Index of /php.ihc-ru.net/manual/ru/


../
feeds/                                             30-Sep-2022 11:09                   -
images/                                            30-Sep-2022 11:09                   -
styles/                                            30-Sep-2022 11:08                   -
toc/                                               30-Sep-2022 11:09                   -
about.formats.php                                  30-Sep-2022 11:09                6131
about.generate.php                                 30-Sep-2022 11:09                3443
about.howtohelp.php                                30-Sep-2022 11:09                4837
about.more.php                                     30-Sep-2022 11:09                2637
about.notes.php                                    30-Sep-2022 11:09                3326
about.php                                          30-Sep-2022 11:09                2057
about.phpversions.php                              30-Sep-2022 11:09                5115
about.prototypes.php                               30-Sep-2022 11:09                9207
about.translations.php                             30-Sep-2022 11:09                4253
aliases.php                                        30-Sep-2022 11:09               30367
apache.configuration.php                           30-Sep-2022 11:09                5847
apache.constants.php                               30-Sep-2022 11:09                1240
apache.installation.php                            30-Sep-2022 11:09                1351
apache.requirements.php                            30-Sep-2022 11:09                1265
apache.resources.php                               30-Sep-2022 11:09                1318
apache.setup.php                                   30-Sep-2022 11:09                1663
apcu.configuration.php                             30-Sep-2022 11:08               19373
apcu.constants.php                                 30-Sep-2022 11:08                5562
apcu.installation.php                              30-Sep-2022 11:08                4100
apcu.requirements.php                              30-Sep-2022 11:08                1251
apcu.resources.php                                 30-Sep-2022 11:08                1304
apcu.setup.php                                     30-Sep-2022 11:08                1621
apcuiterator.construct.php                         30-Sep-2022 11:08                6792
apcuiterator.current.php                           30-Sep-2022 11:08                3304
apcuiterator.gettotalcount.php                     30-Sep-2022 11:08                3574
apcuiterator.gettotalhits.php                      30-Sep-2022 11:08                3739
apcuiterator.gettotalsize.php                      30-Sep-2022 11:08                3370
apcuiterator.key.php                               30-Sep-2022 11:08                2976
apcuiterator.next.php                              30-Sep-2022 11:08                3242
apcuiterator.rewind.php                            30-Sep-2022 11:08                2980
apcuiterator.valid.php                             30-Sep-2022 11:08                3058
appendices.php                                     30-Sep-2022 11:09               14259
appenditerator.append.php                          30-Sep-2022 11:09                5775
appenditerator.construct.php                       30-Sep-2022 11:09               11095
appenditerator.current.php                         30-Sep-2022 11:09                3838
appenditerator.getarrayiterator.php                30-Sep-2022 11:09                3498
appenditerator.getinneriterator.php                30-Sep-2022 11:09                7286
appenditerator.getiteratorindex.php                30-Sep-2022 11:09                7237
appenditerator.key.php                             30-Sep-2022 11:09                8671
appenditerator.next.php                            30-Sep-2022 11:09                3778
appenditerator.rewind.php                          30-Sep-2022 11:09                3736
appenditerator.valid.php                           30-Sep-2022 11:09                3538
array.configuration.php                            30-Sep-2022 11:09                1365
array.constants.php                                30-Sep-2022 11:09                9289
array.installation.php                             30-Sep-2022 11:09                1367
array.requirements.php                             30-Sep-2022 11:09                1258
array.resources.php                                30-Sep-2022 11:09                1311
array.setup.php                                    30-Sep-2022 11:09                1638
array.sorting.php                                  30-Sep-2022 11:09                8147
arrayaccess.offsetexists.php                       30-Sep-2022 11:08               10556
arrayaccess.offsetget.php                          30-Sep-2022 11:08                6077
arrayaccess.offsetset.php                          30-Sep-2022 11:08                5972
arrayaccess.offsetunset.php                        30-Sep-2022 11:08                3041
arrayiterator.append.php                           30-Sep-2022 11:09                3966
arrayiterator.asort.php                            30-Sep-2022 11:09                7096
arrayiterator.construct.php                        30-Sep-2022 11:09                3836
arrayiterator.count.php                            30-Sep-2022 11:09                3391
arrayiterator.current.php                          30-Sep-2022 11:09                5675
