
function.xmlrpc-encode.php                         30-Sep-2022 11:11                2351
function.xmlrpc-get-type.php                       30-Sep-2022 11:11                6621
function.xmlrpc-is-fault.php                       30-Sep-2022 11:11                3815
function.xmlrpc-parse-method-descriptions.php      30-Sep-2022 11:11                2462
function.xmlrpc-server-add-introspection-data.php  30-Sep-2022 11:11                2594
function.xmlrpc-server-call-method.php             30-Sep-2022 11:11                3002
function.xmlrpc-server-create.php                  30-Sep-2022 11:11                2224
function.xmlrpc-server-destroy.php                 30-Sep-2022 11:11                2392
function.xmlrpc-server-register-introspection-c..> 30-Sep-2022 11:11                2651
function.xmlrpc-server-register-method.php         30-Sep-2022 11:11                2679
function.xmlrpc-set-type.php                       30-Sep-2022 11:11                5439
function.xmlwriter-writeattribute.php              30-Sep-2022 11:11                8843
function.yaml-emit-file.php                        30-Sep-2022 11:11                5831
function.yaml-emit.php                             30-Sep-2022 11:11               12833
function.yaml-parse-file.php                       30-Sep-2022 11:11                5714
function.yaml-parse-url.php                        30-Sep-2022 11:11                6042
function.yaml-parse.php                            30-Sep-2022 11:11                9982
function.yaz-addinfo.php                           30-Sep-2022 11:11                3336
function.yaz-ccl-conf.php                          30-Sep-2022 11:11                5775
function.yaz-ccl-parse.php                         30-Sep-2022 11:11                6805
function.yaz-close.php                             30-Sep-2022 11:11                3336
function.yaz-connect.php                           30-Sep-2022 11:11                9374
function.yaz-database.php                          30-Sep-2022 11:11                3240
function.yaz-element.php                           30-Sep-2022 11:11                3655
function.yaz-errno.php                             30-Sep-2022 11:11                3664
function.yaz-error.php                             30-Sep-2022 11:11                3316
function.yaz-es-result.php                         30-Sep-2022 11:11                3218
function.yaz-es.php                                30-Sep-2022 11:11                7315
function.yaz-get-option.php                        30-Sep-2022 11:11                3267
function.yaz-hits.php                              30-Sep-2022 11:11                5230
function.yaz-itemorder.php                         30-Sep-2022 11:11                7356
function.yaz-present.php                           30-Sep-2022 11:11                2823
function.yaz-range.php                             30-Sep-2022 11:11                3457
function.yaz-record.php                            30-Sep-2022 11:11               14415
function.yaz-scan-result.php                       30-Sep-2022 11:11                3871
function.yaz-scan.php                              30-Sep-2022 11:11                9877
function.yaz-schema.php                            30-Sep-2022 11:11                3293
function.yaz-search.php                            30-Sep-2022 11:11                9165
function.yaz-set-option.php                        30-Sep-2022 11:11                7134
function.yaz-sort.php                              30-Sep-2022 11:11                5703
function.yaz-syntax.php                            30-Sep-2022 11:11                3313
function.yaz-wait.php                              30-Sep-2022 11:11                4091
function.zend-thread-id.php                        30-Sep-2022 11:10                3694
function.zend-version.php                          30-Sep-2022 11:10                3970
function.zip-close.php                             30-Sep-2022 11:10                3927
function.zip-entry-close.php                       30-Sep-2022 11:10                4025
function.zip-entry-compressedsize.php              30-Sep-2022 11:10                4390
function.zip-entry-compressionmethod.php           30-Sep-2022 11:10                4463
function.zip-entry-filesize.php                    30-Sep-2022 11:10                4276
function.zip-entry-name.php                        30-Sep-2022 11:10                4185
function.zip-entry-open.php                        30-Sep-2022 11:10                5611
function.zip-entry-read.php                        30-Sep-2022 11:10                4935
function.zip-open.php                              30-Sep-2022 11:10                4361
function.zip-read.php                              30-Sep-2022 11:10                4609
function.zlib-decode.php                           30-Sep-2022 11:10                3205
function.zlib-encode.php                           30-Sep-2022 11:10                4957
function.zlib-get-coding-type.php                  30-Sep-2022 11:10                2814
function.zookeeper-dispatch.php                    30-Sep-2022 11:11                8647
functional.parallel.php                            30-Sep-2022 11:10                2547
functions.anonymous.php                            30-Sep-2022 11:10               26234
functions.arguments.php                            30-Sep-2022 11:10               50125
functions.arrow.php                                30-Sep-2022 11:10               11338
functions.first_class_callable_syntax.php          30-Sep-2022 11:10               12503
functions.internal.php                             30-Sep-2022 11:10                8051
functions.returning-values.php                     30-Sep-2022 11:10                6133
functions.user-defined.php                         30-Sep-2022 11:10               10076
functions.variable-functions.php                   30-Sep-2022 11:10               12860
gearman.configuration.php                          30-Sep-2022 11:11                1264
gearman.constants.php                              30-Sep-2022 11:11               17929
gearman.examples-reverse-bg.php                    30-Sep-2022 11:11               11687
gearman.examples-reverse-task.php                  30-Sep-2022 11:11               18866
gearman.examples-reverse.php                       30-Sep-2022 11:11               14312
gearman.examples.php                               30-Sep-2022 11:11                1562
gearman.installation.php                           30-Sep-2022 11:11                1542
gearman.requirements.php                           30-Sep-2022 11:11                1468
gearman.resources.php                              30-Sep-2022 11:11                1245
gearman.setup.php                                  30-Sep-2022 11:11                1579
gearmanclient.addoptions.php                       30-Sep-2022 11:11                2857
gearmanclient.addserver.php                        30-Sep-2022 11:11                4930
gearmanclient.addservers.php                       30-Sep-2022 11:11                4428
gearmanclient.addtask.php                          30-Sep-2022 11:11               15218
gearmanclient.addtaskbackground.php                30-Sep-2022 11:11               21511
gearmanclient.addtaskhigh.php                      30-Sep-2022 11:11               11333
gearmanclient.addtaskhighbackground.php            30-Sep-2022 11:11                5878
gearmanclient.addtasklow.php                       30-Sep-2022 11:11               11315
gearmanclient.addtasklowbackground.php             30-Sep-2022 11:11                5871
gearmanclient.addtaskstatus.php                    30-Sep-2022 11:11                9927
gearmanclient.clearcallbacks.php                   30-Sep-2022 11:11                4343
gearmanclient.clone.php                            30-Sep-2022 11:11                2573
gearmanclient.construct.php                        30-Sep-2022 11:11                2817
gearmanclient.context.php                          30-Sep-2022 11:11                2830
gearmanclient.data.php                             30-Sep-2022 11:11                3100
gearmanclient.do.php                               30-Sep-2022 11:11               23902
gearmanclient.dobackground.php                     30-Sep-2022 11:11                9742
gearmanclient.dohigh.php                           30-Sep-2022 11:11                4765
gearmanclient.dohighbackground.php                 30-Sep-2022 11:11                4592
gearmanclient.dojobhandle.php                      30-Sep-2022 11:11                2887
gearmanclient.dolow.php                            30-Sep-2022 11:11                4751
gearmanclient.dolowbackground.php                  30-Sep-2022 11:11                4574
gearmanclient.donormal.php                         30-Sep-2022 11:11               24290
gearmanclient.dostatus.php                         30-Sep-2022 11:11                8776
gearmanclient.echo.php                             30-Sep-2022 11:11                2754
gearmanclient.error.php                            30-Sep-2022 11:11                2575
gearmanclient.geterrno.php                         30-Sep-2022 11:11                2599
gearmanclient.jobstatus.php                        30-Sep-2022 11:11                8643
gearmanclient.ping.php                             30-Sep-2022 11:11                2727
gearmanclient.removeoptions.php                    30-Sep-2022 11:11                2503
gearmanclient.returncode.php                       30-Sep-2022 11:11                2223
gearmanclient.runtasks.php                         30-Sep-2022 11:11                3554
gearmanclient.setclientcallback.php                30-Sep-2022 11:11                5353
gearmanclient.setcompletecallback.php              30-Sep-2022 11:11                5185
gearmanclient.setcontext.php                       30-Sep-2022 11:11                3069
gearmanclient.setcreatedcallback.php               30-Sep-2022 11:11                4658
gearmanclient.setdata.php                          30-Sep-2022 11:11                3266
gearmanclient.setdatacallback.php                  30-Sep-2022 11:11                4709
gearmanclient.setexceptioncallback.php             30-Sep-2022 11:11                4629
gearmanclient.setfailcallback.php                  30-Sep-2022 11:11                4715
gearmanclient.setoptions.php                       30-Sep-2022 11:11                2489
gearmanclient.setstatuscallback.php                30-Sep-2022 11:11                4715
gearmanclient.settimeout.php                       30-Sep-2022 11:11                2531
gearmanclient.setwarningcallback.php               30-Sep-2022 11:11                4718
gearmanclient.setworkloadcallback.php              30-Sep-2022 11:11                4872
gearmanclient.timeout.php                          30-Sep-2022 11:11                2694
gearmanclient.wait.php                             30-Sep-2022 11:11                2637
gearmanjob.complete.php                            30-Sep-2022 11:11                3392
gearmanjob.construct.php                           30-Sep-2022 11:11                2315
gearmanjob.data.php                                30-Sep-2022 11:11                3352
gearmanjob.exception.php                           30-Sep-2022 11:11                3574
gearmanjob.fail.php                                30-Sep-2022 11:11                3565
gearmanjob.functionname.php                        30-Sep-2022 11:11                2620
gearmanjob.handle.php                              30-Sep-2022 11:11                2507
gearmanjob.returncode.php                          30-Sep-2022 11:11                2554
gearmanjob.sendcomplete.php                        30-Sep-2022 11:11                3108
gearmanjob.senddata.php                            30-Sep-2022 11:11                3075
gearmanjob.sendexception.php                       30-Sep-2022 11:11                3303
gearmanjob.sendfail.php                            30-Sep-2022 11:11                3279
gearmanjob.sendstatus.php                          30-Sep-2022 11:11                3766
gearmanjob.sendwarning.php                         30-Sep-2022 11:11                3299
gearmanjob.setreturn.php                           30-Sep-2022 11:11                2424
gearmanjob.status.php                              30-Sep-2022 11:11                4052
gearmanjob.unique.php                              30-Sep-2022 11:11                2759
gearmanjob.warning.php                             30-Sep-2022 11:11                3585
gearmanjob.workload.php                            30-Sep-2022 11:11                2765
gearmanjob.workloadsize.php                        30-Sep-2022 11:11                2570
gearmantask.construct.php                          30-Sep-2022 11:11                2335
gearmantask.create.php                             30-Sep-2022 11:11                2711
gearmantask.data.php                               30-Sep-2022 11:11                2561
gearmantask.datasize.php                           30-Sep-2022 11:11                2586
gearmantask.function.php                           30-Sep-2022 11:11                2570
gearmantask.functionname.php                       30-Sep-2022 11:11                2257
gearmantask.isknown.php                            30-Sep-2022 11:11                2272
gearmantask.isrunning.php                          30-Sep-2022 11:11                2276
gearmantask.jobhandle.php                          30-Sep-2022 11:11                2656
gearmantask.recvdata.php                           30-Sep-2022 11:11                3241
gearmantask.returncode.php                         30-Sep-2022 11:11                2581
gearmantask.senddata.php                           30-Sep-2022 11:11                3168
gearmantask.sendworkload.php                       30-Sep-2022 11:11                3201
gearmantask.taskdenominator.php                    30-Sep-2022 11:11                2779
gearmantask.tasknumerator.php                      30-Sep-2022 11:11                2751
gearmantask.unique.php                             30-Sep-2022 11:11                3009
gearmantask.uuid.php                               30-Sep-2022 11:11                3303
gearmanworker.addfunction.php                      30-Sep-2022 11:11                7829
gearmanworker.addoptions.php                       30-Sep-2022 11:11                3255
gearmanworker.addserver.php                        30-Sep-2022 11:11                4587
gearmanworker.addservers.php                       30-Sep-2022 11:11                4080
gearmanworker.clone.php                            30-Sep-2022 11:11                2271
gearmanworker.construct.php                        30-Sep-2022 11:11                2790
gearmanworker.echo.php                             30-Sep-2022 11:11                2908
gearmanworker.error.php                            30-Sep-2022 11:11                2528
gearmanworker.geterrno.php                         30-Sep-2022 11:11                2566
gearmanworker.options.php                          30-Sep-2022 11:11                2573
gearmanworker.register.php                         30-Sep-2022 11:11                3626
gearmanworker.removeoptions.php                    30-Sep-2022 11:11                3277
gearmanworker.returncode.php                       30-Sep-2022 11:11                2776
gearmanworker.setid.php                            30-Sep-2022 11:11                3853
gearmanworker.setoptions.php                       30-Sep-2022 11:11                3425
gearmanworker.settimeout.php                       30-Sep-2022 11:11                8089
gearmanworker.timeout.php                          30-Sep-2022 11:11                2673
gearmanworker.unregister.php                       30-Sep-2022 11:11                3244
gearmanworker.unregisterall.php                    30-Sep-2022 11:11                2951
gearmanworker.wait.php                             30-Sep-2022 11:11                8440
gearmanworker.work.php                             30-Sep-2022 11:11                5372
gender-gender.connect.php                          30-Sep-2022 11:10                2420
gender-gender.construct.php                        30-Sep-2022 11:10                2331
gender-gender.country.php                          30-Sep-2022 11:10                3609
gender-gender.get.php                              30-Sep-2022 11:10                2683
gender-gender.isnick.php                           30-Sep-2022 11:10                3136
gender-gender.similarnames.php                     30-Sep-2022 11:10                2796
gender.example.admin.php                           30-Sep-2022 11:10                9309
gender.examples.php                                30-Sep-2022 11:10                1329
gender.installation.php                            30-Sep-2022 11:10                1897
gender.setup.php                                   30-Sep-2022 11:10                1326
generator.current.php                              30-Sep-2022 11:10                2134
generator.getreturn.php                            30-Sep-2022 11:10                3979
generator.key.php                                  30-Sep-2022 11:10                3986
generator.next.php                                 30-Sep-2022 11:10                2366
generator.rewind.php                               30-Sep-2022 11:10                2135
generator.send.php                                 30-Sep-2022 11:10                5858
generator.throw.php                                30-Sep-2022 11:10                5286
generator.valid.php                                30-Sep-2022 11:10                2105
generator.wakeup.php                               30-Sep-2022 11:10                2142
geoip.configuration.php                            30-Sep-2022 11:10                2425
geoip.constants.php                                30-Sep-2022 11:10                4489
geoip.installation.php                             30-Sep-2022 11:10                1659
geoip.requirements.php                             30-Sep-2022 11:10                1671
geoip.resources.php                                30-Sep-2022 11:10                1201
geoip.setup.php                                    30-Sep-2022 11:10                1540
gettext.configuration.php                          30-Sep-2022 11:10                1264
gettext.constants.php                              30-Sep-2022 11:10                1151
gettext.installation.php                           30-Sep-2022 11:10                1410
gettext.requirements.php                           30-Sep-2022 11:10                1359
gettext.resources.php                              30-Sep-2022 11:10                1215
gettext.setup.php                                  30-Sep-2022 11:10                1584
getting-started.php                                30-Sep-2022 11:10                1889
globiterator.construct.php                         30-Sep-2022 11:10                7857
globiterator.count.php                             30-Sep-2022 11:10                4399
gmagick.addimage.php                               30-Sep-2022 11:10                2854
gmagick.addnoiseimage.php                          30-Sep-2022 11:10                2851
gmagick.annotateimage.php                          30-Sep-2022 11:10                4226
gmagick.blurimage.php                              30-Sep-2022 11:10                3135
gmagick.borderimage.php                            30-Sep-2022 11:10                3646
gmagick.charcoalimage.php                          30-Sep-2022 11:10                3143
gmagick.chopimage.php                              30-Sep-2022 11:10                3687
gmagick.clear.php                                  30-Sep-2022 11:10                2593
gmagick.commentimage.php                           30-Sep-2022 11:10                2796
gmagick.compositeimage.php                         30-Sep-2022 11:10                3908
gmagick.configuration.php                          30-Sep-2022 11:10                1263
gmagick.constants.php                              30-Sep-2022 11:10               68521
gmagick.construct.php                              30-Sep-2022 11:10                2551
gmagick.cropimage.php                              30-Sep-2022 11:10                3822
gmagick.cropthumbnailimage.php                     30-Sep-2022 11:10                3180
gmagick.current.php                                30-Sep-2022 11:10                2494
gmagick.cyclecolormapimage.php                     30-Sep-2022 11:10                2924
gmagick.deconstructimages.php                      30-Sep-2022 11:10                2742
gmagick.despeckleimage.php                         30-Sep-2022 11:10                3434
gmagick.destroy.php                                30-Sep-2022 11:10                2571
gmagick.drawimage.php                              30-Sep-2022 11:10                2978
gmagick.edgeimage.php                              30-Sep-2022 11:10                2867
gmagick.embossimage.php                            30-Sep-2022 11:10                3321
gmagick.enhanceimage.php                           30-Sep-2022 11:10                2604
gmagick.equalizeimage.php                          30-Sep-2022 11:10                2563
gmagick.examples.php                               30-Sep-2022 11:10                3679
gmagick.flipimage.php                              30-Sep-2022 11:10                2921
gmagick.flopimage.php                              30-Sep-2022 11:10                2918
gmagick.frameimage.php                             30-Sep-2022 11:10                4363
gmagick.gammaimage.php                             30-Sep-2022 11:10                3078
gmagick.getcopyright.php                           30-Sep-2022 11:10                2525
gmagick.getfilename.php                            30-Sep-2022 11:10                2475
gmagick.getimagebackgroundcolor.php                30-Sep-2022 11:10                2672
gmagick.getimageblueprimary.php                    30-Sep-2022 11:10                2930
gmagick.getimagebordercolor.php                    30-Sep-2022 11:10                2716
gmagick.getimagechanneldepth.php                   30-Sep-2022 11:10                2661
gmagick.getimagecolors.php                         30-Sep-2022 11:10                2513
gmagick.getimagecolorspace.php                     30-Sep-2022 11:10                2471
gmagick.getimagecompose.php                        30-Sep-2022 11:10                2551
gmagick.getimagedelay.php                          30-Sep-2022 11:10                2448
gmagick.getimagedepth.php                          30-Sep-2022 11:10                2418
gmagick.getimagedispose.php                        30-Sep-2022 11:10                2472
gmagick.getimageextrema.php                        30-Sep-2022 11:10                2697
gmagick.getimagefilename.php                       30-Sep-2022 11:10                2554
gmagick.getimageformat.php                         30-Sep-2022 11:10                2537
gmagick.getimagegamma.php                          30-Sep-2022 11:10                2439
gmagick.getimagegreenprimary.php                   30-Sep-2022 11:10                2658
gmagick.getimageheight.php                         30-Sep-2022 11:10                2470
gmagick.getimagehistogram.php                      30-Sep-2022 11:10                2831
gmagick.getimageindex.php                          30-Sep-2022 11:10                2601
gmagick.getimageinterlacescheme.php                30-Sep-2022 11:10                2589
gmagick.getimageiterations.php                     30-Sep-2022 11:10                2516
gmagick.getimagematte.php                          30-Sep-2022 11:10                2650
gmagick.getimagemattecolor.php                     30-Sep-2022 11:10                2622
gmagick.getimageprofile.php                        30-Sep-2022 11:10                2609
gmagick.getimageredprimary.php                     30-Sep-2022 11:10                2679
gmagick.getimagerenderingintent.php                30-Sep-2022 11:10                2600
gmagick.getimageresolution.php                     30-Sep-2022 11:10                2532
gmagick.getimagescene.php                          30-Sep-2022 11:10                2435
gmagick.getimagesignature.php                      30-Sep-2022 11:10                2548
gmagick.getimagetype.php                           30-Sep-2022 11:10                2442
gmagick.getimageunits.php                          30-Sep-2022 11:10                2188
gmagick.getimagewhitepoint.php                     30-Sep-2022 11:10                2655
gmagick.getimagewidth.php                          30-Sep-2022 11:10                2449
gmagick.getpackagename.php                         30-Sep-2022 11:10                2501
gmagick.getquantumdepth.php                        30-Sep-2022 11:10                2680
gmagick.getreleasedate.php                         30-Sep-2022 11:10                2535
gmagick.getsamplingfactors.php                     30-Sep-2022 11:10                2590
gmagick.getsize.php                                30-Sep-2022 11:10                2739
gmagick.getversion.php                             30-Sep-2022 11:10                2480
gmagick.hasnextimage.php                           30-Sep-2022 11:10                2782
gmagick.haspreviousimage.php                       30-Sep-2022 11:10                2826
gmagick.implodeimage.php                           30-Sep-2022 11:10                2948
gmagick.installation.php                           30-Sep-2022 11:10                1919
gmagick.labelimage.php                             30-Sep-2022 11:10                2715
gmagick.levelimage.php                             30-Sep-2022 11:10                4506
gmagick.magnifyimage.php                           30-Sep-2022 11:10                2630
gmagick.mapimage.php                               30-Sep-2022 11:10                3215
gmagick.medianfilterimage.php                      30-Sep-2022 11:10                2971
gmagick.minifyimage.php                            30-Sep-2022 11:10                2623