arrayiterator.getarraycopy.php                     30-Sep-2022 11:09                3259
arrayiterator.getflags.php                         30-Sep-2022 11:09                3311
arrayiterator.key.php                              30-Sep-2022 11:09                4068
arrayiterator.ksort.php                            30-Sep-2022 11:09                7036
arrayiterator.natcasesort.php                      30-Sep-2022 11:09                4735
arrayiterator.natsort.php                          30-Sep-2022 11:09                4435
arrayiterator.next.php                             30-Sep-2022 11:09                5013
arrayiterator.offsetexists.php                     30-Sep-2022 11:09                3579
arrayiterator.offsetget.php                        30-Sep-2022 11:09                3871
arrayiterator.offsetset.php                        30-Sep-2022 11:09                4172
arrayiterator.offsetunset.php                      30-Sep-2022 11:09                4266
arrayiterator.rewind.php                           30-Sep-2022 11:09                4985
arrayiterator.seek.php                             30-Sep-2022 11:09                2870
arrayiterator.serialize.php                        30-Sep-2022 11:09                3096
arrayiterator.setflags.php                         30-Sep-2022 11:09                4636
arrayiterator.uasort.php                           30-Sep-2022 11:09                5908
arrayiterator.uksort.php                           30-Sep-2022 11:09                5625
arrayiterator.unserialize.php                      30-Sep-2022 11:09                3422
arrayiterator.valid.php                            30-Sep-2022 11:09                4888
arrayobject.append.php                             30-Sep-2022 11:09                5970
arrayobject.asort.php                              30-Sep-2022 11:09               10554
arrayobject.construct.php                          30-Sep-2022 11:09                6428
arrayobject.count.php                              30-Sep-2022 11:09                5758
arrayobject.exchangearray.php                      30-Sep-2022 11:09                6441
arrayobject.getarraycopy.php                       30-Sep-2022 11:09                5585
arrayobject.getflags.php                           30-Sep-2022 11:09                6596
arrayobject.getiterator.php                        30-Sep-2022 11:09                5736
arrayobject.getiteratorclass.php                   30-Sep-2022 11:09                7298
arrayobject.ksort.php                              30-Sep-2022 11:09               10058
arrayobject.natcasesort.php                        30-Sep-2022 11:09                8973
arrayobject.natsort.php                            30-Sep-2022 11:09                8630
arrayobject.offsetexists.php                       30-Sep-2022 11:09                5078
arrayobject.offsetget.php                          30-Sep-2022 11:09                5379
arrayobject.offsetset.php                          30-Sep-2022 11:09                7289
arrayobject.offsetunset.php                        30-Sep-2022 11:09                4563
arrayobject.serialize.php                          30-Sep-2022 11:09                5497
arrayobject.setflags.php                           30-Sep-2022 11:09                7516
arrayobject.setiteratorclass.php                   30-Sep-2022 11:09                6441
arrayobject.uasort.php                             30-Sep-2022 11:09               11043
arrayobject.uksort.php                             30-Sep-2022 11:09               10311
arrayobject.unserialize.php                        30-Sep-2022 11:09                3903
backedenum.from.php                                30-Sep-2022 11:08                6632
backedenum.tryfrom.php                             30-Sep-2022 11:08                6955
bc.configuration.php                               30-Sep-2022 11:09                2749
bc.constants.php                                   30-Sep-2022 11:09                1214
bc.installation.php                                30-Sep-2022 11:09                1687
bc.requirements.php                                30-Sep-2022 11:09                1237
bc.resources.php                                   30-Sep-2022 11:09                1290
bc.setup.php                                       30-Sep-2022 11:09                1621
book.apache.php                                    30-Sep-2022 11:09                3819
book.apcu.php                                      30-Sep-2022 11:08                5258
book.array.php                                     30-Sep-2022 11:09               16265
book.bc.php                                        30-Sep-2022 11:09                3703
book.bson.php                                      30-Sep-2022 11:09               22225
book.bzip2.php                                     30-Sep-2022 11:08                3354
book.calendar.php                                  30-Sep-2022 11:09                5545
book.classobj.php                                  30-Sep-2022 11:09                5568
book.cmark.php                                     30-Sep-2022 11:09                9753
book.com.php                                       30-Sep-2022 11:09                9274
book.componere.php                                 30-Sep-2022 11:08                6806
book.csprng.php                                    30-Sep-2022 11:09                2404
book.ctype.php                                     30-Sep-2022 11:09                3784
book.cubrid.php                                    30-Sep-2022 11:09               18202
book.curl.php                                      30-Sep-2022 11:09                8520
book.datetime.php                                  30-Sep-2022 11:09               19995
book.dba.php                                       30-Sep-2022 11:09                4094
book.dbase.php                                     30-Sep-2022 11:09                3775
book.dio.php                                       30-Sep-2022 11:09                3690
book.dir.php                                       30-Sep-2022 11:09                3680
book.dom.php                                       30-Sep-2022 11:09               22084
book.ds.php                                        30-Sep-2022 11:09               34100
book.eio.php                                       30-Sep-2022 11:09               10787
book.enchant.php                                   30-Sep-2022 11:09                6278
book.errorfunc.php                                 30-Sep-2022 11:08                4078
book.ev.php                                        30-Sep-2022 11:09               17197
book.event.php                                     30-Sep-2022 11:09               29677
book.exec.php                                      30-Sep-2022 11:09                3946
book.exif.php                                      30-Sep-2022 11:09                2762
book.expect.php                                    30-Sep-2022 11:09                2812
book.fann.php                                      30-Sep-2022 11:09               30679
book.fdf.php                                       30-Sep-2022 11:09                6870
book.ffi.php                                       30-Sep-2022 11:08                6663
book.fileinfo.php                                  30-Sep-2022 11:09                3378
book.filesystem.php                                30-Sep-2022 11:09               12841
book.filter.php                                    30-Sep-2022 11:09                4165
book.fpm.php                                       30-Sep-2022 11:09                2116
book.ftp.php                                       30-Sep-2022 11:09                7364
book.funchand.php                                  30-Sep-2022 11:09                4421
book.gearman.php                                   30-Sep-2022 11:09               20401
book.gender.php                                    30-Sep-2022 11:09                2788
book.geoip.php                                     30-Sep-2022 11:09                5185
book.gettext.php                                   30-Sep-2022 11:09                3431
book.gmagick.php                                   30-Sep-2022 11:09               30220
book.gmp.php                                       30-Sep-2022 11:09                8229
book.gnupg.php                                     30-Sep-2022 11:09                6135
book.hash.php                                      30-Sep-2022 11:09                5234
book.hrtime.php                                    30-Sep-2022 11:09                3996
book.ibase.php                                     30-Sep-2022 11:09               14784
book.ibm-db2.php                                   30-Sep-2022 11:09               12131
book.iconv.php                                     30-Sep-2022 11:09                3755
book.igbinary.php                                  30-Sep-2022 11:09                2292
book.image.php                                     30-Sep-2022 11:09               20756
book.imagick.php                                   30-Sep-2022 11:09               83339
book.imap.php                                      30-Sep-2022 11:09               12922
book.info.php                                      30-Sep-2022 11:08               10308
book.inotify.php                                   30-Sep-2022 11:09                2753
book.intl.php                                      30-Sep-2022 11:09               59159
book.json.php                                      30-Sep-2022 11:09                3061
book.ldap.php                                      30-Sep-2022 11:09               11406
book.libxml.php                                    30-Sep-2022 11:09                3487
book.lua.php                                       30-Sep-2022 11:09                2850
book.luasandbox.php                                30-Sep-2022 11:09                6356
book.lzf.php                                       30-Sep-2022 11:08                2300
book.mail.php                                      30-Sep-2022 11:09                2228
book.mailparse.php                                 30-Sep-2022 11:09                4560
book.math.php                                      30-Sep-2022 11:09                8316
book.mbstring.php                                  30-Sep-2022 11:09               13307
book.mcrypt.php                                    30-Sep-2022 11:09                7829
book.memcache.php                                  30-Sep-2022 11:09                5018
book.memcached.php                                 30-Sep-2022 11:09               10528
book.mhash.php                                     30-Sep-2022 11:09                2697
book.misc.php                                      30-Sep-2022 11:09                6589
book.mongodb.php                                   30-Sep-2022 11:09               30359
book.mqseries.php                                  30-Sep-2022 11:09                3288