gmagick.modulateimage.php                          30-Sep-2022 11:10                3717
gmagick.motionblurimage.php                        30-Sep-2022 11:10                3742
gmagick.newimage.php                               30-Sep-2022 11:10                3706
gmagick.nextimage.php                              30-Sep-2022 11:10                2592
gmagick.normalizeimage.php                         30-Sep-2022 11:10                2952
gmagick.oilpaintimage.php                          30-Sep-2022 11:10                2968
gmagick.previousimage.php                          30-Sep-2022 11:10                2587
gmagick.profileimage.php                           30-Sep-2022 11:10                3366
gmagick.quantizeimage.php                          30-Sep-2022 11:10                5077
gmagick.quantizeimages.php                         30-Sep-2022 11:10                5080
gmagick.queryfontmetrics.php                       30-Sep-2022 11:10                2798
gmagick.queryfonts.php                             30-Sep-2022 11:10                2574
gmagick.queryformats.php                           30-Sep-2022 11:10                2926
gmagick.radialblurimage.php                        30-Sep-2022 11:10                3118
gmagick.raiseimage.php                             30-Sep-2022 11:10                4146
gmagick.read.php                                   30-Sep-2022 11:10                2689
gmagick.readimage.php                              30-Sep-2022 11:10                2739
gmagick.readimageblob.php                          30-Sep-2022 11:10                3106
gmagick.readimagefile.php                          30-Sep-2022 11:10                2975
gmagick.reducenoiseimage.php                       30-Sep-2022 11:10                3146
gmagick.removeimage.php                            30-Sep-2022 11:10                2571
gmagick.removeimageprofile.php                     30-Sep-2022 11:10                2791
gmagick.requirements.php                           30-Sep-2022 11:10                1631
gmagick.resampleimage.php                          30-Sep-2022 11:10                3713
gmagick.resizeimage.php                            30-Sep-2022 11:10                3939
gmagick.rollimage.php                              30-Sep-2022 11:10                2897
gmagick.rotateimage.php                            30-Sep-2022 11:10                3171
gmagick.scaleimage.php                             30-Sep-2022 11:10                3329
gmagick.separateimagechannel.php                   30-Sep-2022 11:10                3138
gmagick.setcompressionquality.php                  30-Sep-2022 11:10                4174
gmagick.setfilename.php                            30-Sep-2022 11:10                2869
gmagick.setimagebackgroundcolor.php                30-Sep-2022 11:10                2998
gmagick.setimageblueprimary.php                    30-Sep-2022 11:10                3180
gmagick.setimagebordercolor.php                    30-Sep-2022 11:10                2960
gmagick.setimagechanneldepth.php                   30-Sep-2022 11:10                3327
gmagick.setimagecolorspace.php                     30-Sep-2022 11:10                3023
gmagick.setimagecompose.php                        30-Sep-2022 11:10                2789
gmagick.setimagedelay.php                          30-Sep-2022 11:10                2803
gmagick.setimagedepth.php                          30-Sep-2022 11:10                2801
gmagick.setimagedispose.php                        30-Sep-2022 11:10                2845
gmagick.setimagefilename.php                       30-Sep-2022 11:10                2893
gmagick.setimageformat.php                         30-Sep-2022 11:10                2856
gmagick.setimagegamma.php                          30-Sep-2022 11:10                2795
gmagick.setimagegreenprimary.php                   30-Sep-2022 11:10                3188
gmagick.setimageindex.php                          30-Sep-2022 11:10                2942
gmagick.setimageinterlacescheme.php                30-Sep-2022 11:10                3089
gmagick.setimageiterations.php                     30-Sep-2022 11:10                2898
gmagick.setimageprofile.php                        30-Sep-2022 11:10                3273
gmagick.setimageredprimary.php                     30-Sep-2022 11:10                3091
gmagick.setimagerenderingintent.php                30-Sep-2022 11:10                3120
gmagick.setimageresolution.php                     30-Sep-2022 11:10                3085
gmagick.setimagescene.php                          30-Sep-2022 11:10                2791
gmagick.setimagetype.php                           30-Sep-2022 11:10                2916
gmagick.setimageunits.php                          30-Sep-2022 11:10                2975
gmagick.setimagewhitepoint.php                     30-Sep-2022 11:10                3117
gmagick.setsamplingfactors.php                     30-Sep-2022 11:10                2959
gmagick.setsize.php                                30-Sep-2022 11:10                3224
gmagick.setup.php                                  30-Sep-2022 11:10                1495
gmagick.shearimage.php                             30-Sep-2022 11:10                3860
gmagick.solarizeimage.php                          30-Sep-2022 11:10                3049
gmagick.spreadimage.php                            30-Sep-2022 11:10                2893
gmagick.stripimage.php                             30-Sep-2022 11:10                2551
gmagick.swirlimage.php                             30-Sep-2022 11:10                2974
gmagick.thumbnailimage.php                         30-Sep-2022 11:10                3589
gmagick.trimimage.php                              30-Sep-2022 11:10                3038
gmagick.write.php                                  30-Sep-2022 11:10                1705
gmagick.writeimage.php                             30-Sep-2022 11:10                3286
gmagickdraw.annotate.php                           30-Sep-2022 11:10                3001
gmagickdraw.arc.php                                30-Sep-2022 11:10                4001
gmagickdraw.bezier.php                             30-Sep-2022 11:10                2550
gmagickdraw.ellipse.php                            30-Sep-2022 11:10                3922
gmagickdraw.getfillcolor.php                       30-Sep-2022 11:10                2416
gmagickdraw.getfillopacity.php                     30-Sep-2022 11:10                2309
gmagickdraw.getfont.php                            30-Sep-2022 11:10                2347
gmagickdraw.getfontsize.php                        30-Sep-2022 11:10                2351
gmagickdraw.getfontstyle.php                       30-Sep-2022 11:10                2427
gmagickdraw.getfontweight.php                      30-Sep-2022 11:10                2272
gmagickdraw.getstrokecolor.php                     30-Sep-2022 11:10                2471
gmagickdraw.getstrokeopacity.php                   30-Sep-2022 11:10                2328
gmagickdraw.getstrokewidth.php                     30-Sep-2022 11:10                2347
gmagickdraw.gettextdecoration.php                  30-Sep-2022 11:10                2339
gmagickdraw.gettextencoding.php                    30-Sep-2022 11:10                2475
gmagickdraw.line.php                               30-Sep-2022 11:10                3393
gmagickdraw.point.php                              30-Sep-2022 11:10                2788
gmagickdraw.polygon.php                            30-Sep-2022 11:10                2617
gmagickdraw.polyline.php                           30-Sep-2022 11:10                2652
gmagickdraw.rectangle.php                          30-Sep-2022 11:10                3497
gmagickdraw.rotate.php                             30-Sep-2022 11:10                2608
gmagickdraw.roundrectangle.php                     30-Sep-2022 11:10                4166
gmagickdraw.scale.php                              30-Sep-2022 11:10                2852
gmagickdraw.setfillcolor.php                       30-Sep-2022 11:10                2907
gmagickdraw.setfillopacity.php                     30-Sep-2022 11:10                2706
gmagickdraw.setfont.php                            30-Sep-2022 11:10                2604
gmagickdraw.setfontsize.php                        30-Sep-2022 11:10                2636
gmagickdraw.setfontstyle.php                       30-Sep-2022 11:10                2767
gmagickdraw.setfontweight.php                      30-Sep-2022 11:10                2638
gmagickdraw.setstrokecolor.php                     30-Sep-2022 11:10                2931
gmagickdraw.setstrokeopacity.php                   30-Sep-2022 11:10                2724
gmagickdraw.setstrokewidth.php                     30-Sep-2022 11:10                2684
gmagickdraw.settextdecoration.php                  30-Sep-2022 11:10                2770
gmagickdraw.settextencoding.php                    30-Sep-2022 11:10                2976
gmagickpixel.construct.php                         30-Sep-2022 11:10                2477
gmagickpixel.getcolor.php                          30-Sep-2022 11:10                3644
gmagickpixel.getcolorcount.php                     30-Sep-2022 11:10                2400
gmagickpixel.getcolorvalue.php                     30-Sep-2022 11:10                2756
gmagickpixel.setcolor.php                          30-Sep-2022 11:10                2943
gmagickpixel.setcolorvalue.php                     30-Sep-2022 11:10                3170
gmp.configuration.php                              30-Sep-2022 11:10                1235
gmp.constants.php                                  30-Sep-2022 11:10                3155
gmp.examples.php                                   30-Sep-2022 11:10                3237
gmp.installation.php                               30-Sep-2022 11:10                1305
gmp.requirements.php                               30-Sep-2022 11:10                1676
gmp.serialize.php                                  30-Sep-2022 11:10                2146
gmp.setup.php                                      30-Sep-2022 11:10                1457
gmp.unserialize.php                                30-Sep-2022 11:10                2456
gnupg.configuration.php                            30-Sep-2022 11:10                1248
gnupg.constants.php                                30-Sep-2022 11:10                6369
gnupg.examples-clearsign.php                       30-Sep-2022 11:10                6721
gnupg.examples.php                                 30-Sep-2022 11:10                1344
gnupg.installation.php                             30-Sep-2022 11:10                1523
gnupg.requirements.php                             30-Sep-2022 11:10                1235
gnupg.resources.php                                30-Sep-2022 11:10                1201
gnupg.setup.php                                    30-Sep-2022 11:10                1558
hash.configuration.php                             30-Sep-2022 11:10                1243
hash.constants.php                                 30-Sep-2022 11:10                1704
hash.installation.php                              30-Sep-2022 11:10                1711
hash.requirements.php                              30-Sep-2022 11:10                1187
hash.resources.php                                 30-Sep-2022 11:10                1320
hash.setup.php                                     30-Sep-2022 11:10                1539
hashcontext.construct.php                          30-Sep-2022 11:10                1887
hashcontext.serialize.php                          30-Sep-2022 11:10                2292
hashcontext.unserialize.php                        30-Sep-2022 11:10                2584
history.php                                        30-Sep-2022 11:11                2111
history.php.books.php                              30-Sep-2022 11:11                2563
history.php.php                                    30-Sep-2022 11:11               10770
history.php.publications.php                       30-Sep-2022 11:11                1783
history.php.related.php                            30-Sep-2022 11:11                5945
hrtime-performancecounter.getfrequency.php         30-Sep-2022 11:10                2598
hrtime-performancecounter.getticks.php             30-Sep-2022 11:10                2471
hrtime-performancecounter.gettickssince.php        30-Sep-2022 11:10                2727
hrtime-stopwatch.getelapsedticks.php               30-Sep-2022 11:10                2373
hrtime-stopwatch.getelapsedtime.php                30-Sep-2022 11:10                2722
hrtime-stopwatch.getlastelapsedticks.php           30-Sep-2022 11:10                2441
hrtime-stopwatch.getlastelapsedtime.php            30-Sep-2022 11:10                2746
hrtime-stopwatch.isrunning.php                     30-Sep-2022 11:10                2332
hrtime-stopwatch.start.php                         30-Sep-2022 11:10                2326
hrtime-stopwatch.stop.php                          30-Sep-2022 11:10                2205
hrtime.example.basic.php                           30-Sep-2022 11:10                5965
hrtime.examples.php                                30-Sep-2022 11:10                1323
hrtime.installation.php                            30-Sep-2022 11:10                1897
hrtime.setup.php                                   30-Sep-2022 11:10                1323
ibase.configuration.php                            30-Sep-2022 11:10                7180
ibase.constants.php                                30-Sep-2022 11:10               18156
ibase.installation.php                             30-Sep-2022 11:10                3368
ibase.requirements.php                             30-Sep-2022 11:10                1157
ibase.resources.php                                30-Sep-2022 11:10                1201
ibase.setup.php                                    30-Sep-2022 11:10                1576
ibm-db2.configuration.php                          30-Sep-2022 11:10                9335
ibm-db2.constants.php                              30-Sep-2022 11:10                6831
ibm-db2.installation.php                           30-Sep-2022 11:10                3526
ibm-db2.requirements.php                           30-Sep-2022 11:10                3174
ibm-db2.resources.php                              30-Sep-2022 11:10                1267
ibm-db2.setup.php                                  30-Sep-2022 11:10                1588
iconv.configuration.php                            30-Sep-2022 11:10                4337
iconv.constants.php                                30-Sep-2022 11:10                3203
iconv.installation.php                             30-Sep-2022 11:10                1606
iconv.requirements.php                             30-Sep-2022 11:10                1461
iconv.resources.php                                30-Sep-2022 11:10                1201
iconv.setup.php                                    30-Sep-2022 11:10                1566
igbinary.configuration.php                         30-Sep-2022 11:10                3328
igbinary.installation.php                          30-Sep-2022 11:10                1910
igbinary.requirements.php                          30-Sep-2022 11:10                1178
igbinary.setup.php                                 30-Sep-2022 11:10                1502
image.configuration.php                            30-Sep-2022 11:10                3465
image.constants.php                                30-Sep-2022 11:10               40348
image.examples-png.php                             30-Sep-2022 11:10                4837
image.examples-watermark.php                       30-Sep-2022 11:10                6508
image.examples.merged-watermark.php                30-Sep-2022 11:10                9499
image.examples.php                                 30-Sep-2022 11:10                1595
image.installation.php                             30-Sep-2022 11:10                6324
image.requirements.php                             30-Sep-2022 11:10                4107
image.resources.php                                30-Sep-2022 11:10                2097
image.setup.php                                    30-Sep-2022 11:10                1561
imagick.adaptiveblurimage.php                      30-Sep-2022 11:10                6657
imagick.adaptiveresizeimage.php                    30-Sep-2022 11:10                9441
imagick.adaptivesharpenimage.php                   30-Sep-2022 11:10                6281
imagick.adaptivethresholdimage.php                 30-Sep-2022 11:10                6158
imagick.addimage.php                               30-Sep-2022 11:10                3133
imagick.addnoiseimage.php                          30-Sep-2022 11:10                5409
imagick.affinetransformimage.php                   30-Sep-2022 11:10                7012
imagick.animateimages.php                          30-Sep-2022 11:10                3082
imagick.annotateimage.php                          30-Sep-2022 11:10                8773
imagick.appendimages.php                           30-Sep-2022 11:10                6960
imagick.autolevelimage.php                         30-Sep-2022 11:10                4366
imagick.averageimages.php                          30-Sep-2022 11:10                2805
imagick.blackthresholdimage.php                    30-Sep-2022 11:10                5687
imagick.blueshiftimage.php                         30-Sep-2022 11:10                4435
imagick.blurimage.php                              30-Sep-2022 11:10                5950
imagick.borderimage.php                            30-Sep-2022 11:10                6410
imagick.brightnesscontrastimage.php                30-Sep-2022 11:10                5487
imagick.charcoalimage.php                          30-Sep-2022 11:10                4918
imagick.chopimage.php                              30-Sep-2022 11:10                7000
imagick.clampimage.php                             30-Sep-2022 11:10                2449
imagick.clear.php                                  30-Sep-2022 11:10                2316
imagick.clipimage.php                              30-Sep-2022 11:10                2589
imagick.clipimagepath.php                          30-Sep-2022 11:10                2924
imagick.clippathimage.php                          30-Sep-2022 11:10                3288
imagick.clone.php                                  30-Sep-2022 11:10                4743
imagick.clutimage.php                              30-Sep-2022 11:10                6306
imagick.coalesceimages.php                         30-Sep-2022 11:10                3128
imagick.colorfloodfillimage.php                    30-Sep-2022 11:10                5617
imagick.colorizeimage.php                          30-Sep-2022 11:10                7096
imagick.colormatriximage.php                       30-Sep-2022 11:10                8394
imagick.combineimages.php                          30-Sep-2022 11:10                3215
imagick.commentimage.php                           30-Sep-2022 11:10                5103
imagick.compareimagechannels.php                   30-Sep-2022 11:10                4028
imagick.compareimagelayers.php                     30-Sep-2022 11:10                5915
imagick.compareimages.php                          30-Sep-2022 11:10                5732
imagick.compositeimage.php                         30-Sep-2022 11:10                8187
imagick.configuration.php                          30-Sep-2022 11:10                4163
imagick.constants.php                              30-Sep-2022 11:10              113416
imagick.construct.php                              30-Sep-2022 11:10                2721
imagick.contrastimage.php                          30-Sep-2022 11:10                5205
imagick.contraststretchimage.php                   30-Sep-2022 11:10                3542
imagick.convolveimage.php                          30-Sep-2022 11:10                5951
imagick.count.php                                  30-Sep-2022 11:10                2577
imagick.cropimage.php                              30-Sep-2022 11:10                3623
imagick.cropthumbnailimage.php                     30-Sep-2022 11:10                3342
imagick.current.php                                30-Sep-2022 11:10                2568
imagick.cyclecolormapimage.php                     30-Sep-2022 11:10                2947
imagick.decipherimage.php                          30-Sep-2022 11:10                3138
imagick.deconstructimages.php                      30-Sep-2022 11:10                2815
imagick.deleteimageartifact.php                    30-Sep-2022 11:10                3622
imagick.deleteimageproperty.php                    30-Sep-2022 11:10                2450
imagick.deskewimage.php                            30-Sep-2022 11:10               11671
imagick.despeckleimage.php                         30-Sep-2022 11:10                4349
imagick.destroy.php                                30-Sep-2022 11:10                2438
imagick.displayimage.php                           30-Sep-2022 11:10                2714
imagick.displayimages.php                          30-Sep-2022 11:10                2741
imagick.distortimage.php                           30-Sep-2022 11:10               13121
imagick.drawimage.php                              30-Sep-2022 11:10                2603
imagick.edgeimage.php                              30-Sep-2022 11:10                4888
imagick.embossimage.php                            30-Sep-2022 11:10                5623
imagick.encipherimage.php                          30-Sep-2022 11:10                3184
imagick.enhanceimage.php                           30-Sep-2022 11:10                4469
imagick.equalizeimage.php                          30-Sep-2022 11:10                4299
imagick.evaluateimage.php                          30-Sep-2022 11:10                5807
imagick.examples-1.php                             30-Sep-2022 11:10               32921
imagick.examples.php                               30-Sep-2022 11:10                1354
imagick.exportimagepixels.php                      30-Sep-2022 11:10                7756
imagick.extentimage.php                            30-Sep-2022 11:10                5273
imagick.filter.php                                 30-Sep-2022 11:10                7691
imagick.flattenimages.php                          30-Sep-2022 11:10                2977
imagick.flipimage.php                              30-Sep-2022 11:10                4701
imagick.floodfillpaintimage.php                    30-Sep-2022 11:10               11637
imagick.flopimage.php                              30-Sep-2022 11:10                4837
imagick.forwardfouriertransformimage.php           30-Sep-2022 11:10               12988
imagick.frameimage.php                             30-Sep-2022 11:10                8909
imagick.functionimage.php                          30-Sep-2022 11:10               13814
imagick.fximage.php                                30-Sep-2022 11:10                6139
imagick.gammaimage.php                             30-Sep-2022 11:10                5568
imagick.gaussianblurimage.php                      30-Sep-2022 11:10                6479
imagick.getcolorspace.php                          30-Sep-2022 11:10                2388
imagick.getcompression.php                         30-Sep-2022 11:10                2366
imagick.getcompressionquality.php                  30-Sep-2022 11:10                2313
imagick.getcopyright.php                           30-Sep-2022 11:10                2232
imagick.getfilename.php                            30-Sep-2022 11:10                2621
imagick.getfont.php                                30-Sep-2022 11:10                3141
imagick.getformat.php                              30-Sep-2022 11:10                2679
imagick.getgravity.php                             30-Sep-2022 11:10                2371
imagick.gethomeurl.php                             30-Sep-2022 11:10                2212
imagick.getimage.php                               30-Sep-2022 11:10                2752
imagick.getimagealphachannel.php                   30-Sep-2022 11:10                3324
imagick.getimageartifact.php                       30-Sep-2022 11:10                3560
imagick.getimageattribute.php                      30-Sep-2022 11:10                2690
imagick.getimagebackgroundcolor.php                30-Sep-2022 11:10                2766
imagick.getimageblob.php                           30-Sep-2022 11:10                2816
imagick.getimageblueprimary.php                    30-Sep-2022 11:10                2586
imagick.getimagebordercolor.php                    30-Sep-2022 11:10                2772
imagick.getimagechanneldepth.php                   30-Sep-2022 11:10                2843
imagick.getimagechanneldistortion.php              30-Sep-2022 11:10                3989
imagick.getimagechanneldistortions.php             30-Sep-2022 11:10                4125
imagick.getimagechannelextrema.php                 30-Sep-2022 11:10                3678
imagick.getimagechannelkurtosis.php                30-Sep-2022 11:10                3368
imagick.getimagechannelmean.php                    30-Sep-2022 11:10                3219
imagick.getimagechannelrange.php                   30-Sep-2022 11:10                3221
imagick.getimagechannelstatistics.php              30-Sep-2022 11:10                2520
imagick.getimageclipmask.php                       30-Sep-2022 11:10                3265
imagick.getimagecolormapcolor.php                  30-Sep-2022 11:10                3031
imagick.getimagecolors.php                         30-Sep-2022 11:10                2304
imagick.getimagecolorspace.php                     30-Sep-2022 11:10                2347
imagick.getimagecompose.php                        30-Sep-2022 11:10                2367
imagick.getimagecompression.php                    30-Sep-2022 11:10                2444
imagick.getimagecompressionquality.php             30-Sep-2022 11:10                2450
imagick.getimagedelay.php                          30-Sep-2022 11:10                2635
imagick.getimagedepth.php                          30-Sep-2022 11:10                2204
imagick.getimagedispose.php                        30-Sep-2022 11:10                2659