book.mysql-xdevapi.php                             30-Sep-2022 11:09               35510
book.mysql.php                                     30-Sep-2022 11:09               10183
book.mysqli.php                                    30-Sep-2022 11:09               23879
book.mysqlnd.php                                   30-Sep-2022 11:09                2673
book.network.php                                   30-Sep-2022 11:09                7068
book.oauth.php                                     30-Sep-2022 11:09                8386
book.oci8.php                                      30-Sep-2022 11:09               21001
book.opcache.php                                   30-Sep-2022 11:08                2935
book.openal.php                                    30-Sep-2022 11:08                5237
book.openssl.php                                   30-Sep-2022 11:09               13518
book.outcontrol.php                                30-Sep-2022 11:08                5045
book.parallel.php                                  30-Sep-2022 11:09                6225
book.parle.php                                     30-Sep-2022 11:09               10782
book.password.php                                  30-Sep-2022 11:09                2917
book.pcntl.php                                     30-Sep-2022 11:09                6346
book.pcre.php                                      30-Sep-2022 11:09                4865
book.pdo.php                                       30-Sep-2022 11:09               10028
book.pgsql.php                                     30-Sep-2022 11:09               16820
book.phar.php                                      30-Sep-2022 11:09               19014
book.phpdbg.php                                    30-Sep-2022 11:08                3309
book.posix.php                                     30-Sep-2022 11:09                8389
book.ps.php                                        30-Sep-2022 11:09               11902
book.pspell.php                                    30-Sep-2022 11:09                5359
book.pthreads.php                                  30-Sep-2022 11:09                6191
book.quickhash.php                                 30-Sep-2022 11:09               10195
book.radius.php                                    30-Sep-2022 11:08                6760
book.rar.php                                       30-Sep-2022 11:09                6393
book.readline.php                                  30-Sep-2022 11:08                4331
book.recode.php                                    30-Sep-2022 11:09                2508
book.reflection.php                                30-Sep-2022 11:09               46076
book.rpminfo.php                                   30-Sep-2022 11:09                2646
book.rrd.php                                       30-Sep-2022 11:09                6221
book.runkit7.php                                   30-Sep-2022 11:08                5086
book.scoutapm.php                                  30-Sep-2022 11:09                2329
book.seaslog.php                                   30-Sep-2022 11:09                6543
book.sem.php                                       30-Sep-2022 11:09                5065
book.session.php                                   30-Sep-2022 11:09                9642
book.shmop.php                                     30-Sep-2022 11:09                3319
book.simplexml.php                                 30-Sep-2022 11:09                6599
book.snmp.php                                      30-Sep-2022 11:09                7149
book.soap.php                                      30-Sep-2022 11:09                7099
book.sockets.php                                   30-Sep-2022 11:09                8699
book.sodium.php                                    30-Sep-2022 11:09               21735
book.solr.php                                      30-Sep-2022 11:09               69089
book.spl.php                                       30-Sep-2022 11:09               10989
book.sqlite3.php                                   30-Sep-2022 11:09                9127
book.sqlsrv.php                                    30-Sep-2022 11:09                6632
book.ssdeep.php                                    30-Sep-2022 11:09                2499
book.ssh2.php                                      30-Sep-2022 11:09                6723
book.stats.php                                     30-Sep-2022 11:09               15281
book.stomp.php                                     30-Sep-2022 11:09                4874
book.stream.php                                    30-Sep-2022 11:09               14839
book.strings.php                                   30-Sep-2022 11:09               16968
book.svm.php                                       30-Sep-2022 11:09                4377
book.svn.php                                       30-Sep-2022 11:09                9850
book.swoole.php                                    30-Sep-2022 11:09               45822
book.sync.php                                      30-Sep-2022 11:09                5498
book.taint.php                                     30-Sep-2022 11:09                2857
book.tcpwrap.php                                   30-Sep-2022 11:09                2132
book.tidy.php                                      30-Sep-2022 11:09                8550
book.tokenizer.php                                 30-Sep-2022 11:09                3537
book.trader.php                                    30-Sep-2022 11:09               23103
book.ui.php                                        30-Sep-2022 11:09               34792
book.uodbc.php                                     30-Sep-2022 11:09                8219
book.uopz.php                                      30-Sep-2022 11:08                6609
book.url.php                                       30-Sep-2022 11:09                3357
book.v8js.php                                      30-Sep-2022 11:09                3375
book.var.php                                       30-Sep-2022 11:09                7354
book.var_representation.php                        30-Sep-2022 11:09                2247
book.varnish.php                                   30-Sep-2022 11:09                6508
book.wddx.php                                      30-Sep-2022 11:09                3089
book.win32service.php                              30-Sep-2022 11:09                6124
book.wincache.php                                  30-Sep-2022 11:08                7049
book.wkhtmltox.php                                 30-Sep-2022 11:09                3598
book.xattr.php                                     30-Sep-2022 11:09                2738
book.xdiff.php                                     30-Sep-2022 11:09                4880
book.xhprof.php                                    30-Sep-2022 11:08                2698
book.xlswriter.php                                 30-Sep-2022 11:09                4494
book.xml.php                                       30-Sep-2022 11:09                6662
book.xmldiff.php                                   30-Sep-2022 11:09                3607
book.xmlreader.php                                 30-Sep-2022 11:09                5927
book.xmlrpc.php                                    30-Sep-2022 11:09                4281
book.xmlwriter.php                                 30-Sep-2022 11:09                8117
book.xsl.php                                       30-Sep-2022 11:09                4290
book.yac.php                                       30-Sep-2022 11:08                2781
book.yaconf.php                                    30-Sep-2022 11:09                2252
book.yaf.php                                       30-Sep-2022 11:09               40126
book.yaml.php                                      30-Sep-2022 11:09                3028
book.yar.php                                       30-Sep-2022 11:09                4024
book.yaz.php                                       30-Sep-2022 11:09                5269
book.zip.php                                       30-Sep-2022 11:09               12546
book.zlib.php                                      30-Sep-2022 11:09                6121
book.zmq.php                                       30-Sep-2022 11:09                6550
book.zookeeper.php                                 30-Sep-2022 11:09                8025
bzip2.configuration.php                            30-Sep-2022 11:08                1365
bzip2.constants.php                                30-Sep-2022 11:08                1230
bzip2.examples.php                                 30-Sep-2022 11:08                4539
bzip2.installation.php                             30-Sep-2022 11:08                1463
bzip2.requirements.php                             30-Sep-2022 11:08                1413
bzip2.resources.php                                30-Sep-2022 11:08                1378
bzip2.setup.php                                    30-Sep-2022 11:08                1650
cachingiterator.construct.php                      30-Sep-2022 11:09                2952
cachingiterator.count.php                          30-Sep-2022 11:09                2694
cachingiterator.current.php                        30-Sep-2022 11:09                3110
cachingiterator.getcache.php                       30-Sep-2022 11:09                5880
cachingiterator.getflags.php                       30-Sep-2022 11:09                2764
cachingiterator.getinneriterator.php               30-Sep-2022 11:09                2880
cachingiterator.hasnext.php                        30-Sep-2022 11:09                2799
cachingiterator.key.php                            30-Sep-2022 11:09                2443
cachingiterator.next.php                           30-Sep-2022 11:09                2730
cachingiterator.offsetexists.php                   30-Sep-2022 11:09                3021
cachingiterator.offsetget.php                      30-Sep-2022 11:09                2857
cachingiterator.offsetset.php                      30-Sep-2022 11:09                3305
cachingiterator.offsetunset.php                    30-Sep-2022 11:09                2920
cachingiterator.rewind.php                         30-Sep-2022 11:09                2708
cachingiterator.setflags.php                       30-Sep-2022 11:09                3035
cachingiterator.tostring.php                       30-Sep-2022 11:09                2807
cachingiterator.valid.php                          30-Sep-2022 11:09                2859
calendar.configuration.php                         30-Sep-2022 11:09                1386
calendar.constants.php                             30-Sep-2022 11:09               11775
calendar.installation.php                          30-Sep-2022 11:09                1699
calendar.requirements.php                          30-Sep-2022 11:09                1279
calendar.resources.php                             30-Sep-2022 11:09                1332
calendar.setup.php                                 30-Sep-2022 11:09                1698