imagick.getimagedistortion.php                     30-Sep-2022 11:10                3483
imagick.getimageextrema.php                        30-Sep-2022 11:10                2929
imagick.getimagefilename.php                       30-Sep-2022 11:10                2648
imagick.getimageformat.php                         30-Sep-2022 11:10                2615
imagick.getimagegamma.php                          30-Sep-2022 11:10                2498
imagick.getimagegeometry.php                       30-Sep-2022 11:10                4181
imagick.getimagegravity.php                        30-Sep-2022 11:10                2660
imagick.getimagegreenprimary.php                   30-Sep-2022 11:10                2925
imagick.getimageheight.php                         30-Sep-2022 11:10                2528
imagick.getimagehistogram.php                      30-Sep-2022 11:10               19884
imagick.getimageindex.php                          30-Sep-2022 11:10                3140
imagick.getimageinterlacescheme.php                30-Sep-2022 11:10                2599
imagick.getimageinterpolatemethod.php              30-Sep-2022 11:10                2737
imagick.getimageiterations.php                     30-Sep-2022 11:10                2585
imagick.getimagelength.php                         30-Sep-2022 11:10                3408
imagick.getimagematte.php                          30-Sep-2022 11:10                2769
imagick.getimagemattecolor.php                     30-Sep-2022 11:10                3022
imagick.getimagemimetype.php                       30-Sep-2022 11:10                2178
imagick.getimageorientation.php                    30-Sep-2022 11:10                2653
imagick.getimagepage.php                           30-Sep-2022 11:10                2702
imagick.getimagepixelcolor.php                     30-Sep-2022 11:10                3330
imagick.getimageprofile.php                        30-Sep-2022 11:10                2769
imagick.getimageprofiles.php                       30-Sep-2022 11:10                3384
imagick.getimageproperties.php                     30-Sep-2022 11:10                5783
imagick.getimageproperty.php                       30-Sep-2022 11:10                4944
imagick.getimageredprimary.php                     30-Sep-2022 11:10                2901
imagick.getimageregion.php                         30-Sep-2022 11:10                3770
imagick.getimagerenderingintent.php                30-Sep-2022 11:10                2738
imagick.getimageresolution.php                     30-Sep-2022 11:10                2595
imagick.getimagesblob.php                          30-Sep-2022 11:10                2681
imagick.getimagesignature.php                      30-Sep-2022 11:10                2543
imagick.getimagesize.php                           30-Sep-2022 11:10                2827
imagick.getimagetickspersecond.php                 30-Sep-2022 11:10                2631
imagick.getimagetotalinkdensity.php                30-Sep-2022 11:10                2518
imagick.getimagetype.php                           30-Sep-2022 11:10                4164
imagick.getimageunits.php                          30-Sep-2022 11:10                2766
imagick.getimagevirtualpixelmethod.php             30-Sep-2022 11:10                2902
imagick.getimagewhitepoint.php                     30-Sep-2022 11:10                2749
imagick.getimagewidth.php                          30-Sep-2022 11:10                2483
imagick.getinterlacescheme.php                     30-Sep-2022 11:10                2807
imagick.getiteratorindex.php                       30-Sep-2022 11:10                6416
imagick.getnumberimages.php                        30-Sep-2022 11:10                2738
imagick.getoption.php                              30-Sep-2022 11:10                2753
imagick.getpackagename.php                         30-Sep-2022 11:10                2474
imagick.getpage.php                                30-Sep-2022 11:10                2700
imagick.getpixeliterator.php                       30-Sep-2022 11:10                7339
imagick.getpixelregioniterator.php                 30-Sep-2022 11:10                7215
imagick.getpointsize.php                           30-Sep-2022 11:10                2776
imagick.getquantum.php                             30-Sep-2022 11:10                2141
imagick.getquantumdepth.php                        30-Sep-2022 11:10                2709
imagick.getquantumrange.php                        30-Sep-2022 11:10                2971
imagick.getregistry.php                            30-Sep-2022 11:10                2367
imagick.getreleasedate.php                         30-Sep-2022 11:10                2524
imagick.getresource.php                            30-Sep-2022 11:10                2927
imagick.getresourcelimit.php                       30-Sep-2022 11:10                3378
imagick.getsamplingfactors.php                     30-Sep-2022 11:10                2589
imagick.getsize.php                                30-Sep-2022 11:10                6217
imagick.getsizeoffset.php                          30-Sep-2022 11:10                2809
imagick.getversion.php                             30-Sep-2022 11:10                2504
imagick.haldclutimage.php                          30-Sep-2022 11:10                5972
imagick.hasnextimage.php                           30-Sep-2022 11:10                2400
imagick.haspreviousimage.php                       30-Sep-2022 11:10                2431
imagick.identifyformat.php                         30-Sep-2022 11:10                4500
imagick.identifyimage.php                          30-Sep-2022 11:10                3915
imagick.implodeimage.php                           30-Sep-2022 11:10                4735
imagick.importimagepixels.php                      30-Sep-2022 11:10               11798
imagick.installation.php                           30-Sep-2022 11:10                3013
imagick.inversefouriertransformimage.php           30-Sep-2022 11:10                3263
imagick.labelimage.php                             30-Sep-2022 11:10                2420
imagick.levelimage.php                             30-Sep-2022 11:10                7868
imagick.linearstretchimage.php                     30-Sep-2022 11:10                5685
imagick.liquidrescaleimage.php                     30-Sep-2022 11:10                4400
imagick.listregistry.php                           30-Sep-2022 11:10                2260
imagick.magnifyimage.php                           30-Sep-2022 11:10                4317
imagick.mapimage.php                               30-Sep-2022 11:10                3331
imagick.mattefloodfillimage.php                    30-Sep-2022 11:10                5657
imagick.medianfilterimage.php                      30-Sep-2022 11:10                5347
imagick.mergeimagelayers.php                       30-Sep-2022 11:10                6852
imagick.minifyimage.php                            30-Sep-2022 11:10                2248
imagick.modulateimage.php                          30-Sep-2022 11:10                5774
imagick.montageimage.php                           30-Sep-2022 11:10                4457
imagick.morphimages.php                            30-Sep-2022 11:10                2927
imagick.morphology.php                             30-Sep-2022 11:10               75740
imagick.mosaicimages.php                           30-Sep-2022 11:10                2763
imagick.motionblurimage.php                        30-Sep-2022 11:10                6752
imagick.negateimage.php                            30-Sep-2022 11:10                5666
imagick.newimage.php                               30-Sep-2022 11:10                6605
imagick.newpseudoimage.php                         30-Sep-2022 11:10                5928
imagick.nextimage.php                              30-Sep-2022 11:10                2301
imagick.normalizeimage.php                         30-Sep-2022 11:10                6424
imagick.oilpaintimage.php                          30-Sep-2022 11:10                4620
imagick.opaquepaintimage.php                       30-Sep-2022 11:10                4779
imagick.optimizeimagelayers.php                    30-Sep-2022 11:10                5649
imagick.orderedposterizeimage.php                  30-Sep-2022 11:10                6714
imagick.paintfloodfillimage.php                    30-Sep-2022 11:10                5527
imagick.paintopaqueimage.php                       30-Sep-2022 11:10                5417
imagick.painttransparentimage.php                  30-Sep-2022 11:10                4618
imagick.pingimage.php                              30-Sep-2022 11:10                2539
imagick.pingimageblob.php                          30-Sep-2022 11:10                6152
imagick.pingimagefile.php                          30-Sep-2022 11:10                5938
imagick.polaroidimage.php                          30-Sep-2022 11:10                4549
imagick.posterizeimage.php                         30-Sep-2022 11:10                5749
imagick.previewimages.php                          30-Sep-2022 11:10                3088
imagick.previousimage.php                          30-Sep-2022 11:10                2335
imagick.profileimage.php                           30-Sep-2022 11:10                3157
imagick.quantizeimage.php                          30-Sep-2022 11:10                7494
imagick.quantizeimages.php                         30-Sep-2022 11:10                4651
imagick.queryfontmetrics.php                       30-Sep-2022 11:10                5779
imagick.queryfonts.php                             30-Sep-2022 11:10                5152
imagick.queryformats.php                           30-Sep-2022 11:10                8372
imagick.radialblurimage.php                        30-Sep-2022 11:10                5941
imagick.raiseimage.php                             30-Sep-2022 11:10                6328
imagick.randomthresholdimage.php                   30-Sep-2022 11:10                6481
imagick.readimage.php                              30-Sep-2022 11:10                2404
imagick.readimageblob.php                          30-Sep-2022 11:10                5532
imagick.readimagefile.php                          30-Sep-2022 11:10                3020
imagick.readimages.php                             30-Sep-2022 11:10                2394
imagick.recolorimage.php                           30-Sep-2022 11:10                6773
imagick.reducenoiseimage.php                       30-Sep-2022 11:10                5284
imagick.remapimage.php                             30-Sep-2022 11:10                3375
imagick.removeimage.php                            30-Sep-2022 11:10                2476
imagick.removeimageprofile.php                     30-Sep-2022 11:10                2748
imagick.render.php                                 30-Sep-2022 11:10                2178
imagick.requirements.php                           30-Sep-2022 11:10                1509
imagick.resampleimage.php                          30-Sep-2022 11:10                5552
imagick.resetimagepage.php                         30-Sep-2022 11:10                2647
imagick.resizeimage.php                            30-Sep-2022 11:10                5462
imagick.resources.php                              30-Sep-2022 11:10                1215
imagick.rollimage.php                              30-Sep-2022 11:10                4776
imagick.rotateimage.php                            30-Sep-2022 11:10                5748
imagick.rotationalblurimage.php                    30-Sep-2022 11:10                5446
imagick.roundcorners.php                           30-Sep-2022 11:10                6423
imagick.sampleimage.php                            30-Sep-2022 11:10                2755
imagick.scaleimage.php                             30-Sep-2022 11:10                6960
imagick.segmentimage.php                           30-Sep-2022 11:10                6607
imagick.selectiveblurimage.php                     30-Sep-2022 11:10                6168
imagick.separateimagechannel.php                   30-Sep-2022 11:10                5279
imagick.sepiatoneimage.php                         30-Sep-2022 11:10                4943
imagick.setbackgroundcolor.php                     30-Sep-2022 11:10                3279
imagick.setcolorspace.php                          30-Sep-2022 11:10                2928
imagick.setcompression.php                         30-Sep-2022 11:10                2617
imagick.setcompressionquality.php                  30-Sep-2022 11:10                7283
imagick.setfilename.php                            30-Sep-2022 11:10                2439
imagick.setfirstiterator.php                       30-Sep-2022 11:10                2326
imagick.setfont.php                                30-Sep-2022 11:10                5653
imagick.setformat.php                              30-Sep-2022 11:10                2447
imagick.setgravity.php                             30-Sep-2022 11:10                2618
imagick.setimage.php                               30-Sep-2022 11:10                4715
imagick.setimagealphachannel.php                   30-Sep-2022 11:10                3744
imagick.setimageartifact.php                       30-Sep-2022 11:10                7484
imagick.setimageattribute.php                      30-Sep-2022 11:10                3068
imagick.setimagebackgroundcolor.php                30-Sep-2022 11:10                3609
imagick.setimagebias.php                           30-Sep-2022 11:10                7205
imagick.setimagebiasquantum.php                    30-Sep-2022 11:10                2817
imagick.setimageblueprimary.php                    30-Sep-2022 11:10                3070
imagick.setimagebordercolor.php                    30-Sep-2022 11:10                3610
imagick.setimagechanneldepth.php                   30-Sep-2022 11:10                3056
imagick.setimageclipmask.php                       30-Sep-2022 11:10                9604
imagick.setimagecolormapcolor.php                  30-Sep-2022 11:10                3111
imagick.setimagecolorspace.php                     30-Sep-2022 11:10                3162
imagick.setimagecompose.php                        30-Sep-2022 11:10                3131
imagick.setimagecompression.php                    30-Sep-2022 11:10                2962
imagick.setimagecompressionquality.php             30-Sep-2022 11:10                4946
imagick.setimagedelay.php                          30-Sep-2022 11:10                6152
imagick.setimagedepth.php                          30-Sep-2022 11:10                2699
imagick.setimagedispose.php                        30-Sep-2022 11:10                2888
imagick.setimageextent.php                         30-Sep-2022 11:10                3056
imagick.setimagefilename.php                       30-Sep-2022 11:10                2790
imagick.setimageformat.php                         30-Sep-2022 11:10                2600
imagick.setimagegamma.php                          30-Sep-2022 11:10                2703
imagick.setimagegravity.php                        30-Sep-2022 11:10                2783
imagick.setimagegreenprimary.php                   30-Sep-2022 11:10                3059
imagick.setimageindex.php                          30-Sep-2022 11:10                3301
imagick.setimageinterlacescheme.php                30-Sep-2022 11:10                2981
imagick.setimageinterpolatemethod.php              30-Sep-2022 11:10                2675
imagick.setimageiterations.php                     30-Sep-2022 11:10                4949
imagick.setimagematte.php                          30-Sep-2022 11:10                2698
imagick.setimagemattecolor.php                     30-Sep-2022 11:10                3851
imagick.setimageopacity.php                        30-Sep-2022 11:10                4935
imagick.setimageorientation.php                    30-Sep-2022 11:10                4780
imagick.setimagepage.php                           30-Sep-2022 11:10                3495
imagick.setimageprofile.php                        30-Sep-2022 11:10                3414
imagick.setimageproperty.php                       30-Sep-2022 11:10                5160
imagick.setimageredprimary.php                     30-Sep-2022 11:10                3067
imagick.setimagerenderingintent.php                30-Sep-2022 11:10                3016
imagick.setimageresolution.php                     30-Sep-2022 11:10                5059
imagick.setimagescene.php                          30-Sep-2022 11:10                2717
imagick.setimagetickspersecond.php                 30-Sep-2022 11:10                7895
imagick.setimagetype.php                           30-Sep-2022 11:10                2556
imagick.setimageunits.php                          30-Sep-2022 11:10                2477
imagick.setimagevirtualpixelmethod.php             30-Sep-2022 11:10                2726
imagick.setimagewhitepoint.php                     30-Sep-2022 11:10                3024
imagick.setinterlacescheme.php                     30-Sep-2022 11:10                2519
imagick.setiteratorindex.php                       30-Sep-2022 11:10                6306
imagick.setlastiterator.php                        30-Sep-2022 11:10                2423
imagick.setoption.php                              30-Sep-2022 11:10               12859
imagick.setpage.php                                30-Sep-2022 11:10                3312
imagick.setpointsize.php                           30-Sep-2022 11:10                5311
imagick.setprogressmonitor.php                     30-Sep-2022 11:10               12732
imagick.setregistry.php                            30-Sep-2022 11:10                2777
imagick.setresolution.php                          30-Sep-2022 11:10                3758
imagick.setresourcelimit.php                       30-Sep-2022 11:10                3381
imagick.setsamplingfactors.php                     30-Sep-2022 11:10                7115
imagick.setsize.php                                30-Sep-2022 11:10                2801
imagick.setsizeoffset.php                          30-Sep-2022 11:10                3323
imagick.settype.php                                30-Sep-2022 11:10                2520
imagick.setup.php                                  30-Sep-2022 11:10                1583
imagick.shadeimage.php                             30-Sep-2022 11:10                5794
imagick.shadowimage.php                            30-Sep-2022 11:10                5271
imagick.sharpenimage.php                           30-Sep-2022 11:10                5901
imagick.shaveimage.php                             30-Sep-2022 11:10                4575
imagick.shearimage.php                             30-Sep-2022 11:10                6637
imagick.sigmoidalcontrastimage.php                 30-Sep-2022 11:10                7909
imagick.sketchimage.php                            30-Sep-2022 11:10                5907
imagick.smushimages.php                            30-Sep-2022 11:10                5802
imagick.solarizeimage.php                          30-Sep-2022 11:10                4839
imagick.sparsecolorimage.php                       30-Sep-2022 11:10               31227
imagick.spliceimage.php                            30-Sep-2022 11:10                5646
imagick.spreadimage.php                            30-Sep-2022 11:10                4762
imagick.statisticimage.php                         30-Sep-2022 11:10                6704
imagick.steganoimage.php                           30-Sep-2022 11:10                2971
imagick.stereoimage.php                            30-Sep-2022 11:10                2806
imagick.subimagematch.php                          30-Sep-2022 11:10                7647
imagick.swirlimage.php                             30-Sep-2022 11:10                4831
imagick.textureimage.php                           30-Sep-2022 11:10                6516
imagick.thresholdimage.php                         30-Sep-2022 11:10                5392
imagick.thumbnailimage.php                         30-Sep-2022 11:10                7330
imagick.tintimage.php                              30-Sep-2022 11:10                8424
imagick.tostring.php                               30-Sep-2022 11:10                2973
imagick.transformimage.php                         30-Sep-2022 11:10                6823
imagick.transformimagecolorspace.php               30-Sep-2022 11:10                5809
imagick.transparentpaintimage.php                  30-Sep-2022 11:10                7360
imagick.transposeimage.php                         30-Sep-2022 11:10                4688
imagick.transverseimage.php                        30-Sep-2022 11:10                4687
imagick.trimimage.php                              30-Sep-2022 11:10                6192
imagick.uniqueimagecolors.php                      30-Sep-2022 11:10                5694
imagick.unsharpmaskimage.php                       30-Sep-2022 11:10                6918
imagick.valid.php                                  30-Sep-2022 11:10                2251
imagick.vignetteimage.php                          30-Sep-2022 11:10                6522
imagick.waveimage.php                              30-Sep-2022 11:10                6579
imagick.whitethresholdimage.php                    30-Sep-2022 11:10                5555
imagick.writeimage.php                             30-Sep-2022 11:10                3108
imagick.writeimagefile.php                         30-Sep-2022 11:10                3742
imagick.writeimages.php                            30-Sep-2022 11:10                2750
imagick.writeimagesfile.php                        30-Sep-2022 11:10                3751
imagickdraw.affine.php                             30-Sep-2022 11:10               18488
imagickdraw.annotation.php                         30-Sep-2022 11:10                3125
imagickdraw.arc.php                                30-Sep-2022 11:10                9861
imagickdraw.bezier.php                             30-Sep-2022 11:10               19517
imagickdraw.circle.php                             30-Sep-2022 11:10                9275
imagickdraw.clear.php                              30-Sep-2022 11:10                2428
imagickdraw.clone.php                              30-Sep-2022 11:10                2478
imagickdraw.color.php                              30-Sep-2022 11:10                3261
imagickdraw.comment.php                            30-Sep-2022 11:10                2631
imagickdraw.composite.php                          30-Sep-2022 11:10               12171
imagickdraw.construct.php                          30-Sep-2022 11:10                2258
imagickdraw.destroy.php                            30-Sep-2022 11:10                2324
imagickdraw.ellipse.php                            30-Sep-2022 11:10               12508
imagickdraw.getclippath.php                        30-Sep-2022 11:10                2319
imagickdraw.getcliprule.php                        30-Sep-2022 11:10                2401
imagickdraw.getclipunits.php                       30-Sep-2022 11:10                2230
imagickdraw.getfillcolor.php                       30-Sep-2022 11:10                2377
imagickdraw.getfillopacity.php                     30-Sep-2022 11:10                2329
imagickdraw.getfillrule.php                        30-Sep-2022 11:10                2334
imagickdraw.getfont.php                            30-Sep-2022 11:10                2235
imagickdraw.getfontfamily.php                      30-Sep-2022 11:10                2331
imagickdraw.getfontsize.php                        30-Sep-2022 11:10                2378
imagickdraw.getfontstretch.php                     30-Sep-2022 11:10                2244
imagickdraw.getfontstyle.php                       30-Sep-2022 11:10                2528
imagickdraw.getfontweight.php                      30-Sep-2022 11:10                2267
imagickdraw.getgravity.php                         30-Sep-2022 11:10                2402
imagickdraw.getstrokeantialias.php                 30-Sep-2022 11:10                2633
imagickdraw.getstrokecolor.php                     30-Sep-2022 11:10                2503
imagickdraw.getstrokedasharray.php                 30-Sep-2022 11:10                2501
imagickdraw.getstrokedashoffset.php                30-Sep-2022 11:10                2408
imagickdraw.getstrokelinecap.php                   30-Sep-2022 11:10                2483
imagickdraw.getstrokelinejoin.php                  30-Sep-2022 11:10                2466
imagickdraw.getstrokemiterlimit.php                30-Sep-2022 11:10                2652
imagickdraw.getstrokeopacity.php                   30-Sep-2022 11:10                2418
imagickdraw.getstrokewidth.php                     30-Sep-2022 11:10                2389
imagickdraw.gettextalignment.php                   30-Sep-2022 11:10                2416
imagickdraw.gettextantialias.php                   30-Sep-2022 11:10                2424
imagickdraw.gettextdecoration.php                  30-Sep-2022 11:10                2449
imagickdraw.gettextencoding.php                    30-Sep-2022 11:10                2449
imagickdraw.gettextinterlinespacing.php            30-Sep-2022 11:10                2304
imagickdraw.gettextinterwordspacing.php            30-Sep-2022 11:10                2328
imagickdraw.gettextkerning.php                     30-Sep-2022 11:10                2233
imagickdraw.gettextundercolor.php                  30-Sep-2022 11:10                2442
imagickdraw.getvectorgraphics.php                  30-Sep-2022 11:10                2431
imagickdraw.line.php                               30-Sep-2022 11:10                8477
imagickdraw.matte.php                              30-Sep-2022 11:10                8341
imagickdraw.pathclose.php                          30-Sep-2022 11:10                2283
imagickdraw.pathcurvetoabsolute.php                30-Sep-2022 11:10                4751
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-Sep-2022 11:10               12377
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-Sep-2022 11:10                4183
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-Sep-2022 11:10               11481