callbackfilteriterator.accept.php                  30-Sep-2022 11:09                3869
callbackfilteriterator.construct.php               30-Sep-2022 11:09                4361
cc.license.php                                     30-Sep-2022 11:09               21036
changelog.misc.php                                 30-Sep-2022 11:09                4407
changelog.mysql.php                                30-Sep-2022 11:09                2867
changelog.mysql_xdevapi.php                        30-Sep-2022 11:09                2595
changelog.mysqli.php                               30-Sep-2022 11:09                4172
changelog.strings.php                              30-Sep-2022 11:09               14606
class.addressinfo.php                              30-Sep-2022 11:09                1825
class.apcuiterator.php                             30-Sep-2022 11:08                7237
class.appenditerator.php                           30-Sep-2022 11:09                8512
class.argumentcounterror.php                       30-Sep-2022 11:08                6818
class.arithmeticerror.php                          30-Sep-2022 11:08                7205
class.arrayaccess.php                              30-Sep-2022 11:08               13395
class.arrayiterator.php                            30-Sep-2022 11:09               16770
class.arrayobject.php                              30-Sep-2022 11:09               15941
class.assertionerror.php                           30-Sep-2022 11:08                6817
class.backedenum.php                               30-Sep-2022 11:08                4476
class.badfunctioncallexception.php                 30-Sep-2022 11:09                6943
class.badmethodcallexception.php                   30-Sep-2022 11:09                6953
class.cachingiterator.php                          30-Sep-2022 11:09               17290
class.callbackfilteriterator.php                   30-Sep-2022 11:09               12865
class.closure.php                                  30-Sep-2022 11:08                7002
class.collator.php                                 30-Sep-2022 11:09               28473
class.collectable.php                              30-Sep-2022 11:09                2546
class.com-exception.php                            30-Sep-2022 11:09                6758
class.com.php                                      30-Sep-2022 11:09               13677
class.commonmark-cql.php                           30-Sep-2022 11:09                9158
class.commonmark-interfaces-ivisitable.php         30-Sep-2022 11:09                2906
class.commonmark-interfaces-ivisitor.php           30-Sep-2022 11:09                4322
class.commonmark-node-blockquote.php               30-Sep-2022 11:09                8297
class.commonmark-node-bulletlist.php               30-Sep-2022 11:09               10228
class.commonmark-node-code.php                     30-Sep-2022 11:09                9172
class.commonmark-node-codeblock.php                30-Sep-2022 11:09               10405
class.commonmark-node-customblock.php              30-Sep-2022 11:09                8917
class.commonmark-node-custominline.php             30-Sep-2022 11:09                8893
class.commonmark-node-document.php                 30-Sep-2022 11:09                8241
class.commonmark-node-heading.php                  30-Sep-2022 11:09                9578
class.commonmark-node-htmlblock.php                30-Sep-2022 11:09                9226
class.commonmark-node-htmlinline.php               30-Sep-2022 11:09                9202
class.commonmark-node-image.php                    30-Sep-2022 11:09               10290
class.commonmark-node-item.php                     30-Sep-2022 11:09                8250
class.commonmark-node-linebreak.php                30-Sep-2022 11:09                8264
class.commonmark-node-link.php                     30-Sep-2022 11:09               10297
class.commonmark-node-orderedlist.php              30-Sep-2022 11:09               10958
class.commonmark-node-paragraph.php                30-Sep-2022 11:09                8303
class.commonmark-node-softbreak.php                30-Sep-2022 11:09                8296
class.commonmark-node-text-emphasis.php            30-Sep-2022 11:09                8325
class.commonmark-node-text-strong.php              30-Sep-2022 11:09                8314
class.commonmark-node-text.php                     30-Sep-2022 11:09                9614
class.commonmark-node-thematicbreak.php            30-Sep-2022 11:09                8325
class.commonmark-node.php                          30-Sep-2022 11:09                9790
class.commonmark-parser.php                        30-Sep-2022 11:09                3810
class.compersisthelper.php                         30-Sep-2022 11:09                6781
class.compileerror.php                             30-Sep-2022 11:08                6748
class.componere-abstract-definition.php            30-Sep-2022 11:08                4821
class.componere-definition.php                     30-Sep-2022 11:08                9752
class.componere-method.php                         30-Sep-2022 11:08                4509
class.componere-patch.php                          30-Sep-2022 11:08                8150
class.componere-value.php                          30-Sep-2022 11:08                5497
class.countable.php                                30-Sep-2022 11:09                2673
class.curlfile.php                                 30-Sep-2022 11:09                7878
class.curlhandle.php                               30-Sep-2022 11:09                1828