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-Sep-2022 11:10               11453
imagickdraw.pathcurvetorelative.php                30-Sep-2022 11:10                4796
imagickdraw.pathcurvetosmoothabsolute.php          30-Sep-2022 11:10                4869
imagickdraw.pathcurvetosmoothrelative.php          30-Sep-2022 11:10                4878
imagickdraw.pathellipticarcabsolute.php            30-Sep-2022 11:10                5639
imagickdraw.pathellipticarcrelative.php            30-Sep-2022 11:10                5610
imagickdraw.pathfinish.php                         30-Sep-2022 11:10                2189
imagickdraw.pathlinetoabsolute.php                 30-Sep-2022 11:10                3028
imagickdraw.pathlinetohorizontalabsolute.php       30-Sep-2022 11:10                2928
imagickdraw.pathlinetohorizontalrelative.php       30-Sep-2022 11:10                2929
imagickdraw.pathlinetorelative.php                 30-Sep-2022 11:10                3077
imagickdraw.pathlinetoverticalabsolute.php         30-Sep-2022 11:10                2892
imagickdraw.pathlinetoverticalrelative.php         30-Sep-2022 11:10                2893
imagickdraw.pathmovetoabsolute.php                 30-Sep-2022 11:10                3095
imagickdraw.pathmovetorelative.php                 30-Sep-2022 11:10                3022
imagickdraw.pathstart.php                          30-Sep-2022 11:10               12772
imagickdraw.point.php                              30-Sep-2022 11:10                7052
imagickdraw.polygon.php                            30-Sep-2022 11:10                9530
imagickdraw.polyline.php                           30-Sep-2022 11:10                9530
imagickdraw.pop.php                                30-Sep-2022 11:10                2643
imagickdraw.popclippath.php                        30-Sep-2022 11:10                2172
imagickdraw.popdefs.php                            30-Sep-2022 11:10                8096
imagickdraw.poppattern.php                         30-Sep-2022 11:10                2251
imagickdraw.push.php                               30-Sep-2022 11:10                9481
imagickdraw.pushclippath.php                       30-Sep-2022 11:10                2884
imagickdraw.pushdefs.php                           30-Sep-2022 11:10                8646
imagickdraw.pushpattern.php                        30-Sep-2022 11:10               15557
imagickdraw.rectangle.php                          30-Sep-2022 11:10                8663
imagickdraw.render.php                             30-Sep-2022 11:10                2285
imagickdraw.resetvectorgraphics.php                30-Sep-2022 11:10                2272
imagickdraw.rotate.php                             30-Sep-2022 11:10                8003
imagickdraw.roundrectangle.php                     30-Sep-2022 11:10                9439
imagickdraw.scale.php                              30-Sep-2022 11:10                8275
imagickdraw.setclippath.php                        30-Sep-2022 11:10                8800
imagickdraw.setcliprule.php                        30-Sep-2022 11:10                9901
imagickdraw.setclipunits.php                       30-Sep-2022 11:10                9225
imagickdraw.setfillalpha.php                       30-Sep-2022 11:10                8055
imagickdraw.setfillcolor.php                       30-Sep-2022 11:10                8206
imagickdraw.setfillopacity.php                     30-Sep-2022 11:10                8091
imagickdraw.setfillpatternurl.php                  30-Sep-2022 11:10                3301
imagickdraw.setfillrule.php                        30-Sep-2022 11:10               14822
imagickdraw.setfont.php                            30-Sep-2022 11:10                9626
imagickdraw.setfontfamily.php                      30-Sep-2022 11:10               10272
imagickdraw.setfontsize.php                        30-Sep-2022 11:10                8656
imagickdraw.setfontstretch.php                     30-Sep-2022 11:10               10410
imagickdraw.setfontstyle.php                       30-Sep-2022 11:10                9225
imagickdraw.setfontweight.php                      30-Sep-2022 11:10                9537
imagickdraw.setgravity.php                         30-Sep-2022 11:10               11428
imagickdraw.setresolution.php                      30-Sep-2022 11:10                2658
imagickdraw.setstrokealpha.php                     30-Sep-2022 11:10                8777
imagickdraw.setstrokeantialias.php                 30-Sep-2022 11:10                9424
imagickdraw.setstrokecolor.php                     30-Sep-2022 11:10                8915
imagickdraw.setstrokedasharray.php                 30-Sep-2022 11:10               14036
imagickdraw.setstrokedashoffset.php                30-Sep-2022 11:10               10369
imagickdraw.setstrokelinecap.php                   30-Sep-2022 11:10                8958
imagickdraw.setstrokelinejoin.php                  30-Sep-2022 11:10               12530
imagickdraw.setstrokemiterlimit.php                30-Sep-2022 11:10               12230
imagickdraw.setstrokeopacity.php                   30-Sep-2022 11:10               10678
imagickdraw.setstrokepatternurl.php                30-Sep-2022 11:10                2877
imagickdraw.setstrokewidth.php                     30-Sep-2022 11:10                8844
imagickdraw.settextalignment.php                   30-Sep-2022 11:10                9780
imagickdraw.settextantialias.php                   30-Sep-2022 11:10                9332
imagickdraw.settextdecoration.php                  30-Sep-2022 11:10                7683
imagickdraw.settextencoding.php                    30-Sep-2022 11:10                3062
imagickdraw.settextinterlinespacing.php            30-Sep-2022 11:10                2720
imagickdraw.settextinterwordspacing.php            30-Sep-2022 11:10                2564
imagickdraw.settextkerning.php                     30-Sep-2022 11:10                2639
imagickdraw.settextundercolor.php                  30-Sep-2022 11:10                8059
imagickdraw.setvectorgraphics.php                  30-Sep-2022 11:10                9595
imagickdraw.setviewbox.php                         30-Sep-2022 11:10               10862
imagickdraw.skewx.php                              30-Sep-2022 11:10                8497
imagickdraw.skewy.php                              30-Sep-2022 11:10                8499
imagickdraw.translate.php                          30-Sep-2022 11:10                8812
imagickkernel.addkernel.php                        30-Sep-2022 11:10                7619
imagickkernel.addunitykernel.php                   30-Sep-2022 11:10               15966
imagickkernel.frombuiltin.php                      30-Sep-2022 11:10               29673
imagickkernel.frommatrix.php                       30-Sep-2022 11:10               26045
imagickkernel.getmatrix.php                        30-Sep-2022 11:10                8212
imagickkernel.scale.php                            30-Sep-2022 11:10               15169
imagickkernel.separate.php                         30-Sep-2022 11:10               11741
imagickpixel.clear.php                             30-Sep-2022 11:10                2268
imagickpixel.construct.php                         30-Sep-2022 11:10               13960
imagickpixel.destroy.php                           30-Sep-2022 11:10                2388
imagickpixel.getcolor.php                          30-Sep-2022 11:10                7748
imagickpixel.getcolorasstring.php                  30-Sep-2022 11:10                4833
imagickpixel.getcolorcount.php                     30-Sep-2022 11:10                5220
imagickpixel.getcolorquantum.php                   30-Sep-2022 11:10                2744
imagickpixel.getcolorvalue.php                     30-Sep-2022 11:10                7122
imagickpixel.getcolorvaluequantum.php              30-Sep-2022 11:10                6551
imagickpixel.gethsl.php                            30-Sep-2022 11:10                4508
imagickpixel.getindex.php                          30-Sep-2022 11:10                2160
imagickpixel.ispixelsimilar.php                    30-Sep-2022 11:10                3445
imagickpixel.ispixelsimilarquantum.php             30-Sep-2022 11:10                2974
imagickpixel.issimilar.php                         30-Sep-2022 11:10               22679
imagickpixel.setcolor.php                          30-Sep-2022 11:10                7521
imagickpixel.setcolorcount.php                     30-Sep-2022 11:10                2457
imagickpixel.setcolorvalue.php                     30-Sep-2022 11:10                4976
imagickpixel.setcolorvaluequantum.php              30-Sep-2022 11:10                8515
imagickpixel.sethsl.php                            30-Sep-2022 11:10                7660
imagickpixel.setindex.php                          30-Sep-2022 11:10                2392
imagickpixeliterator.clear.php                     30-Sep-2022 11:10                7129
imagickpixeliterator.construct.php                 30-Sep-2022 11:10                7043
imagickpixeliterator.destroy.php                   30-Sep-2022 11:10                2413
imagickpixeliterator.getcurrentiteratorrow.php     30-Sep-2022 11:10                2807
imagickpixeliterator.getiteratorrow.php            30-Sep-2022 11:10                2476
imagickpixeliterator.getnextiteratorrow.php        30-Sep-2022 11:10                7996
imagickpixeliterator.getpreviousiteratorrow.php    30-Sep-2022 11:10                2784
imagickpixeliterator.newpixeliterator.php          30-Sep-2022 11:10                2744
imagickpixeliterator.newpixelregioniterator.php    30-Sep-2022 11:10                4256
imagickpixeliterator.resetiterator.php             30-Sep-2022 11:10               10894
imagickpixeliterator.setiteratorfirstrow.php       30-Sep-2022 11:10                2472
imagickpixeliterator.setiteratorlastrow.php        30-Sep-2022 11:10                2467
imagickpixeliterator.setiteratorrow.php            30-Sep-2022 11:10                7639
imagickpixeliterator.synciterator.php              30-Sep-2022 11:10                2328
imap.configuration.php                             30-Sep-2022 11:10                3291
imap.constants.php                                 30-Sep-2022 11:10               17787
imap.installation.php                              30-Sep-2022 11:10                2770
imap.requirements.php                              30-Sep-2022 11:10                2643
imap.resources.php                                 30-Sep-2022 11:10                1434
imap.setup.php                                     30-Sep-2022 11:10                1553
index.php                                          30-Sep-2022 11:11               14737
indexes.examples.php                               30-Sep-2022 11:11              726592
indexes.functions.php                              30-Sep-2022 11:11             1182839
indexes.php                                        30-Sep-2022 11:11                1408
infiniteiterator.construct.php                     30-Sep-2022 11:10                5137
infiniteiterator.next.php                          30-Sep-2022 11:10                3261
info.configuration.php                             30-Sep-2022 11:10               19186
info.constants.php                                 30-Sep-2022 11:10               16077
info.installation.php                              30-Sep-2022 11:10                1206
info.requirements.php                              30-Sep-2022 11:10                1150
info.resources.php                                 30-Sep-2022 11:10                1194
info.setup.php                                     30-Sep-2022 11:10                1528
ini.core.php                                       30-Sep-2022 11:11               71859
ini.list.php                                       30-Sep-2022 11:11               90875
ini.php                                            30-Sep-2022 11:11                1573
ini.sections.php                                   30-Sep-2022 11:11                4094
inotify.configuration.php                          30-Sep-2022 11:10                1274
inotify.constants.php                              30-Sep-2022 11:10                7811
inotify.install.php                                30-Sep-2022 11:10                1697
inotify.requirements.php                           30-Sep-2022 11:10                1189
inotify.resources.php                              30-Sep-2022 11:10                1324
inotify.setup.php                                  30-Sep-2022 11:10                1588
install.cloud.azure.php                            30-Sep-2022 11:10                4237
install.cloud.ec2.php                              30-Sep-2022 11:10                1398
install.cloud.php                                  30-Sep-2022 11:10                1572
install.fpm.configuration.php                      30-Sep-2022 11:10               33332
install.fpm.install.php                            30-Sep-2022 11:10                3282
install.fpm.php                                    30-Sep-2022 11:10                3594
install.general.php                                30-Sep-2022 11:10                4705
install.macosx.bundled.php                         30-Sep-2022 11:10               10717
install.macosx.compile.php                         30-Sep-2022 11:10                1334
install.macosx.packages.php                        30-Sep-2022 11:10                2999
install.macosx.php                                 30-Sep-2022 11:10                2002
install.pecl.downloads.php                         30-Sep-2022 11:10                3590
install.pecl.intro.php                             30-Sep-2022 11:10                3227
install.pecl.pear.php                              30-Sep-2022 11:10                3051
install.pecl.php                                   30-Sep-2022 11:10                1955
install.pecl.php-config.php                        30-Sep-2022 11:10                3884
install.pecl.phpize.php                            30-Sep-2022 11:10                3047
install.pecl.static.php                            30-Sep-2022 11:10                3466
install.pecl.windows.php                           30-Sep-2022 11:10                9867
install.php                                        30-Sep-2022 11:10                5566
install.problems.bugs.php                          30-Sep-2022 11:10                1942
install.problems.faq.php                           30-Sep-2022 11:10                1310
install.problems.php                               30-Sep-2022 11:10                1530
install.problems.support.php                       30-Sep-2022 11:10                2558
install.unix.apache2.php                           30-Sep-2022 11:10               13142
install.unix.commandline.php                       30-Sep-2022 11:10                3982
install.unix.debian.php                            30-Sep-2022 11:10                7384
install.unix.lighttpd-14.php                       30-Sep-2022 11:10                6400
install.unix.litespeed.php                         30-Sep-2022 11:10                8938
install.unix.nginx.php                             30-Sep-2022 11:10                8306
install.unix.openbsd.php                           30-Sep-2022 11:10                5716
install.unix.php                                   30-Sep-2022 11:10                7445
install.unix.solaris.php                           30-Sep-2022 11:10                3869
install.windows.apache2.php                        30-Sep-2022 11:10                7198
install.windows.building.php                       30-Sep-2022 11:10                1664
install.windows.commandline.php                    30-Sep-2022 11:10                8703
install.windows.manual.php                         30-Sep-2022 11:10                5525
install.windows.pecl.php                           30-Sep-2022 11:10                1611
install.windows.php                                30-Sep-2022 11:10                3262
install.windows.recommended.php                    30-Sep-2022 11:10                5109
install.windows.requirements.php                   30-Sep-2022 11:10                2215
install.windows.tools.php                          30-Sep-2022 11:10                1801
install.windows.troubleshooting.php                30-Sep-2022 11:10                1709
internaliterator.construct.php                     30-Sep-2022 11:10                1946
internaliterator.current.php                       30-Sep-2022 11:10                2296
internaliterator.key.php                           30-Sep-2022 11:10                2292
internaliterator.next.php                          30-Sep-2022 11:10                2192
internaliterator.rewind.php                        30-Sep-2022 11:10                2223
internaliterator.valid.php                         30-Sep-2022 11:10                2216
intl.configuration.php                             30-Sep-2022 11:10                5063
intl.constants.php                                 30-Sep-2022 11:10                7449
intl.examples.basic.php                            30-Sep-2022 11:10                4447
intl.examples.php                                  30-Sep-2022 11:10                1362
intl.installation.php                              30-Sep-2022 11:10                2277
intl.requirements.php                              30-Sep-2022 11:10                1503
intl.resources.php                                 30-Sep-2022 11:10                1194
intl.setup.php                                     30-Sep-2022 11:10                1550
intlbreakiterator.construct.php                    30-Sep-2022 11:10                2396
intlbreakiterator.createcharacterinstance.php      30-Sep-2022 11:10                3107
intlbreakiterator.createcodepointinstance.php      30-Sep-2022 11:10                2739
intlbreakiterator.createlineinstance.php           30-Sep-2022 11:10                3068
intlbreakiterator.createsentenceinstance.php       30-Sep-2022 11:10                3070
intlbreakiterator.createtitleinstance.php          30-Sep-2022 11:10                3050
intlbreakiterator.createwordinstance.php           30-Sep-2022 11:10                3004
intlbreakiterator.current.php                      30-Sep-2022 11:10                2370
intlbreakiterator.first.php                        30-Sep-2022 11:10                2354
intlbreakiterator.following.php                    30-Sep-2022 11:10                2606
intlbreakiterator.geterrorcode.php                 30-Sep-2022 11:10                2847
intlbreakiterator.geterrormessage.php              30-Sep-2022 11:10                2982
intlbreakiterator.getlocale.php                    30-Sep-2022 11:10                2598
intlbreakiterator.getpartsiterator.php             30-Sep-2022 11:10                3400
intlbreakiterator.gettext.php                      30-Sep-2022 11:10                2429
intlbreakiterator.isboundary.php                   30-Sep-2022 11:10                2575
intlbreakiterator.last.php                         30-Sep-2022 11:10                2353
intlbreakiterator.next.php                         30-Sep-2022 11:10                2659
intlbreakiterator.preceding.php                    30-Sep-2022 11:10                2584
intlbreakiterator.previous.php                     30-Sep-2022 11:10                2409
intlbreakiterator.settext.php                      30-Sep-2022 11:10                2592
intlcalendar.add.php                               30-Sep-2022 11:10                8373
intlcalendar.after.php                             30-Sep-2022 11:10                6732
intlcalendar.before.php                            30-Sep-2022 11:10                3973
intlcalendar.clear.php                             30-Sep-2022 11:10               20713
intlcalendar.construct.php                         30-Sep-2022 11:10                2301
intlcalendar.createinstance.php                    30-Sep-2022 11:10               12887
intlcalendar.equals.php                            30-Sep-2022 11:10               10972
intlcalendar.fielddifference.php                   30-Sep-2022 11:10               11313
intlcalendar.fromdatetime.php                      30-Sep-2022 11:10                7447
intlcalendar.get.php                               30-Sep-2022 11:10                8856
intlcalendar.getactualmaximum.php                  30-Sep-2022 11:10                8427
intlcalendar.getactualminimum.php                  30-Sep-2022 11:10                5592
intlcalendar.getavailablelocales.php               30-Sep-2022 11:10                4176
intlcalendar.getdayofweektype.php                  30-Sep-2022 11:10                9826
intlcalendar.geterrorcode.php                      30-Sep-2022 11:10                9139
intlcalendar.geterrormessage.php                   30-Sep-2022 11:10                5949
intlcalendar.getfirstdayofweek.php                 30-Sep-2022 11:10                8487
intlcalendar.getgreatestminimum.php                30-Sep-2022 11:10                4425
intlcalendar.getkeywordvaluesforlocale.php         30-Sep-2022 11:10                7550
intlcalendar.getleastmaximum.php                   30-Sep-2022 11:10                8224
intlcalendar.getlocale.php                         30-Sep-2022 11:10                5928
intlcalendar.getmaximum.php                        30-Sep-2022 11:10                5125
intlcalendar.getminimaldaysinfirstweek.php         30-Sep-2022 11:10                9022
intlcalendar.getminimum.php                        30-Sep-2022 11:10                4369
intlcalendar.getnow.php                            30-Sep-2022 11:10                5313
intlcalendar.getrepeatedwalltimeoption.php         30-Sep-2022 11:10               10307
intlcalendar.getskippedwalltimeoption.php          30-Sep-2022 11:10               12716
intlcalendar.gettime.php                           30-Sep-2022 11:10                6452
intlcalendar.gettimezone.php                       30-Sep-2022 11:10                7534
intlcalendar.gettype.php                           30-Sep-2022 11:10                5587
intlcalendar.getweekendtransition.php              30-Sep-2022 11:10                4707
intlcalendar.indaylighttime.php                    30-Sep-2022 11:10                8792
intlcalendar.isequivalentto.php                    30-Sep-2022 11:10                8492
intlcalendar.islenient.php                         30-Sep-2022 11:10                8321
intlcalendar.isset.php                             30-Sep-2022 11:10                4605
intlcalendar.isweekend.php                         30-Sep-2022 11:10                8734
intlcalendar.roll.php                              30-Sep-2022 11:10                9030
intlcalendar.set.php                               30-Sep-2022 11:10               14075
intlcalendar.setfirstdayofweek.php                 30-Sep-2022 11:10                7874
intlcalendar.setlenient.php                        30-Sep-2022 11:10                4069
intlcalendar.setminimaldaysinfirstweek.php         30-Sep-2022 11:10                4067
intlcalendar.setrepeatedwalltimeoption.php         30-Sep-2022 11:10                5378
intlcalendar.setskippedwalltimeoption.php          30-Sep-2022 11:10                6087
intlcalendar.settime.php                           30-Sep-2022 11:10                8574
intlcalendar.settimezone.php                       30-Sep-2022 11:10               10887
intlcalendar.todatetime.php                        30-Sep-2022 11:10                7157
intlchar.charage.php                               30-Sep-2022 11:10                5510
intlchar.chardigitvalue.php                        30-Sep-2022 11:10                5182
intlchar.chardirection.php                         30-Sep-2022 11:10                8623
intlchar.charfromname.php                          30-Sep-2022 11:10                6699
intlchar.charmirror.php                            30-Sep-2022 11:10                6028
intlchar.charname.php                              30-Sep-2022 11:10                6975
intlchar.chartype.php                              30-Sep-2022 11:10                9159
intlchar.chr.php                                   30-Sep-2022 11:10                5388
intlchar.digit.php                                 30-Sep-2022 11:10                7944
intlchar.enumcharnames.php                         30-Sep-2022 11:10                7679
intlchar.enumchartypes.php                         30-Sep-2022 11:10                5729
intlchar.foldcase.php                              30-Sep-2022 11:10                3452
intlchar.fordigit.php                              30-Sep-2022 11:10                6852
intlchar.getbidipairedbracket.php                  30-Sep-2022 11:10                5626
intlchar.getblockcode.php                          30-Sep-2022 11:10                5251
intlchar.getcombiningclass.php                     30-Sep-2022 11:10                4565
intlchar.getfc-nfkc-closure.php                    30-Sep-2022 11:10                4506
intlchar.getintpropertymaxvalue.php                30-Sep-2022 11:10                6315
intlchar.getintpropertyminvalue.php                30-Sep-2022 11:10                6308
intlchar.getintpropertyvalue.php                   30-Sep-2022 11:10                7636
intlchar.getnumericvalue.php                       30-Sep-2022 11:10                5075
intlchar.getpropertyenum.php                       30-Sep-2022 11:10                6493
intlchar.getpropertyname.php                       30-Sep-2022 11:10                8156
intlchar.getpropertyvalueenum.php                  30-Sep-2022 11:10                7816
intlchar.getpropertyvaluename.php                  30-Sep-2022 11:10                9894
intlchar.getunicodeversion.php                     30-Sep-2022 11:10                3893
intlchar.hasbinaryproperty.php                     30-Sep-2022 11:10                8499
intlchar.isalnum.php                               30-Sep-2022 11:10                5304
intlchar.isalpha.php                               30-Sep-2022 11:10                5192
intlchar.isbase.php                                30-Sep-2022 11:10                5674
intlchar.isblank.php                               30-Sep-2022 11:10                6381
intlchar.iscntrl.php                               30-Sep-2022 11:10                5981
intlchar.isdefined.php                             30-Sep-2022 11:10                6416
intlchar.isdigit.php                               30-Sep-2022 11:10                5530
intlchar.isgraph.php                               30-Sep-2022 11:10                5215
intlchar.isidignorable.php                         30-Sep-2022 11:10                5813
intlchar.isidpart.php                              30-Sep-2022 11:10                6393
intlchar.isidstart.php                             30-Sep-2022 11:10                5895
intlchar.isisocontrol.php                          30-Sep-2022 11:10                5147
intlchar.isjavaidpart.php                          30-Sep-2022 11:10                6487
intlchar.isjavaidstart.php                         30-Sep-2022 11:10                6187
intlchar.isjavaspacechar.php                       30-Sep-2022 11:10                6425
intlchar.islower.php                               30-Sep-2022 11:10                6696
intlchar.ismirrored.php                            30-Sep-2022 11:10                5257
intlchar.isprint.php                               30-Sep-2022 11:10                5501
intlchar.ispunct.php                               30-Sep-2022 11:10                4962
intlchar.isspace.php                               30-Sep-2022 11:10                6068
intlchar.istitle.php                               30-Sep-2022 11:10                6129
intlchar.isualphabetic.php                         30-Sep-2022 11:10                5488
intlchar.isulowercase.php                          30-Sep-2022 11:10                6473
intlchar.isupper.php                               30-Sep-2022 11:10                6694
intlchar.isuuppercase.php                          30-Sep-2022 11:10                6511
intlchar.isuwhitespace.php                         30-Sep-2022 11:10                7017
intlchar.iswhitespace.php                          30-Sep-2022 11:10                7140
intlchar.isxdigit.php                              30-Sep-2022 11:10                6577
intlchar.ord.php                                   30-Sep-2022 11:10                5244
intlchar.tolower.php                               30-Sep-2022 11:10                7224
intlchar.totitle.php                               30-Sep-2022 11:10                7286
intlchar.toupper.php                               30-Sep-2022 11:10                7160
intlcodepointbreakiterator.getlastcodepoint.php    30-Sep-2022 11:10                2612
intldateformatter.create.php                       30-Sep-2022 11:10               27700
intldateformatter.format.php                       30-Sep-2022 11:10               27626
intldateformatter.formatobject.php                 30-Sep-2022 11:10               13945
intldateformatter.getcalendar.php                  30-Sep-2022 11:10                9306
intldateformatter.getcalendarobject.php            30-Sep-2022 11:10                7641
intldateformatter.getdatetype.php                  30-Sep-2022 11:10               12305
intldateformatter.geterrorcode.php                 30-Sep-2022 11:10                9277
intldateformatter.geterrormessage.php              30-Sep-2022 11:10                9192
intldateformatter.getlocale.php                    30-Sep-2022 11:10               12306
intldateformatter.getpattern.php                   30-Sep-2022 11:10               11400
intldateformatter.gettimetype.php                  30-Sep-2022 11:10               12186
intldateformatter.gettimezone.php                  30-Sep-2022 11:10                8777
intldateformatter.gettimezoneid.php                30-Sep-2022 11:10                9170
intldateformatter.islenient.php                    30-Sep-2022 11:10               16331
intldateformatter.localtime.php                    30-Sep-2022 11:10               11765
intldateformatter.parse.php                        30-Sep-2022 11:10               13632
intldateformatter.setcalendar.php                  30-Sep-2022 11:10               14039
intldateformatter.setlenient.php                   30-Sep-2022 11:10               16746
intldateformatter.setpattern.php                   30-Sep-2022 11:10               11873
intldateformatter.settimezone.php                  30-Sep-2022 11:10               11586
intldatepatterngenerator.create.php                30-Sep-2022 11:10                3774
intldatepatterngenerator.getbestpattern.php        30-Sep-2022 11:10                6821
intlgregoriancalendar.construct.php                30-Sep-2022 11:10                5072
intlgregoriancalendar.getgregorianchange.php       30-Sep-2022 11:10                2576
intlgregoriancalendar.isleapyear.php               30-Sep-2022 11:10                2804
intlgregoriancalendar.setgregorianchange.php       30-Sep-2022 11:10                2834
intliterator.current.php                           30-Sep-2022 11:10                2343
intliterator.key.php                               30-Sep-2022 11:10                2312
intliterator.next.php                              30-Sep-2022 11:10                2262
intliterator.rewind.php                            30-Sep-2022 11:10                2290
intliterator.valid.php                             30-Sep-2022 11:10                2234
intlpartsiterator.getbreakiterator.php             30-Sep-2022 11:10                2513
intlrulebasedbreakiterator.construct.php           30-Sep-2022 11:10                2991
intlrulebasedbreakiterator.getbinaryrules.php      30-Sep-2022 11:10                2684
intlrulebasedbreakiterator.getrules.php            30-Sep-2022 11:10                2648
intlrulebasedbreakiterator.getrulestatus.php       30-Sep-2022 11:10                2648
intlrulebasedbreakiterator.getrulestatusvec.php    30-Sep-2022 11:10                2744
intltimezone.construct.php                         30-Sep-2022 11:10                1942
intltimezone.countequivalentids.php                30-Sep-2022 11:10                3364
intltimezone.createdefault.php                     30-Sep-2022 11:10                2970
intltimezone.createenumeration.php                 30-Sep-2022 11:10                4120
intltimezone.createtimezone.php                    30-Sep-2022 11:10                3396
intltimezone.createtimezoneidenumeration.php       30-Sep-2022 11:10                5050
intltimezone.fromdatetimezone.php                  30-Sep-2022 11:10                3637
intltimezone.getcanonicalid.php                    30-Sep-2022 11:10                3867
intltimezone.getdisplayname.php                    30-Sep-2022 11:10                4772
intltimezone.getdstsavings.php                     30-Sep-2022 11:10                2986
intltimezone.getequivalentid.php                   30-Sep-2022 11:10                3654
intltimezone.geterrorcode.php                      30-Sep-2022 11:10                3106
intltimezone.geterrormessage.php                   30-Sep-2022 11:10                3130
intltimezone.getgmt.php                            30-Sep-2022 11:10                2819
intltimezone.getid.php                             30-Sep-2022 11:10                2982
intltimezone.getidforwindowsid.php                 30-Sep-2022 11:10                5232
intltimezone.getoffset.php                         30-Sep-2022 11:10                4504
intltimezone.getrawoffset.php                      30-Sep-2022 11:10                2937
intltimezone.getregion.php                         30-Sep-2022 11:10                3319
intltimezone.gettzdataversion.php                  30-Sep-2022 11:10                3021
intltimezone.getunknown.php                        30-Sep-2022 11:10                3034
intltimezone.getwindowsid.php                      30-Sep-2022 11:10                4085
intltimezone.hassamerules.php                      30-Sep-2022 11:10                3372
intltimezone.todatetimezone.php                    30-Sep-2022 11:10                3351
intltimezone.usedaylighttime.php                   30-Sep-2022 11:10                2968
intro-whatcando.php                                30-Sep-2022 11:10                8336
intro-whatis.php                                   30-Sep-2022 11:10                4667
intro.apache.php                                   30-Sep-2022 11:11                1133
intro.apcu.php                                     30-Sep-2022 11:10                1524
intro.array.php                                    30-Sep-2022 11:11                2000
intro.bc.php                                       30-Sep-2022 11:10                4417
intro.bzip2.php                                    30-Sep-2022 11:10                1154
intro.calendar.php                                 30-Sep-2022 11:10                2100
intro.classobj.php                                 30-Sep-2022 11:11                1694
intro.cmark.php                                    30-Sep-2022 11:11                6328
intro.com.php                                      30-Sep-2022 11:11                3145
intro.componere.php                                30-Sep-2022 11:10                6091
intro.csprng.php                                   30-Sep-2022 11:10                1618
intro.ctype.php                                    30-Sep-2022 11:11                3731
intro.cubrid.php                                   30-Sep-2022 11:10                1418
intro.curl.php                                     30-Sep-2022 11:11                1613
intro.datetime.php                                 30-Sep-2022 11:10                2189
intro.dba.php                                      30-Sep-2022 11:10                1438
intro.dbase.php                                    30-Sep-2022 11:10                6203
intro.dio.php                                      30-Sep-2022 11:10                1595
intro.dom.php                                      30-Sep-2022 11:11                1648
intro.ds.php                                       30-Sep-2022 11:11                1340
intro.eio.php                                      30-Sep-2022 11:10               15526
intro.enchant.php                                  30-Sep-2022 11:10                2551
intro.errorfunc.php                                30-Sep-2022 11:10                2055
intro.ev.php                                       30-Sep-2022 11:10                2226
intro.event.php                                    30-Sep-2022 11:11                1928
intro.exec.php                                     30-Sep-2022 11:10                1711
intro.exif.php                                     30-Sep-2022 11:10                1437
intro.expect.php                                   30-Sep-2022 11:10                1372
intro.fann.php                                     30-Sep-2022 11:10                1361
intro.fdf.php                                      30-Sep-2022 11:10                3767
intro.ffi.php                                      30-Sep-2022 11:10                2794
intro.fileinfo.php                                 30-Sep-2022 11:10                1367
intro.filesystem.php                               30-Sep-2022 11:10                1417
intro.filter.php                                   30-Sep-2022 11:11                2610
intro.fpm.php                                      30-Sep-2022 11:11                1294
intro.ftp.php                                      30-Sep-2022 11:11                1792
intro.funchand.php                                 30-Sep-2022 11:11                1156
intro.gearman.php                                  30-Sep-2022 11:11                1602
intro.gender.php                                   30-Sep-2022 11:10                1270
intro.geoip.php                                    30-Sep-2022 11:10                1509
intro.gettext.php                                  30-Sep-2022 11:10                1489
intro.gmagick.php                                  30-Sep-2022 11:10                1632
intro.gmp.php                                      30-Sep-2022 11:10                2952
intro.gnupg.php                                    30-Sep-2022 11:10                1159
intro.hash.php                                     30-Sep-2022 11:10                1177
intro.hrtime.php                                   30-Sep-2022 11:10                1608
intro.ibase.php                                    30-Sep-2022 11:10                3114
intro.ibm-db2.php                                  30-Sep-2022 11:10                1219
intro.iconv.php                                    30-Sep-2022 11:10                1851
intro.igbinary.php                                 30-Sep-2022 11:10                1614
intro.image.php                                    30-Sep-2022 11:10                5810
intro.imagick.php                                  30-Sep-2022 11:10                1784
intro.imap.php                                     30-Sep-2022 11:10                1694
intro.info.php                                     30-Sep-2022 11:10                1482
intro.inotify.php                                  30-Sep-2022 11:10                2281
intro.intl.php                                     30-Sep-2022 11:10                5843
intro.json.php                                     30-Sep-2022 11:10                1633
intro.ldap.php                                     30-Sep-2022 11:11                4020
intro.libxml.php                                   30-Sep-2022 11:11                1616
intro.lua.php                                      30-Sep-2022 11:10                1207
intro.luasandbox.php                               30-Sep-2022 11:10                2304
intro.lzf.php                                      30-Sep-2022 11:10                1523
intro.mail.php                                     30-Sep-2022 11:10                1162
intro.mailparse.php                                30-Sep-2022 11:10                1881
intro.math.php                                     30-Sep-2022 11:10                1881
intro.mbstring.php                                 30-Sep-2022 11:10                2585
intro.mcrypt.php                                   30-Sep-2022 11:10                2347
intro.memcache.php                                 30-Sep-2022 11:11                1623
intro.memcached.php                                30-Sep-2022 11:11                1816
intro.mhash.php                                    30-Sep-2022 11:10                2845
intro.misc.php                                     30-Sep-2022 11:10                1109
intro.mqseries.php                                 30-Sep-2022 11:11                1683
intro.mysql-xdevapi.php                            30-Sep-2022 11:10                1819
intro.mysql.php                                    30-Sep-2022 11:10                2102
intro.mysqli.php                                   30-Sep-2022 11:10                2107
intro.mysqlnd.php                                  30-Sep-2022 11:10                1885
intro.network.php                                  30-Sep-2022 11:11                1104
intro.oauth.php                                    30-Sep-2022 11:11                1273
intro.oci8.php                                     30-Sep-2022 11:10                1415
intro.opcache.php                                  30-Sep-2022 11:10                1469
intro.openal.php                                   30-Sep-2022 11:10                1192
intro.openssl.php                                  30-Sep-2022 11:10                1523
intro.outcontrol.php                               30-Sep-2022 11:10                1802
intro.parallel.php                                 30-Sep-2022 11:10                6818
intro.parle.php                                    30-Sep-2022 11:11                3378
intro.password.php                                 30-Sep-2022 11:10                1375
intro.pcntl.php                                    30-Sep-2022 11:10                2556
intro.pcre.php                                     30-Sep-2022 11:11                2764
intro.pdo.php                                      30-Sep-2022 11:10                2124
intro.pgsql.php                                    30-Sep-2022 11:10                1517
intro.phar.php                                     30-Sep-2022 11:10               10050
intro.phpdbg.php                                   30-Sep-2022 11:10                5980
intro.posix.php                                    30-Sep-2022 11:10                1581
intro.ps.php                                       30-Sep-2022 11:10                1701
intro.pspell.php                                   30-Sep-2022 11:10                1134
intro.pthreads.php                                 30-Sep-2022 11:10                9071
intro.quickhash.php                                30-Sep-2022 11:11                1206
intro.radius.php                                   30-Sep-2022 11:10                2109
intro.rar.php                                      30-Sep-2022 11:10                1480
intro.readline.php                                 30-Sep-2022 11:10                1901
intro.recode.php                                   30-Sep-2022 11:10                2296
intro.reflection.php                               30-Sep-2022 11:11                1824
intro.rpminfo.php                                  30-Sep-2022 11:10                1165
intro.rrd.php                                      30-Sep-2022 11:11                1375
intro.runkit7.php                                  30-Sep-2022 11:10                1418
intro.scoutapm.php                                 30-Sep-2022 11:11                1402
intro.seaslog.php                                  30-Sep-2022 11:10                4112
intro.sem.php                                      30-Sep-2022 11:10                3167
intro.session.php                                  30-Sep-2022 11:11                5528
intro.shmop.php                                    30-Sep-2022 11:10                1180
intro.simplexml.php                                30-Sep-2022 11:11                1252
intro.snmp.php                                     30-Sep-2022 11:11                1598
intro.soap.php                                     30-Sep-2022 11:11                1403
intro.sockets.php                                  30-Sep-2022 11:11                2576
intro.sodium.php                                   30-Sep-2022 11:10                1269
intro.solr.php                                     30-Sep-2022 11:11                1724
intro.spl.php                                      30-Sep-2022 11:10                1514
intro.sqlite3.php                                  30-Sep-2022 11:10                1115
intro.sqlsrv.php                                   30-Sep-2022 11:10                2105
intro.ssdeep.php                                   30-Sep-2022 11:11                1698
intro.ssh2.php                                     30-Sep-2022 11:11                1305
intro.stats.php                                    30-Sep-2022 11:10                1450
intro.stomp.php                                    30-Sep-2022 11:11                1283
intro.stream.php                                   30-Sep-2022 11:11                4252
intro.strings.php                                  30-Sep-2022 11:11                1629
intro.svm.php                                      30-Sep-2022 11:11                1181
intro.svn.php                                      30-Sep-2022 11:11                1722
intro.swoole.php                                   30-Sep-2022 11:11                1581
intro.sync.php                                     30-Sep-2022 11:10                2296
intro.taint.php                                    30-Sep-2022 11:11                4476
intro.tcpwrap.php                                  30-Sep-2022 11:11                1204
intro.tidy.php                                     30-Sep-2022 11:11                1437
intro.tokenizer.php                                30-Sep-2022 11:11                1488
intro.trader.php                                   30-Sep-2022 11:10                2327
intro.ui.php                                       30-Sep-2022 11:11                1150
intro.uodbc.php                                    30-Sep-2022 11:10                2762
intro.uopz.php                                     30-Sep-2022 11:10                2345
intro.url.php                                      30-Sep-2022 11:11                1099
intro.v8js.php                                     30-Sep-2022 11:11                1167
intro.var.php                                      30-Sep-2022 11:11                1261
intro.var_representation.php                       30-Sep-2022 11:11                1368
intro.varnish.php                                  30-Sep-2022 11:11                1257
intro.wddx.php                                     30-Sep-2022 11:11                2278
intro.win32service.php                             30-Sep-2022 11:11                1390
intro.wincache.php                                 30-Sep-2022 11:10                4914
intro.wkhtmltox.php                                30-Sep-2022 11:10                1216
intro.xattr.php                                    30-Sep-2022 11:10                1130
intro.xdiff.php                                    30-Sep-2022 11:10                2658
intro.xhprof.php                                   30-Sep-2022 11:10                2733
intro.xlswriter.php                                30-Sep-2022 11:10                1129
intro.xml.php                                      30-Sep-2022 11:11                2595
intro.xmldiff.php                                  30-Sep-2022 11:11                1350
intro.xmlreader.php                                30-Sep-2022 11:11                1441
intro.xmlrpc.php                                   30-Sep-2022 11:11                1865
intro.xmlwriter.php                                30-Sep-2022 11:11                1519
intro.xsl.php                                      30-Sep-2022 11:11                1292
intro.yac.php                                      30-Sep-2022 11:10                1141
intro.yaconf.php                                   30-Sep-2022 11:11                2507
intro.yaf.php                                      30-Sep-2022 11:11                1489
intro.yaml.php                                     30-Sep-2022 11:11                1345
intro.yar.php                                      30-Sep-2022 11:11                1210
intro.yaz.php                                      30-Sep-2022 11:11                2536
intro.zip.php                                      30-Sep-2022 11:10                1145
intro.zlib.php                                     30-Sep-2022 11:10                1696
intro.zmq.php                                      30-Sep-2022 11:11                1326
intro.zookeeper.php                                30-Sep-2022 11:11                1387
introduction.php                                   30-Sep-2022 11:10                1358
iterator.current.php                               30-Sep-2022 11:10                2163
iterator.key.php                                   30-Sep-2022 11:10                2532
iterator.next.php                                  30-Sep-2022 11:10                2365
iterator.rewind.php                                30-Sep-2022 11:10                2514
iterator.valid.php                                 30-Sep-2022 11:10                2566
iteratoraggregate.getiterator.php                  30-Sep-2022 11:10                2863
iteratoriterator.construct.php                     30-Sep-2022 11:10                2949
iteratoriterator.current.php                       30-Sep-2022 11:10                2744
iteratoriterator.getinneriterator.php              30-Sep-2022 11:10                3058
iteratoriterator.key.php                           30-Sep-2022 11:10                2692
iteratoriterator.next.php                          30-Sep-2022 11:10                2793
iteratoriterator.rewind.php                        30-Sep-2022 11:10                2812
iteratoriterator.valid.php                         30-Sep-2022 11:10                2849
json.configuration.php                             30-Sep-2022 11:10                1243
json.constants.php                                 30-Sep-2022 11:10               12805
json.installation.php                              30-Sep-2022 11:10                1770
json.requirements.php                              30-Sep-2022 11:10                1187
json.resources.php                                 30-Sep-2022 11:10                1194
json.setup.php                                     30-Sep-2022 11:10                1523
jsonserializable.jsonserialize.php                 30-Sep-2022 11:10               12761
langref.php                                        30-Sep-2022 11:10               19931
language.attributes.classes.php                    30-Sep-2022 11:10                5647
language.attributes.overview.php                   30-Sep-2022 11:10               11765
language.attributes.php                            30-Sep-2022 11:10                1776
language.attributes.reflection.php                 30-Sep-2022 11:10                8817
language.attributes.syntax.php                     30-Sep-2022 11:10                5122
language.basic-syntax.comments.php                 30-Sep-2022 11:10                4371
language.basic-syntax.instruction-separation.php   30-Sep-2022 11:10                4338
language.basic-syntax.php                          30-Sep-2022 11:10                1643
language.basic-syntax.phpmode.php                  30-Sep-2022 11:10                4912
language.basic-syntax.phptags.php                  30-Sep-2022 11:10                5365
language.constants.magic.php                       30-Sep-2022 11:10                5195
language.constants.php                             30-Sep-2022 11:10                6735
language.constants.predefined.php                  30-Sep-2022 11:10                1468
language.constants.syntax.php                      30-Sep-2022 11:10               10377
language.control-structures.php                    30-Sep-2022 11:10                2707
language.enumerations.backed.php                   30-Sep-2022 11:10               10853
language.enumerations.basics.php                   30-Sep-2022 11:10                7904
language.enumerations.constants.php                30-Sep-2022 11:10                2292
language.enumerations.examples.php                 30-Sep-2022 11:10                7804
language.enumerations.expressions.php              30-Sep-2022 11:10                5873
language.enumerations.listing.php                  30-Sep-2022 11:10                2296
language.enumerations.methods.php                  30-Sep-2022 11:10               15918
language.enumerations.object-differences.php       30-Sep-2022 11:10                4969
language.enumerations.overview.php                 30-Sep-2022 11:10                2370
language.enumerations.php                          30-Sep-2022 11:10                2353
language.enumerations.serialization.php            30-Sep-2022 11:10                4996
language.enumerations.static-methods.php           30-Sep-2022 11:10                3693
language.enumerations.traits.php                   30-Sep-2022 11:10                4966
language.errors.basics.php                         30-Sep-2022 11:10                5105
language.errors.php                                30-Sep-2022 11:10                1859
language.errors.php7.php                           30-Sep-2022 11:10                5741
language.exceptions.extending.php                  30-Sep-2022 11:10               25594
language.exceptions.php                            30-Sep-2022 11:10               31174
language.expressions.php                           30-Sep-2022 11:10               17071
language.fibers.php                                30-Sep-2022 11:10                6811
language.functions.php                             30-Sep-2022 11:10                1931
language.generators.comparison.php                 30-Sep-2022 11:10               10399
language.generators.overview.php                   30-Sep-2022 11:10               10201
language.generators.php                            30-Sep-2022 11:10                1608
language.generators.syntax.php                     30-Sep-2022 11:10               26985
language.namespaces.basics.php                     30-Sep-2022 11:10               13301
language.namespaces.definition.php                 30-Sep-2022 11:10                4454
language.namespaces.definitionmultiple.php         30-Sep-2022 11:10               10063
language.namespaces.dynamic.php                    30-Sep-2022 11:10                9196
language.namespaces.fallback.php                   30-Sep-2022 11:10                6815
language.namespaces.faq.php                        30-Sep-2022 11:10               36066
language.namespaces.global.php                     30-Sep-2022 11:10                3109
language.namespaces.importing.php                  30-Sep-2022 11:10               19019
language.namespaces.nested.php                     30-Sep-2022 11:10                3065
language.namespaces.nsconstants.php                30-Sep-2022 11:10               10364
language.namespaces.php                            30-Sep-2022 11:10                2557
language.namespaces.rationale.php                  30-Sep-2022 11:10                7329
language.namespaces.rules.php                      30-Sep-2022 11:10               15284
language.oop5.abstract.php                         30-Sep-2022 11:10               12432
language.oop5.anonymous.php                        30-Sep-2022 11:10               12132
language.oop5.autoload.php                         30-Sep-2022 11:10                7119
language.oop5.basic.php                            30-Sep-2022 11:10               49119
language.oop5.changelog.php                        30-Sep-2022 11:10               13471
language.oop5.cloning.php                          30-Sep-2022 11:10                9691
language.oop5.constants.php                        30-Sep-2022 11:10                9707
language.oop5.decon.php                            30-Sep-2022 11:10               30101
language.oop5.final.php                            30-Sep-2022 11:10                7120
language.oop5.inheritance.php                      30-Sep-2022 11:10               15361
language.oop5.interfaces.php                       30-Sep-2022 11:10               23556
language.oop5.iterations.php                       30-Sep-2022 11:10                6407
language.oop5.late-static-bindings.php             30-Sep-2022 11:10               16522
language.oop5.magic.php                            30-Sep-2022 11:10               46429
language.oop5.object-comparison.php                30-Sep-2022 11:10                9770
language.oop5.overloading.php                      30-Sep-2022 11:10               27240
language.oop5.paamayim-nekudotayim.php             30-Sep-2022 11:10                8955
language.oop5.php                                  30-Sep-2022 11:10                3482
language.oop5.properties.php                       30-Sep-2022 11:10               29139
language.oop5.references.php                       30-Sep-2022 11:10                6328
language.oop5.serialization.php                    30-Sep-2022 11:10                7682
language.oop5.static.php                           30-Sep-2022 11:10               10249
language.oop5.traits.php                           30-Sep-2022 11:10               35567
language.oop5.variance.php                         30-Sep-2022 11:10               17608
language.oop5.visibility.php                       30-Sep-2022 11:10               29361
language.operators.arithmetic.php                  30-Sep-2022 11:10                6467
language.operators.array.php                       30-Sep-2022 11:10                9264
language.operators.assignment.php                  30-Sep-2022 11:10               12167
language.operators.bitwise.php                     30-Sep-2022 11:10               47443
language.operators.comparison.php                  30-Sep-2022 11:10               43993
language.operators.errorcontrol.php                30-Sep-2022 11:10                6079
language.operators.execution.php                   30-Sep-2022 11:10                3557
language.operators.increment.php                   30-Sep-2022 11:10               11600
language.operators.logical.php                     30-Sep-2022 11:10                7946
language.operators.php                             30-Sep-2022 11:10                3858
language.operators.precedence.php                  30-Sep-2022 11:10               21116
language.operators.string.php                      30-Sep-2022 11:10                3253
language.operators.type.php                        30-Sep-2022 11:10               19165
language.references.arent.php                      30-Sep-2022 11:10                3386
language.references.pass.php                       30-Sep-2022 11:10                7329
language.references.php                            30-Sep-2022 11:10                1987
language.references.return.php                     30-Sep-2022 11:10                7952
language.references.spot.php                       30-Sep-2022 11:10                2710
language.references.unset.php                      30-Sep-2022 11:10                2516
language.references.whatare.php                    30-Sep-2022 11:10                2027
language.references.whatdo.php                     30-Sep-2022 11:10               19608
language.types.array.php                           30-Sep-2022 11:10              109324
language.types.boolean.php                         30-Sep-2022 11:10                9458
language.types.callable.php                        30-Sep-2022 11:10               12909
language.types.declarations.php                    30-Sep-2022 11:10               53518
language.types.enumerations.php                    30-Sep-2022 11:10                3697
language.types.float.php                           30-Sep-2022 11:10                9242
language.types.integer.php                         30-Sep-2022 11:10               20372
language.types.intro.php                           30-Sep-2022 11:10                7714
language.types.iterable.php                        30-Sep-2022 11:10                7038
language.types.null.php                            30-Sep-2022 11:10                3583
language.types.numeric-strings.php                 30-Sep-2022 11:10               10554
language.types.object.php                          30-Sep-2022 11:10                5999
language.types.php                                 30-Sep-2022 11:10                2347
language.types.resource.php                        30-Sep-2022 11:10                2940
language.types.string.php                          30-Sep-2022 11:10               82800
language.types.type-juggling.php                   30-Sep-2022 11:10               18900
language.variables.basics.php                      30-Sep-2022 11:10               15822
language.variables.external.php                    30-Sep-2022 11:10               17879
language.variables.php                             30-Sep-2022 11:10                1727
language.variables.predefined.php                  30-Sep-2022 11:10                3042
language.variables.scope.php                       30-Sep-2022 11:10               29830
language.variables.superglobals.php                30-Sep-2022 11:10                4562
language.variables.variable.php                    30-Sep-2022 11:10               10484
ldap.configuration.php                             30-Sep-2022 11:11                2357
ldap.constants.php                                 30-Sep-2022 11:11               24578
ldap.controls.php                                  30-Sep-2022 11:11                8686
ldap.examples-basic.php                            30-Sep-2022 11:11                9414
ldap.examples-controls.php                         30-Sep-2022 11:11               18982
ldap.examples.php                                  30-Sep-2022 11:11                1372
ldap.installation.php                              30-Sep-2022 11:11                2864
ldap.requirements.php                              30-Sep-2022 11:11                1473
ldap.resources.php                                 30-Sep-2022 11:11                1403
ldap.setup.php                                     30-Sep-2022 11:11                1550
ldap.using.php                                     30-Sep-2022 11:11                2180
libxml.configuration.php                           30-Sep-2022 11:11                1257
libxml.constants.php                               30-Sep-2022 11:11               10483
libxml.installation.php                            30-Sep-2022 11:11                2501
libxml.requirements.php                            30-Sep-2022 11:11                1224
libxml.resources.php                               30-Sep-2022 11:11                1208
libxml.setup.php                                   30-Sep-2022 11:11                1565
limititerator.construct.php                        30-Sep-2022 11:11                7296
limititerator.current.php                          30-Sep-2022 11:11                3596
limititerator.getinneriterator.php                 30-Sep-2022 11:11                3127
limititerator.getposition.php                      30-Sep-2022 11:11                5946
limititerator.key.php                              30-Sep-2022 11:11                3702
limititerator.next.php                             30-Sep-2022 11:11                3303
limititerator.rewind.php                           30-Sep-2022 11:11                3471
limititerator.seek.php                             30-Sep-2022 11:11                4053
limititerator.valid.php                            30-Sep-2022 11:11                3399
locale.acceptfromhttp.php                          30-Sep-2022 11:10                5871
locale.canonicalize.php                            30-Sep-2022 11:10                2832
locale.composelocale.php                           30-Sep-2022 11:10               13949
locale.filtermatches.php                           30-Sep-2022 11:10                8833
locale.getallvariants.php                          30-Sep-2022 11:10                6224
locale.getdefault.php                              30-Sep-2022 11:10                6009
locale.getdisplaylanguage.php                      30-Sep-2022 11:10                9515
locale.getdisplayname.php                          30-Sep-2022 11:10                9537
locale.getdisplayregion.php                        30-Sep-2022 11:10                9497
locale.getdisplayscript.php                        30-Sep-2022 11:10                9510
locale.getdisplayvariant.php                       30-Sep-2022 11:10                9559
locale.getkeywords.php                             30-Sep-2022 11:10                7033
locale.getprimarylanguage.php                      30-Sep-2022 11:10                5707
locale.getregion.php                               30-Sep-2022 11:10                5619
locale.getscript.php                               30-Sep-2022 11:10                5421
locale.lookup.php                                  30-Sep-2022 11:10                9419
locale.parselocale.php                             30-Sep-2022 11:10                7372
locale.setdefault.php                              30-Sep-2022 11:10                5154
lua.assign.php                                     30-Sep-2022 11:10                4517
lua.call.php                                       30-Sep-2022 11:10                7392
lua.configuration.php                              30-Sep-2022 11:10                1236
lua.construct.php                                  30-Sep-2022 11:10                2305
lua.eval.php                                       30-Sep-2022 11:10                3627
lua.getversion.php                                 30-Sep-2022 11:10                2173
lua.include.php                                    30-Sep-2022 11:10                2547
lua.installation.php                               30-Sep-2022 11:10                1944
lua.registercallback.php                           30-Sep-2022 11:10                4464
lua.requirements.php                               30-Sep-2022 11:10                1236
lua.resources.php                                  30-Sep-2022 11:10                1187
lua.setup.php                                      30-Sep-2022 11:10                1510
luaclosure.invoke.php                              30-Sep-2022 11:10                4207
luasandbox.callfunction.php                        30-Sep-2022 11:10                4879
luasandbox.configuration.php                       30-Sep-2022 11:10                1285
luasandbox.disableprofiler.php                     30-Sep-2022 11:10                2844
luasandbox.enableprofiler.php                      30-Sep-2022 11:10                3398
luasandbox.examples-basic.php                      30-Sep-2022 11:10                7413
luasandbox.examples.php                            30-Sep-2022 11:10                1432
luasandbox.getcpuusage.php                         30-Sep-2022 11:10                3582
luasandbox.getmemoryusage.php                      30-Sep-2022 11:10                3157
luasandbox.getpeakmemoryusage.php                  30-Sep-2022 11:10                3207
luasandbox.getprofilerfunctionreport.php           30-Sep-2022 11:10                5650
luasandbox.getversioninfo.php                      30-Sep-2022 11:10                2898
luasandbox.installation.php                        30-Sep-2022 11:10                2045
luasandbox.loadbinary.php                          30-Sep-2022 11:10                3513
luasandbox.loadstring.php                          30-Sep-2022 11:10                5627
luasandbox.pauseusagetimer.php                     30-Sep-2022 11:10               10283
luasandbox.registerlibrary.php                     30-Sep-2022 11:10                6884
luasandbox.requirements.php                        30-Sep-2022 11:10                1722
luasandbox.resources.php                           30-Sep-2022 11:10                1252
luasandbox.setcpulimit.php                         30-Sep-2022 11:10                5997
luasandbox.setmemorylimit.php                      30-Sep-2022 11:10                5647
luasandbox.setup.php                               30-Sep-2022 11:10                1601
luasandbox.unpauseusagetimer.php                   30-Sep-2022 11:10                3140
luasandbox.wrapphpfunction.php                     30-Sep-2022 11:10                4331
luasandboxfunction.call.php                        30-Sep-2022 11:10                6851
luasandboxfunction.construct.php                   30-Sep-2022 11:10                2654
luasandboxfunction.dump.php                        30-Sep-2022 11:10                2357
lzf.configuration.php                              30-Sep-2022 11:10                1236
lzf.constants.php                                  30-Sep-2022 11:10                1115
lzf.installation.php                               30-Sep-2022 11:10                2687
lzf.requirements.php                               30-Sep-2022 11:10                1143
lzf.resources.php                                  30-Sep-2022 11:10                1187
lzf.setup.php                                      30-Sep-2022 11:10                1533
magick.getimagescene.php                           30-Sep-2022 11:10                2486
magick.stripimage.php                              30-Sep-2022 11:10                2487
mail.configuration.php                             30-Sep-2022 11:10                7883
mail.constants.php                                 30-Sep-2022 11:10                1126
mail.installation.php                              30-Sep-2022 11:10                1206
mail.requirements.php                              30-Sep-2022 11:10                2074
mail.resources.php                                 30-Sep-2022 11:10                1194
mail.setup.php                                     30-Sep-2022 11:10                1544
mailparse.configuration.php                        30-Sep-2022 11:10                2484
mailparse.constants.php                            30-Sep-2022 11:10                1972
mailparse.installation.php                         30-Sep-2022 11:10                2410
mailparse.requirements.php                         30-Sep-2022 11:10                1185
mailparse.resources.php                            30-Sep-2022 11:10                1546
mailparse.setup.php                                30-Sep-2022 11:10                1609
manual.php                                         30-Sep-2022 11:10                1252
math.configuration.php                             30-Sep-2022 11:10                1243
math.constants.php                                 30-Sep-2022 11:10                5999
math.installation.php                              30-Sep-2022 11:10                1206
math.requirements.php                              30-Sep-2022 11:10                1150
math.resources.php                                 30-Sep-2022 11:10                1194
math.setup.php                                     30-Sep-2022 11:10                1539
mbstring.configuration.php                         30-Sep-2022 11:10               15098
mbstring.constants.php                             30-Sep-2022 11:10                5551
mbstring.encodings.php                             30-Sep-2022 11:10               15733
mbstring.http.php                                  30-Sep-2022 11:10                5497
mbstring.installation.php                          30-Sep-2022 11:10                3498
mbstring.ja-basic.php                              30-Sep-2022 11:10                3765
mbstring.overload.php                              30-Sep-2022 11:10                7551
mbstring.php4.req.php                              30-Sep-2022 11:10                4084
mbstring.requirements.php                          30-Sep-2022 11:10                1178
mbstring.resources.php                             30-Sep-2022 11:10                1222
mbstring.setup.php                                 30-Sep-2022 11:10                1603
mbstring.supported-encodings.php                   30-Sep-2022 11:10                8344
mcrypt.ciphers.php                                 30-Sep-2022 11:10                6507
mcrypt.configuration.php                           30-Sep-2022 11:10                3556
mcrypt.constants.php                               30-Sep-2022 11:10                5980
mcrypt.installation.php                            30-Sep-2022 11:10                1745
mcrypt.requirements.php                            30-Sep-2022 11:10                2162
mcrypt.resources.php                               30-Sep-2022 11:10                1326
mcrypt.setup.php                                   30-Sep-2022 11:10                1578
memcache.add.php                                   30-Sep-2022 11:11                6954
memcache.addserver.php                             30-Sep-2022 11:11               13187
memcache.close.php                                 30-Sep-2022 11:11                5130
memcache.connect.php                               30-Sep-2022 11:11                7204
memcache.constants.php                             30-Sep-2022 11:11                4241
memcache.decrement.php                             30-Sep-2022 11:11                7219
memcache.delete.php                                30-Sep-2022 11:11                6405
memcache.examples-overview.php                     30-Sep-2022 11:11                6722
memcache.examples.php                              30-Sep-2022 11:11                1366
memcache.flush.php                                 30-Sep-2022 11:11                4481
memcache.get.php                                   30-Sep-2022 11:11                8633
memcache.getextendedstats.php                      30-Sep-2022 11:11                8036
memcache.getserverstatus.php                       30-Sep-2022 11:11                6129
memcache.getstats.php                              30-Sep-2022 11:11                4548
memcache.getversion.php                            30-Sep-2022 11:11                5010
memcache.increment.php                             30-Sep-2022 11:11                7012
memcache.ini.php                                   30-Sep-2022 11:11                9675
memcache.installation.php                          30-Sep-2022 11:11                2060
memcache.pconnect.php                              30-Sep-2022 11:11                6191
memcache.replace.php                               30-Sep-2022 11:11                7057
memcache.requirements.php                          30-Sep-2022 11:11                1312
memcache.resources.php                             30-Sep-2022 11:11                1284
memcache.set.php                                   30-Sep-2022 11:11                9669
memcache.setcompressthreshold.php                  30-Sep-2022 11:11                5833
memcache.setserverparams.php                       30-Sep-2022 11:11               10896
memcache.setup.php                                 30-Sep-2022 11:11                1591
memcached.add.php                                  30-Sep-2022 11:11                4418
memcached.addbykey.php                             30-Sep-2022 11:11                5304
memcached.addserver.php                            30-Sep-2022 11:11                7257
memcached.addservers.php                           30-Sep-2022 11:11                5334
memcached.append.php                               30-Sep-2022 11:11                6781
memcached.appendbykey.php                          30-Sep-2022 11:11                4446
memcached.callbacks.php                            30-Sep-2022 11:11                1469
memcached.callbacks.read-through.php               30-Sep-2022 11:11                4558
memcached.callbacks.result.php                     30-Sep-2022 11:11                4998
memcached.cas.php                                  30-Sep-2022 11:11                9684
memcached.casbykey.php                             30-Sep-2022 11:11                5337
memcached.configuration.php                        30-Sep-2022 11:11               23159
memcached.constants.php                            30-Sep-2022 11:11               22286
memcached.construct.php                            30-Sep-2022 11:11                4414
memcached.decrement.php                            30-Sep-2022 11:11                8922
memcached.decrementbykey.php                       30-Sep-2022 11:11                5599
memcached.delete.php                               30-Sep-2022 11:11                5803
memcached.deletebykey.php                          30-Sep-2022 11:11                4707
memcached.deletemulti.php                          30-Sep-2022 11:11                4841
memcached.deletemultibykey.php                     30-Sep-2022 11:11                4770
memcached.expiration.php                           30-Sep-2022 11:11                1880
memcached.fetch.php                                30-Sep-2022 11:11                6549
memcached.fetchall.php                             30-Sep-2022 11:11                6483
memcached.flush.php                                30-Sep-2022 11:11                4557
memcached.get.php                                  30-Sep-2022 11:11               10126
memcached.getallkeys.php                           30-Sep-2022 11:11                2700
memcached.getbykey.php                             30-Sep-2022 11:11                6001
memcached.getdelayed.php                           30-Sep-2022 11:11                8342
memcached.getdelayedbykey.php                      30-Sep-2022 11:11                5187
memcached.getmulti.php                             30-Sep-2022 11:11               21152
memcached.getmultibykey.php                        30-Sep-2022 11:11                5324
memcached.getoption.php                            30-Sep-2022 11:11                5128
memcached.getresultcode.php                        30-Sep-2022 11:11                4257
memcached.getresultmessage.php                     30-Sep-2022 11:11                4652
memcached.getserverbykey.php                       30-Sep-2022 11:11                7190
memcached.getserverlist.php                        30-Sep-2022 11:11                4583
memcached.getstats.php                             30-Sep-2022 11:11                5067
memcached.getversion.php                           30-Sep-2022 11:11                3800
memcached.increment.php                            30-Sep-2022 11:11                8242
memcached.incrementbykey.php                       30-Sep-2022 11:11                5532
memcached.installation.php                         30-Sep-2022 11:11                2564
memcached.ispersistent.php                         30-Sep-2022 11:11                2778
memcached.ispristine.php                           30-Sep-2022 11:11                2709
memcached.prepend.php                              30-Sep-2022 11:11                6815
memcached.prependbykey.php                         30-Sep-2022 11:11                4478
memcached.quit.php                                 30-Sep-2022 11:11                2271
memcached.replace.php                              30-Sep-2022 11:11                4490
memcached.replacebykey.php                         30-Sep-2022 11:11                5391
memcached.requirements.php                         30-Sep-2022 11:11                1486
memcached.resetserverlist.php                      30-Sep-2022 11:11                3019
memcached.resources.php                            30-Sep-2022 11:11                1229
memcached.sessions.php                             30-Sep-2022 11:11                2265
memcached.set.php                                  30-Sep-2022 11:11                9045
memcached.setbykey.php                             30-Sep-2022 11:11                6861
memcached.setmulti.php                             30-Sep-2022 11:11                6172
memcached.setmultibykey.php                        30-Sep-2022 11:11                4671
memcached.setoption.php                            30-Sep-2022 11:11                7281
memcached.setoptions.php                           30-Sep-2022 11:11                6845
memcached.setsaslauthdata.php                      30-Sep-2022 11:11                3169
memcached.setup.php                                30-Sep-2022 11:11                1609
memcached.touch.php                                30-Sep-2022 11:11                3498
memcached.touchbykey.php                           30-Sep-2022 11:11                4339
messageformatter.create.php                        30-Sep-2022 11:10               11222
messageformatter.format.php                        30-Sep-2022 11:10               10133
messageformatter.formatmessage.php                 30-Sep-2022 11:10               10343
messageformatter.geterrorcode.php                  30-Sep-2022 11:10                3973
messageformatter.geterrormessage.php               30-Sep-2022 11:10                7880
messageformatter.getlocale.php                     30-Sep-2022 11:10                5453
messageformatter.getpattern.php                    30-Sep-2022 11:10               10560
messageformatter.parse.php                         30-Sep-2022 11:10               10400
messageformatter.parsemessage.php                  30-Sep-2022 11:10               10393
messageformatter.setpattern.php                    30-Sep-2022 11:10               11030
mhash.configuration.php                            30-Sep-2022 11:10                1250
mhash.constants.php                                30-Sep-2022 11:10                4917
mhash.examples.php                                 30-Sep-2022 11:10                3465
mhash.installation.php                             30-Sep-2022 11:10                1567
mhash.requirements.php                             30-Sep-2022 11:10                1286
mhash.resources.php                                30-Sep-2022 11:10                1201
mhash.setup.php                                    30-Sep-2022 11:10                1558
migration56.changed-functions.php                  30-Sep-2022 11:11                6583
migration56.constants.php                          30-Sep-2022 11:11                5200
migration56.deprecated.php                         30-Sep-2022 11:11                6100
migration56.extensions.php                         30-Sep-2022 11:11                4313
migration56.incompatible.php                       30-Sep-2022 11:11                8545
migration56.new-features.php                       30-Sep-2022 11:11               30987
migration56.new-functions.php                      30-Sep-2022 11:11                7495
migration56.openssl.php                            30-Sep-2022 11:11               26261
migration56.php                                    30-Sep-2022 11:11                2418
migration70.changed-functions.php                  30-Sep-2022 11:11                5189
migration70.classes.php                            30-Sep-2022 11:11                3875
migration70.constants.php                          30-Sep-2022 11:11                7052
migration70.deprecated.php                         30-Sep-2022 11:11                5837
migration70.incompatible.php                       30-Sep-2022 11:11               62017
migration70.new-features.php                       30-Sep-2022 11:11               43717
migration70.new-functions.php                      30-Sep-2022 11:11                7376
migration70.other-changes.php                      30-Sep-2022 11:11                3451
migration70.php                                    30-Sep-2022 11:11                2798
migration70.removed-exts-sapis.php                 30-Sep-2022 11:11                3129
migration70.sapi-changes.php                       30-Sep-2022 11:11                1974
migration71.changed-functions.php                  30-Sep-2022 11:11                7194
migration71.constants.php                          30-Sep-2022 11:11                7188
migration71.deprecated.php                         30-Sep-2022 11:11                2246
migration71.incompatible.php                       30-Sep-2022 11:11               31714
migration71.new-features.php                       30-Sep-2022 11:11               28580
migration71.new-functions.php                      30-Sep-2022 11:11                5030
migration71.other-changes.php                      30-Sep-2022 11:11                8162
migration71.php                                    30-Sep-2022 11:11                2494
migration71.windows-support.php                    30-Sep-2022 11:11                7125
migration72.constants.php                          30-Sep-2022 11:11               24658
migration72.deprecated.php                         30-Sep-2022 11:11               10171
migration72.incompatible.php                       30-Sep-2022 11:11               19612
migration72.new-features.php                       30-Sep-2022 11:11               18542
migration72.new-functions.php                      30-Sep-2022 11:11               24374
migration72.other-changes.php                      30-Sep-2022 11:11                5655
migration72.php                                    30-Sep-2022 11:11                2394
migration73.constants.php                          30-Sep-2022 11:11               17677
migration73.deprecated.php                         30-Sep-2022 11:11                8452
migration73.incompatible.php                       30-Sep-2022 11:11               18425
migration73.new-features.php                       30-Sep-2022 11:11               16096
migration73.new-functions.php                      30-Sep-2022 11:11                7351
migration73.other-changes.php                      30-Sep-2022 11:11               15458
migration73.php                                    30-Sep-2022 11:11                2512
migration73.windows-support.php                    30-Sep-2022 11:11                1801
migration74.constants.php                          30-Sep-2022 11:11                5845
migration74.deprecated.php                         30-Sep-2022 11:11               15331
migration74.incompatible.php                       30-Sep-2022 11:11               17106
migration74.new-classes.php                        30-Sep-2022 11:11                1481
migration74.new-features.php                       30-Sep-2022 11:11               22478
migration74.new-functions.php                      30-Sep-2022 11:11                3697
migration74.other-changes.php                      30-Sep-2022 11:11               21106
migration74.php                                    30-Sep-2022 11:11                2728
migration74.removed-extensions.php                 30-Sep-2022 11:11                1889
migration74.windows-support.php                    30-Sep-2022 11:11                3754
migration80.deprecated.php                         30-Sep-2022 11:11               19184
migration80.incompatible.php                       30-Sep-2022 11:11               96867
migration80.new-features.php                       30-Sep-2022 11:11               32952
migration80.other-changes.php                      30-Sep-2022 11:11               14803
migration80.php                                    30-Sep-2022 11:11                2381
migration81.constants.php                          30-Sep-2022 11:11                6172
migration81.deprecated.php                         30-Sep-2022 11:11               17824
migration81.incompatible.php                       30-Sep-2022 11:11               22563
migration81.new-classes.php                        30-Sep-2022 11:11                2117
migration81.new-features.php                       30-Sep-2022 11:11               23403
migration81.new-functions.php                      30-Sep-2022 11:11                8457
migration81.other-changes.php                      30-Sep-2022 11:11                9551
migration81.php                                    30-Sep-2022 11:11                2601
migration82.constants.php                          30-Sep-2022 11:11               16108
migration82.deprecated.php                         30-Sep-2022 11:11                6000
migration82.incompatible.php                       30-Sep-2022 11:11                8083
migration82.new-features.php                       30-Sep-2022 11:11                6780
migration82.new-functions.php                      30-Sep-2022 11:11                3401
migration82.other-changes.php                      30-Sep-2022 11:11               24917
migration82.php                                    30-Sep-2022 11:11                2652
migration82.windows-support.php                    30-Sep-2022 11:11                2291
misc.configuration.php                             30-Sep-2022 11:10                5351
misc.constants.php                                 30-Sep-2022 11:10                2116
misc.installation.php                              30-Sep-2022 11:10                1206
misc.requirements.php                              30-Sep-2022 11:10                1150
misc.resources.php                                 30-Sep-2022 11:10                1194
misc.setup.php                                     30-Sep-2022 11:10                1528
mongodb-bson-binary.construct.php                  30-Sep-2022 11:10                7084
mongodb-bson-binary.getdata.php                    30-Sep-2022 11:10                4656
mongodb-bson-binary.gettype.php                    30-Sep-2022 11:10                4640
mongodb-bson-binary.jsonserialize.php              30-Sep-2022 11:10                5521
mongodb-bson-binary.serialize.php                  30-Sep-2022 11:10                3480
mongodb-bson-binary.tostring.php                   30-Sep-2022 11:10                4445
mongodb-bson-binary.unserialize.php                30-Sep-2022 11:10                4329
mongodb-bson-binaryinterface.getdata.php           30-Sep-2022 11:10                2778
mongodb-bson-binaryinterface.gettype.php           30-Sep-2022 11:10                2790
mongodb-bson-binaryinterface.tostring.php          30-Sep-2022 11:10                3269
mongodb-bson-dbpointer.construct.php               30-Sep-2022 11:10                2662
mongodb-bson-dbpointer.jsonserialize.php           30-Sep-2022 11:10                5590
mongodb-bson-dbpointer.serialize.php               30-Sep-2022 11:10                3555
mongodb-bson-dbpointer.tostring.php                30-Sep-2022 11:10                2620
mongodb-bson-dbpointer.unserialize.php             30-Sep-2022 11:10                3798
mongodb-bson-decimal128.construct.php              30-Sep-2022 11:10                6145
mongodb-bson-decimal128.jsonserialize.php          30-Sep-2022 11:10                5611
mongodb-bson-decimal128.serialize.php              30-Sep-2022 11:10                3580
mongodb-bson-decimal128.tostring.php               30-Sep-2022 11:10                4944
mongodb-bson-decimal128.unserialize.php            30-Sep-2022 11:10                4421
mongodb-bson-decimal128interface.tostring.php      30-Sep-2022 11:10                2941
mongodb-bson-int64.construct.php                   30-Sep-2022 11:10                2610
mongodb-bson-int64.jsonserialize.php               30-Sep-2022 11:10                5265
mongodb-bson-int64.serialize.php                   30-Sep-2022 11:10                3457
mongodb-bson-int64.tostring.php                    30-Sep-2022 11:10                3848
mongodb-bson-int64.unserialize.php                 30-Sep-2022 11:10                4300
mongodb-bson-javascript.construct.php              30-Sep-2022 11:10                7184
mongodb-bson-javascript.getcode.php                30-Sep-2022 11:10                4504
mongodb-bson-javascript.getscope.php               30-Sep-2022 11:10                5572
mongodb-bson-javascript.jsonserialize.php          30-Sep-2022 11:10                5607
mongodb-bson-javascript.serialize.php              30-Sep-2022 11:10                3580
mongodb-bson-javascript.tostring.php               30-Sep-2022 11:10                4315
mongodb-bson-javascript.unserialize.php            30-Sep-2022 11:10                4413
mongodb-bson-javascriptinterface.getcode.php       30-Sep-2022 11:10                2872
mongodb-bson-javascriptinterface.getscope.php      30-Sep-2022 11:10                2981
mongodb-bson-javascriptinterface.tostring.php      30-Sep-2022 11:10                3367
mongodb-bson-maxkey.construct.php                  30-Sep-2022 11:10                3783
mongodb-bson-maxkey.jsonserialize.php              30-Sep-2022 11:10                5527
mongodb-bson-maxkey.serialize.php                  30-Sep-2022 11:10                3484
mongodb-bson-maxkey.unserialize.php                30-Sep-2022 11:10                3731
mongodb-bson-minkey.construct.php                  30-Sep-2022 11:10                3783
mongodb-bson-minkey.jsonserialize.php              30-Sep-2022 11:10                5527
mongodb-bson-minkey.serialize.php                  30-Sep-2022 11:10                3484
mongodb-bson-minkey.unserialize.php                30-Sep-2022 11:10                3735
mongodb-bson-objectid.construct.php                30-Sep-2022 11:10                5400
mongodb-bson-objectid.gettimestamp.php             30-Sep-2022 11:10                5745
mongodb-bson-objectid.jsonserialize.php            30-Sep-2022 11:10                5573
mongodb-bson-objectid.serialize.php                30-Sep-2022 11:10                3532
mongodb-bson-objectid.tostring.php                 30-Sep-2022 11:10                4436
mongodb-bson-objectid.unserialize.php              30-Sep-2022 11:10                4367
mongodb-bson-objectidinterface.gettimestamp.php    30-Sep-2022 11:10                2943
mongodb-bson-objectidinterface.tostring.php        30-Sep-2022 11:10                2925
mongodb-bson-regex.construct.php                   30-Sep-2022 11:10                6979
mongodb-bson-regex.getflags.php                    30-Sep-2022 11:10                4619
mongodb-bson-regex.getpattern.php                  30-Sep-2022 11:10                4466
mongodb-bson-regex.jsonserialize.php               30-Sep-2022 11:10                5506
mongodb-bson-regex.serialize.php                   30-Sep-2022 11:10                3455
mongodb-bson-regex.tostring.php                    30-Sep-2022 11:10                3980
mongodb-bson-regex.unserialize.php                 30-Sep-2022 11:10                4304
mongodb-bson-regexinterface.getflags.php           30-Sep-2022 11:10                2777
mongodb-bson-regexinterface.getpattern.php         30-Sep-2022 11:10                2820
mongodb-bson-regexinterface.tostring.php           30-Sep-2022 11:10                2851
mongodb-bson-serializable.bsonserialize.php        30-Sep-2022 11:10               16212
mongodb-bson-symbol.construct.php                  30-Sep-2022 11:10                2602
mongodb-bson-symbol.jsonserialize.php              30-Sep-2022 11:10                5527
mongodb-bson-symbol.serialize.php                  30-Sep-2022 11:10                3480
mongodb-bson-symbol.tostring.php                   30-Sep-2022 11:10                2598
mongodb-bson-symbol.unserialize.php                30-Sep-2022 11:10                3737
mongodb-bson-timestamp.construct.php               30-Sep-2022 11:10                4757
mongodb-bson-timestamp.getincrement.php            30-Sep-2022 11:10                4265
mongodb-bson-timestamp.gettimestamp.php            30-Sep-2022 11:10                4250
mongodb-bson-timestamp.jsonserialize.php           30-Sep-2022 11:10                5594
mongodb-bson-timestamp.serialize.php               30-Sep-2022 11:10                3555
mongodb-bson-timestamp.tostring.php                30-Sep-2022 11:10                4124
mongodb-bson-timestamp.unserialize.php             30-Sep-2022 11:10                4400
mongodb-bson-timestampinterface.getincrement.php   30-Sep-2022 11:10                3306
mongodb-bson-timestampinterface.gettimestamp.php   30-Sep-2022 11:10                3321
mongodb-bson-timestampinterface.tostring.php       30-Sep-2022 11:10                2943
mongodb-bson-undefined.construct.php               30-Sep-2022 11:10                2662
mongodb-bson-undefined.jsonserialize.php           30-Sep-2022 11:10                5590
mongodb-bson-undefined.serialize.php               30-Sep-2022 11:10                3555
mongodb-bson-undefined.tostring.php                30-Sep-2022 11:10                2620
mongodb-bson-undefined.unserialize.php             30-Sep-2022 11:10                3799
mongodb-bson-unserializable.bsonunserialize.php    30-Sep-2022 11:10                7563
mongodb-bson-utcdatetime.construct.php             30-Sep-2022 11:10                8132
mongodb-bson-utcdatetime.jsonserialize.php         30-Sep-2022 11:10                5632
mongodb-bson-utcdatetime.serialize.php             30-Sep-2022 11:10                3607
mongodb-bson-utcdatetime.todatetime.php            30-Sep-2022 11:10                6000
mongodb-bson-utcdatetime.tostring.php              30-Sep-2022 11:10                4073
mongodb-bson-utcdatetime.unserialize.php           30-Sep-2022 11:10                4432
mongodb-bson-utcdatetimeinterface.todatetime.php   30-Sep-2022 11:10                3280
mongodb-bson-utcdatetimeinterface.tostring.php     30-Sep-2022 11:10                2959
mongodb-driver-bulkwrite.construct.php             30-Sep-2022 11:10               20288
mongodb-driver-bulkwrite.count.php                 30-Sep-2022 11:10                7107
mongodb-driver-bulkwrite.delete.php                30-Sep-2022 11:10               11560
mongodb-driver-bulkwrite.insert.php                30-Sep-2022 11:10               10083
mongodb-driver-bulkwrite.update.php                30-Sep-2022 11:10               14817
mongodb-driver-clientencryption.construct.php      30-Sep-2022 11:10                8627
mongodb-driver-clientencryption.createdatakey.php  30-Sep-2022 11:10               10231
mongodb-driver-clientencryption.decrypt.php        30-Sep-2022 11:10                4274
mongodb-driver-clientencryption.encrypt.php        30-Sep-2022 11:10                9899
mongodb-driver-command.construct.php               30-Sep-2022 11:10               15422
mongodb-driver-commandexception.getresultdocume..> 30-Sep-2022 11:10                3193
mongodb-driver-cursor.construct.php                30-Sep-2022 11:10                3381
mongodb-driver-cursor.current.php                  30-Sep-2022 11:10                2887
mongodb-driver-cursor.getid.php                    30-Sep-2022 11:10                8354
mongodb-driver-cursor.getserver.php                30-Sep-2022 11:10                8002
mongodb-driver-cursor.isdead.php                   30-Sep-2022 11:10               11121
mongodb-driver-cursor.key.php                      30-Sep-2022 11:10                2612
mongodb-driver-cursor.next.php                     30-Sep-2022 11:10                3529
mongodb-driver-cursor.rewind.php                   30-Sep-2022 11:10                3945
mongodb-driver-cursor.settypemap.php               30-Sep-2022 11:10                8422
mongodb-driver-cursor.toarray.php                  30-Sep-2022 11:10                8099
mongodb-driver-cursor.valid.php                    30-Sep-2022 11:10                2686
mongodb-driver-cursorid.construct.php              30-Sep-2022 11:10                2824
mongodb-driver-cursorid.serialize.php              30-Sep-2022 11:10                3578
mongodb-driver-cursorid.tostring.php               30-Sep-2022 11:10                7531
mongodb-driver-cursorid.unserialize.php            30-Sep-2022 11:10                4439
mongodb-driver-cursorinterface.getid.php           30-Sep-2022 11:10                4060
mongodb-driver-cursorinterface.getserver.php       30-Sep-2022 11:10                4146
mongodb-driver-cursorinterface.isdead.php          30-Sep-2022 11:10                3992
mongodb-driver-cursorinterface.settypemap.php      30-Sep-2022 11:10                4007
mongodb-driver-cursorinterface.toarray.php         30-Sep-2022 11:10                3892
mongodb-driver-manager.addsubscriber.php           30-Sep-2022 11:10                5132
mongodb-driver-manager.construct.php               30-Sep-2022 11:10               73335
mongodb-driver-manager.createclientencryption.php  30-Sep-2022 11:10               10371
mongodb-driver-manager.executebulkwrite.php        30-Sep-2022 11:10               24043
mongodb-driver-manager.executecommand.php          30-Sep-2022 11:10               26428
mongodb-driver-manager.executequery.php            30-Sep-2022 11:10               17213
mongodb-driver-manager.executereadcommand.php      30-Sep-2022 11:10               10150
mongodb-driver-manager.executereadwritecommand.php 30-Sep-2022 11:10               11141
mongodb-driver-manager.executewritecommand.php     30-Sep-2022 11:10               11221
mongodb-driver-manager.getencryptedfieldsmap.php   30-Sep-2022 11:10                3703
mongodb-driver-manager.getreadconcern.php          30-Sep-2022 11:10                6232
mongodb-driver-manager.getreadpreference.php       30-Sep-2022 11:10                6827
mongodb-driver-manager.getservers.php              30-Sep-2022 11:10                8146
mongodb-driver-manager.getwriteconcern.php         30-Sep-2022 11:10                6285
mongodb-driver-manager.removesubscriber.php        30-Sep-2022 11:10                4992
mongodb-driver-manager.selectserver.php            30-Sep-2022 11:10                7075
mongodb-driver-manager.startsession.php            30-Sep-2022 11:10               11894
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                3672
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                3767
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                3656
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                4829
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                3966
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                4238
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                4224
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                3865
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:10                3707
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:10                3973
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:10                3704
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:10                3606
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:10                5153
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:10                4714
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:10                4530
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:10                3885
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:10                3727
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:10                4954
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:10                5004
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:10                5019
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:10                3729
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:10                3836
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:10                4916
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:10                4023
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:10                4301
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:10                4759
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:10                3925
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:10                3753
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:10                4822
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:10                4792
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:10                5359
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:10                5404
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:10                5435
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:10                4822
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:10                4897
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:10                4834
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:10                4817
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:10                3119
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:10                3495
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:10                3189
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:10                3572
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:10                3295
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:10                3081
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:10                3133
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:10                3251
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:10                3569
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:10                3479
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:10                3256
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:10                3287
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:10                3538
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:10                3261
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:10                3305
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:10                3558
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:10                3621
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:10                3328
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:10                3339
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:10                4160
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:10                3574
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:10                3099
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:10                3151
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:10                3283
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:10                3564
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:10                3642
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:10                3303
mongodb-driver-monitoring-topologyclosedevent.g..> 30-Sep-2022 11:10                3248
mongodb-driver-monitoring-topologyopeningevent...> 30-Sep-2022 11:10                3258
mongodb-driver-query.construct.php                 30-Sep-2022 11:10               31493
mongodb-driver-readconcern.bsonserialize.php       30-Sep-2022 11:10                7770
mongodb-driver-readconcern.construct.php           30-Sep-2022 11:10                6529
mongodb-driver-readconcern.getlevel.php            30-Sep-2022 11:10                6434
mongodb-driver-readconcern.isdefault.php           30-Sep-2022 11:10                8712
mongodb-driver-readconcern.serialize.php           30-Sep-2022 11:10                3655
mongodb-driver-readconcern.unserialize.php         30-Sep-2022 11:10                4490
mongodb-driver-readpreference.bsonserialize.php    30-Sep-2022 11:10               12416
mongodb-driver-readpreference.construct.php        30-Sep-2022 11:10               18284
mongodb-driver-readpreference.gethedge.php         30-Sep-2022 11:10                3324
mongodb-driver-readpreference.getmaxstalenessse..> 30-Sep-2022 11:10                9608
mongodb-driver-readpreference.getmode.php          30-Sep-2022 11:10                8953
mongodb-driver-readpreference.getmodestring.php    30-Sep-2022 11:10                9157
mongodb-driver-readpreference.gettagsets.php       30-Sep-2022 11:10                9154
mongodb-driver-readpreference.serialize.php        30-Sep-2022 11:10                3732
mongodb-driver-readpreference.unserialize.php      30-Sep-2022 11:10                4569
mongodb-driver-runtimeexception.haserrorlabel.php  30-Sep-2022 11:10                4178
mongodb-driver-server.construct.php                30-Sep-2022 11:10                3383
mongodb-driver-server.executebulkwrite.php         30-Sep-2022 11:10               11025
mongodb-driver-server.executecommand.php           30-Sep-2022 11:10               13067
mongodb-driver-server.executequery.php             30-Sep-2022 11:10                8321
mongodb-driver-server.executereadcommand.php       30-Sep-2022 11:10               10477
mongodb-driver-server.executereadwritecommand.php  30-Sep-2022 11:10               11658
mongodb-driver-server.executewritecommand.php      30-Sep-2022 11:10               11704
mongodb-driver-server.gethost.php                  30-Sep-2022 11:10                5875
mongodb-driver-server.getinfo.php                  30-Sep-2022 11:10               10911
mongodb-driver-server.getlatency.php               30-Sep-2022 11:10                7403
mongodb-driver-server.getport.php                  30-Sep-2022 11:10                5919
mongodb-driver-server.getserverdescription.php     30-Sep-2022 11:10                3419
mongodb-driver-server.gettags.php                  30-Sep-2022 11:10                3567
mongodb-driver-server.gettype.php                  30-Sep-2022 11:10                3678
mongodb-driver-server.isarbiter.php                30-Sep-2022 11:10                3492
mongodb-driver-server.ishidden.php                 30-Sep-2022 11:10                3486
mongodb-driver-server.ispassive.php                30-Sep-2022 11:10                3554
mongodb-driver-server.isprimary.php                30-Sep-2022 11:10                3499
mongodb-driver-server.issecondary.php              30-Sep-2022 11:10                3534
mongodb-driver-serverapi.bsonserialize.php         30-Sep-2022 11:10                3266
mongodb-driver-serverapi.construct.php             30-Sep-2022 11:10                3112
mongodb-driver-serverapi.serialize.php             30-Sep-2022 11:10                3608
mongodb-driver-serverapi.unserialize.php           30-Sep-2022 11:10                4457
mongodb-driver-serverdescription.gethellorespon..> 30-Sep-2022 11:10                5189
mongodb-driver-serverdescription.gethost.php       30-Sep-2022 11:10                3403
mongodb-driver-serverdescription.getlastupdatet..> 30-Sep-2022 11:10                3541
mongodb-driver-serverdescription.getport.php       30-Sep-2022 11:10                3460
mongodb-driver-serverdescription.getroundtripti..> 30-Sep-2022 11:10                3803
mongodb-driver-serverdescription.gettype.php       30-Sep-2022 11:10                3673
mongodb-driver-session.aborttransaction.php        30-Sep-2022 11:10                4237
mongodb-driver-session.advanceclustertime.php      30-Sep-2022 11:10                4773
mongodb-driver-session.advanceoperationtime.php    30-Sep-2022 11:10                4831
mongodb-driver-session.committransaction.php       30-Sep-2022 11:10                5645
mongodb-driver-session.construct.php               30-Sep-2022 11:10                2891
mongodb-driver-session.endsession.php              30-Sep-2022 11:10                4374
mongodb-driver-session.getclustertime.php          30-Sep-2022 11:10                3773
mongodb-driver-session.getlogicalsessionid.php     30-Sep-2022 11:10                3069
mongodb-driver-session.getoperationtime.php        30-Sep-2022 11:10                3913
mongodb-driver-session.getserver.php               30-Sep-2022 11:10                3786
mongodb-driver-session.gettransactionoptions.php   30-Sep-2022 11:10                3623
mongodb-driver-session.gettransactionstate.php     30-Sep-2022 11:10                3705
mongodb-driver-session.isdirty.php                 30-Sep-2022 11:10                2955
mongodb-driver-session.isintransaction.php         30-Sep-2022 11:10                3650
mongodb-driver-session.starttransaction.php        30-Sep-2022 11:10                8999
mongodb-driver-topologydescription.getservers.php  30-Sep-2022 11:10                3398
mongodb-driver-topologydescription.gettype.php     30-Sep-2022 11:10                3324
mongodb-driver-topologydescription.hasreadables..> 30-Sep-2022 11:10                3803
mongodb-driver-topologydescription.haswritables..> 30-Sep-2022 11:10                3165
mongodb-driver-writeconcern.bsonserialize.php      30-Sep-2022 11:10                8225
mongodb-driver-writeconcern.construct.php          30-Sep-2022 11:10               10667
mongodb-driver-writeconcern.getjournal.php         30-Sep-2022 11:10                6353
mongodb-driver-writeconcern.getw.php               30-Sep-2022 11:10                5549
mongodb-driver-writeconcern.getwtimeout.php        30-Sep-2022 11:10                6298
mongodb-driver-writeconcern.isdefault.php          30-Sep-2022 11:10                8211
mongodb-driver-writeconcern.serialize.php          30-Sep-2022 11:10                3680
mongodb-driver-writeconcern.unserialize.php        30-Sep-2022 11:10                4529
mongodb-driver-writeconcernerror.getcode.php       30-Sep-2022 11:10                7029
mongodb-driver-writeconcernerror.getinfo.php       30-Sep-2022 11:10                7246
mongodb-driver-writeconcernerror.getmessage.php    30-Sep-2022 11:10                7118
mongodb-driver-writeerror.getcode.php              30-Sep-2022 11:10                6193
mongodb-driver-writeerror.getindex.php             30-Sep-2022 11:10                6741
mongodb-driver-writeerror.getinfo.php              30-Sep-2022 11:10                2959
mongodb-driver-writeerror.getmessage.php           30-Sep-2022 11:10                6327
mongodb-driver-writeexception.getwriteresult.php   30-Sep-2022 11:10                8743
mongodb-driver-writeresult.getdeletedcount.php     30-Sep-2022 11:10                8463
mongodb-driver-writeresult.getinsertedcount.php    30-Sep-2022 11:10                8545
mongodb-driver-writeresult.getmatchedcount.php     30-Sep-2022 11:10                9123
mongodb-driver-writeresult.getmodifiedcount.php    30-Sep-2022 11:10                9370
mongodb-driver-writeresult.getserver.php           30-Sep-2022 11:10                7171
mongodb-driver-writeresult.getupsertedcount.php    30-Sep-2022 11:10                8700
mongodb-driver-writeresult.getupsertedids.php      30-Sep-2022 11:10                9242
mongodb-driver-writeresult.getwriteconcernerror..> 30-Sep-2022 11:10                7873
mongodb-driver-writeresult.getwriteerrors.php      30-Sep-2022 11:10               14492
mongodb-driver-writeresult.isacknowledged.php      30-Sep-2022 11:10                8831
mongodb.architecture.php                           30-Sep-2022 11:10                1922
mongodb.configuration.php                          30-Sep-2022 11:10                3920
mongodb.connection-handling.php                    30-Sep-2022 11:10                9478
mongodb.constants.php                              30-Sep-2022 11:10                1878
mongodb.exceptions.php                             30-Sep-2022 11:10                5149
mongodb.exceptions.tree.php                        30-Sep-2022 11:10                5559
mongodb.installation.homebrew.php                  30-Sep-2022 11:10                1970
mongodb.installation.manual.php                    30-Sep-2022 11:10                6532
mongodb.installation.pecl.php                      30-Sep-2022 11:10                3592
mongodb.installation.php                           30-Sep-2022 11:10                1755
mongodb.installation.windows.php                   30-Sep-2022 11:10                2998
mongodb.monitoring.php                             30-Sep-2022 11:10               18571
mongodb.overview.php                               30-Sep-2022 11:10                7234
mongodb.persistence.deserialization.php            30-Sep-2022 11:10               20739
mongodb.persistence.php                            30-Sep-2022 11:10                1804
mongodb.persistence.serialization.php              30-Sep-2022 11:10               23894
mongodb.requirements.php                           30-Sep-2022 11:10                3107
mongodb.security.php                               30-Sep-2022 11:10                1484
mongodb.security.request_injection.php             30-Sep-2022 11:10                3004
mongodb.security.script_injection.php              30-Sep-2022 11:10               10544
mongodb.setup.php                                  30-Sep-2022 11:10                2028
mongodb.tutorial.apm.php                           30-Sep-2022 11:10               24275
mongodb.tutorial.library.php                       30-Sep-2022 11:10               11315
mongodb.tutorial.php                               30-Sep-2022 11:10                1699
mqseries.configure.php                             30-Sep-2022 11:11                2759
mqseries.constants.php                             30-Sep-2022 11:11                2132
mqseries.ini.php                                   30-Sep-2022 11:11                1306
mqseries.requirements.php                          30-Sep-2022 11:11                1582
mqseries.resources.php                             30-Sep-2022 11:11                1666
mqseries.setup.php                                 30-Sep-2022 11:11                1594
multipleiterator.attachiterator.php                30-Sep-2022 11:11                4172
multipleiterator.construct.php                     30-Sep-2022 11:11                8158
multipleiterator.containsiterator.php              30-Sep-2022 11:11                3327
multipleiterator.countiterators.php                30-Sep-2022 11:11                2992
multipleiterator.current.php                       30-Sep-2022 11:11                4270
multipleiterator.detachiterator.php                30-Sep-2022 11:11                3195
multipleiterator.getflags.php                      30-Sep-2022 11:11                3160
multipleiterator.key.php                           30-Sep-2022 11:11                4136
multipleiterator.next.php                          30-Sep-2022 11:11                2813
multipleiterator.rewind.php                        30-Sep-2022 11:11                2831
multipleiterator.setflags.php                      30-Sep-2022 11:11                3468
multipleiterator.valid.php                         30-Sep-2022 11:11                2904
mysql-xdevapi-baseresult.getwarnings.php           30-Sep-2022 11:10                7050
mysql-xdevapi-baseresult.getwarningscount.php      30-Sep-2022 11:10                6782
mysql-xdevapi-client.close.php                     30-Sep-2022 11:10                2320
mysql-xdevapi-client.construct.php                 30-Sep-2022 11:10                3602
mysql-xdevapi-client.getsession.php                30-Sep-2022 11:10                2386
mysql-xdevapi-collection.add.php                   30-Sep-2022 11:10                9936
mysql-xdevapi-collection.addorreplaceone.php       30-Sep-2022 11:10                8566
mysql-xdevapi-collection.construct.php             30-Sep-2022 11:10                6791
mysql-xdevapi-collection.count.php                 30-Sep-2022 11:10                6897
mysql-xdevapi-collection.createindex.php           30-Sep-2022 11:10               10053
mysql-xdevapi-collection.dropindex.php             30-Sep-2022 11:10                6925
mysql-xdevapi-collection.existsindatabase.php      30-Sep-2022 11:10                6166
mysql-xdevapi-collection.find.php                  30-Sep-2022 11:10               10198
mysql-xdevapi-collection.getname.php               30-Sep-2022 11:10                5231
mysql-xdevapi-collection.getone.php                30-Sep-2022 11:10                7470
mysql-xdevapi-collection.getschema.php             30-Sep-2022 11:10                5438
mysql-xdevapi-collection.getsession.php            30-Sep-2022 11:10                5713
mysql-xdevapi-collection.modify.php                30-Sep-2022 11:10                8535
mysql-xdevapi-collection.remove.php                30-Sep-2022 11:10                8865
mysql-xdevapi-collection.removeone.php             30-Sep-2022 11:10                8116
mysql-xdevapi-collection.replaceone.php            30-Sep-2022 11:10                8381
mysql-xdevapi-collectionadd.construct.php          30-Sep-2022 11:10                8400
mysql-xdevapi-collectionadd.execute.php            30-Sep-2022 11:10                8379
mysql-xdevapi-collectionfind.bind.php              30-Sep-2022 11:10                8274
mysql-xdevapi-collectionfind.construct.php         30-Sep-2022 11:10                7237
mysql-xdevapi-collectionfind.execute.php           30-Sep-2022 11:10                7448
mysql-xdevapi-collectionfind.fields.php            30-Sep-2022 11:10                7876
mysql-xdevapi-collectionfind.groupby.php           30-Sep-2022 11:10                4344
mysql-xdevapi-collectionfind.having.php            30-Sep-2022 11:10                4588
mysql-xdevapi-collectionfind.limit.php             30-Sep-2022 11:10                8541
mysql-xdevapi-collectionfind.lockexclusive.php     30-Sep-2022 11:10                6708
mysql-xdevapi-collectionfind.lockshared.php        30-Sep-2022 11:10                6511
mysql-xdevapi-collectionfind.offset.php            30-Sep-2022 11:10                8288
mysql-xdevapi-collectionfind.sort.php              30-Sep-2022 11:10                8398
mysql-xdevapi-collectionmodify.arrayappend.php     30-Sep-2022 11:10                8357
mysql-xdevapi-collectionmodify.arrayinsert.php     30-Sep-2022 11:10                8776
mysql-xdevapi-collectionmodify.bind.php            30-Sep-2022 11:10                8501
mysql-xdevapi-collectionmodify.construct.php       30-Sep-2022 11:10                7137
mysql-xdevapi-collectionmodify.execute.php         30-Sep-2022 11:10                3275
mysql-xdevapi-collectionmodify.limit.php           30-Sep-2022 11:10                8952
mysql-xdevapi-collectionmodify.patch.php           30-Sep-2022 11:10                4172
mysql-xdevapi-collectionmodify.replace.php         30-Sep-2022 11:10                8174
mysql-xdevapi-collectionmodify.set.php             30-Sep-2022 11:10                8116
mysql-xdevapi-collectionmodify.skip.php            30-Sep-2022 11:10                4841
mysql-xdevapi-collectionmodify.sort.php            30-Sep-2022 11:10                4884
mysql-xdevapi-collectionmodify.unset.php           30-Sep-2022 11:10                4472
mysql-xdevapi-collectionremove.bind.php            30-Sep-2022 11:10                5133
mysql-xdevapi-collectionremove.construct.php       30-Sep-2022 11:10                7645
mysql-xdevapi-collectionremove.execute.php         30-Sep-2022 11:10                4032
mysql-xdevapi-collectionremove.limit.php           30-Sep-2022 11:10                4473
mysql-xdevapi-collectionremove.sort.php            30-Sep-2022 11:10                4551
mysql-xdevapi-columnresult.construct.php           30-Sep-2022 11:10               10009
mysql-xdevapi-columnresult.getcharactersetname.php 30-Sep-2022 11:10                3232
mysql-xdevapi-columnresult.getcollationname.php    30-Sep-2022 11:10                3211
mysql-xdevapi-columnresult.getcolumnlabel.php      30-Sep-2022 11:10                3177
mysql-xdevapi-columnresult.getcolumnname.php       30-Sep-2022 11:10                3172
mysql-xdevapi-columnresult.getfractionaldigits.php 30-Sep-2022 11:10                3283
mysql-xdevapi-columnresult.getlength.php           30-Sep-2022 11:10                3127
mysql-xdevapi-columnresult.getschemaname.php       30-Sep-2022 11:10                3201
mysql-xdevapi-columnresult.gettablelabel.php       30-Sep-2022 11:10                3156
mysql-xdevapi-columnresult.gettablename.php        30-Sep-2022 11:10                3166
mysql-xdevapi-columnresult.gettype.php             30-Sep-2022 11:10                3083
mysql-xdevapi-columnresult.isnumbersigned.php      30-Sep-2022 11:10                3329
mysql-xdevapi-columnresult.ispadded.php            30-Sep-2022 11:10                3170
mysql-xdevapi-crudoperationbindable.bind.php       30-Sep-2022 11:10                5783
mysql-xdevapi-crudoperationlimitable.limit.php     30-Sep-2022 11:10                5874
mysql-xdevapi-crudoperationskippable.skip.php      30-Sep-2022 11:10                4545
mysql-xdevapi-crudoperationsortable.sort.php       30-Sep-2022 11:10                4581
mysql-xdevapi-databaseobject.existsindatabase.php  30-Sep-2022 11:10                3492
mysql-xdevapi-databaseobject.getname.php           30-Sep-2022 11:10                3403
mysql-xdevapi-databaseobject.getsession.php        30-Sep-2022 11:10                3506
mysql-xdevapi-docresult.construct.php              30-Sep-2022 11:10                7802
mysql-xdevapi-docresult.fetchall.php               30-Sep-2022 11:10                8254
mysql-xdevapi-docresult.fetchone.php               30-Sep-2022 11:10                7896
mysql-xdevapi-docresult.getwarnings.php            30-Sep-2022 11:10                8917
mysql-xdevapi-docresult.getwarningscount.php       30-Sep-2022 11:10                8729
mysql-xdevapi-executable.execute.php               30-Sep-2022 11:10                6756
mysql-xdevapi-executionstatus.construct.php        30-Sep-2022 11:10                2953
mysql-xdevapi-expression.construct.php             30-Sep-2022 11:10                3051
mysql-xdevapi-result.construct.php                 30-Sep-2022 11:10                7343
mysql-xdevapi-result.getaffecteditemscount.php     30-Sep-2022 11:10                6143
mysql-xdevapi-result.getautoincrementvalue.php     30-Sep-2022 11:10                7682
mysql-xdevapi-result.getgeneratedids.php           30-Sep-2022 11:10                6969
mysql-xdevapi-result.getwarnings.php               30-Sep-2022 11:10                6932
mysql-xdevapi-result.getwarningscount.php          30-Sep-2022 11:10                6628
mysql-xdevapi-rowresult.construct.php              30-Sep-2022 11:10                5005
mysql-xdevapi-rowresult.fetchall.php               30-Sep-2022 11:10                6702
mysql-xdevapi-rowresult.fetchone.php               30-Sep-2022 11:10                6861
mysql-xdevapi-rowresult.getcolumncount.php         30-Sep-2022 11:10                6186
mysql-xdevapi-rowresult.getcolumnnames.php         30-Sep-2022 11:10                6188
mysql-xdevapi-rowresult.getcolumns.php             30-Sep-2022 11:10                7149
mysql-xdevapi-rowresult.getwarnings.php            30-Sep-2022 11:10                6979
mysql-xdevapi-rowresult.getwarningscount.php       30-Sep-2022 11:10                6674
mysql-xdevapi-schema.construct.php                 30-Sep-2022 11:10                5530
mysql-xdevapi-schema.createcollection.php          30-Sep-2022 11:10               10326
mysql-xdevapi-schema.dropcollection.php            30-Sep-2022 11:10                6645
mysql-xdevapi-schema.existsindatabase.php          30-Sep-2022 11:10                6500
mysql-xdevapi-schema.getcollection.php             30-Sep-2022 11:10                5687
mysql-xdevapi-schema.getcollectionastable.php      30-Sep-2022 11:10                7319
mysql-xdevapi-schema.getcollections.php            30-Sep-2022 11:10                6416
mysql-xdevapi-schema.getname.php                   30-Sep-2022 11:10                4818
mysql-xdevapi-schema.getsession.php                30-Sep-2022 11:10                5316
mysql-xdevapi-schema.gettable.php                  30-Sep-2022 11:10                6886
mysql-xdevapi-schema.gettables.php                 30-Sep-2022 11:10                7090
mysql-xdevapi-schemaobject.getschema.php           30-Sep-2022 11:10                4085
mysql-xdevapi-session.close.php                    30-Sep-2022 11:10                3966
mysql-xdevapi-session.commit.php                   30-Sep-2022 11:10                4767
mysql-xdevapi-session.construct.php                30-Sep-2022 11:10                3127
mysql-xdevapi-session.createschema.php             30-Sep-2022 11:10                4989
mysql-xdevapi-session.dropschema.php               30-Sep-2022 11:10                4083
mysql-xdevapi-session.generateuuid.php             30-Sep-2022 11:10                3993
mysql-xdevapi-session.getdefaultschema.php         30-Sep-2022 11:10                4150
mysql-xdevapi-session.getschema.php                30-Sep-2022 11:10                4265
mysql-xdevapi-session.getschemas.php               30-Sep-2022 11:10                4086
mysql-xdevapi-session.getserverversion.php         30-Sep-2022 11:10                3929
mysql-xdevapi-session.listclients.php              30-Sep-2022 11:10                4253
mysql-xdevapi-session.quotename.php                30-Sep-2022 11:10                5366
mysql-xdevapi-session.releasesavepoint.php         30-Sep-2022 11:10                5698
mysql-xdevapi-session.rollback.php                 30-Sep-2022 11:10                5393
mysql-xdevapi-session.rollbackto.php               30-Sep-2022 11:10                5777
mysql-xdevapi-session.setsavepoint.php             30-Sep-2022 11:10                5986
mysql-xdevapi-session.sql.php                      30-Sep-2022 11:10                3941
mysql-xdevapi-session.starttransaction.php         30-Sep-2022 11:10                5469
mysql-xdevapi-sqlstatement.bind.php                30-Sep-2022 11:10                3339
mysql-xdevapi-sqlstatement.construct.php           30-Sep-2022 11:10                2891
mysql-xdevapi-sqlstatement.execute.php             30-Sep-2022 11:10                3181
mysql-xdevapi-sqlstatement.getnextresult.php       30-Sep-2022 11:10                3233
mysql-xdevapi-sqlstatement.getresult.php           30-Sep-2022 11:10                3202
mysql-xdevapi-sqlstatement.hasmoreresults.php      30-Sep-2022 11:10                3252
mysql-xdevapi-sqlstatementresult.construct.php     30-Sep-2022 11:10                3011
mysql-xdevapi-sqlstatementresult.fetchall.php      30-Sep-2022 11:10                7105
mysql-xdevapi-sqlstatementresult.fetchone.php      30-Sep-2022 11:10                6934
mysql-xdevapi-sqlstatementresult.getaffectedite..> 30-Sep-2022 11:10                3367
mysql-xdevapi-sqlstatementresult.getcolumncount..> 30-Sep-2022 11:10                3901
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 30-Sep-2022 11:10                3283
mysql-xdevapi-sqlstatementresult.getcolumns.php    30-Sep-2022 11:10                3239
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 30-Sep-2022 11:10                3397
mysq