class.curlmultihandle.php                          30-Sep-2022 11:09                1867
class.curlsharehandle.php                          30-Sep-2022 11:09                1863
class.curlstringfile.php                           30-Sep-2022 11:09                5605
class.dateinterval.php                             30-Sep-2022 11:09               14378
class.dateperiod.php                               30-Sep-2022 11:09               13766
class.datetime.php                                 30-Sep-2022 11:09               21761
class.datetimeimmutable.php                        30-Sep-2022 11:09               21284
class.datetimeinterface.php                        30-Sep-2022 11:09               17399
class.datetimezone.php                             30-Sep-2022 11:09               13749
class.deflatecontext.php                           30-Sep-2022 11:09                1885
class.directory.php                                30-Sep-2022 11:09                5737
class.directoryiterator.php                        30-Sep-2022 11:09               24960
class.divisionbyzeroerror.php                      30-Sep-2022 11:08                6738
class.domainexception.php                          30-Sep-2022 11:09                6837
class.domattr.php                                  30-Sep-2022 11:09               21698
class.domcdatasection.php                          30-Sep-2022 11:09               23050
class.domcharacterdata.php                         30-Sep-2022 11:09               24641
class.domchildnode.php                             30-Sep-2022 11:09                4057
class.domcomment.php                               30-Sep-2022 11:09               22026
class.domdocument.php                              30-Sep-2022 11:09               58519
class.domdocumentfragment.php                      30-Sep-2022 11:09               21242
class.domdocumenttype.php                          30-Sep-2022 11:09               21625
class.domelement.php                               30-Sep-2022 11:09               37130
class.domentity.php                                30-Sep-2022 11:09               22132
class.domentityreference.php                       30-Sep-2022 11:09               17540
class.domexception.php                             30-Sep-2022 11:09                7727
class.domimplementation.php                        30-Sep-2022 11:09                5615
class.domnamednodemap.php                          30-Sep-2022 11:09                6882
class.domnode.php                                  30-Sep-2022 11:09               26944
class.domnodelist.php                              30-Sep-2022 11:09                5722
class.domnotation.php                              30-Sep-2022 11:09               17741
class.domparentnode.php                            30-Sep-2022 11:09                3157
class.domprocessinginstruction.php                 30-Sep-2022 11:09               18901
class.domtext.php                                  30-Sep-2022 11:09               24927
class.domxpath.php                                 30-Sep-2022 11:09                8007
class.dotnet.php                                   30-Sep-2022 11:09                8004
class.ds-collection.php                            30-Sep-2022 11:09                5577
class.ds-deque.php                                 30-Sep-2022 11:09               23929
class.ds-hashable.php                              30-Sep-2022 11:09                4883
class.ds-map.php                                   30-Sep-2022 11:09               25168
class.ds-pair.php                                  30-Sep-2022 11:09                4725
class.ds-priorityqueue.php                         30-Sep-2022 11:09                8756
class.ds-queue.php                                 30-Sep-2022 11:09                8171
class.ds-sequence.php                              30-Sep-2022 11:09               20910
class.ds-set.php                                   30-Sep-2022 11:09               19754
class.ds-stack.php                                 30-Sep-2022 11:09                7648
class.ds-vector.php                                30-Sep-2022 11:09               22707
class.emptyiterator.php                            30-Sep-2022 11:09                3987
class.enchantbroker.php                            30-Sep-2022 11:09                1897
class.enchantdictionary.php                        30-Sep-2022 11:09                1887
class.error.php                                    30-Sep-2022 11:08               10342
class.errorexception.php                           30-Sep-2022 11:08               13341
class.ev.php                                       30-Sep-2022 11:09               43554
class.evcheck.php                                  30-Sep-2022 11:09               11307
class.evchild.php                                  30-Sep-2022 11:09               12645
class.evembed.php                                  30-Sep-2022 11:09                9519
class.event.php                                    30-Sep-2022 11:09               19608
class.eventbase.php                                30-Sep-2022 11:09               15657
class.eventbuffer.php                              30-Sep-2022 11:09               22195
class.eventbufferevent.php                         30-Sep-2022 11:09               37529
class.eventconfig.php                              30-Sep-2022 11:09                7537
class.eventdnsbase.php                             30-Sep-2022 11:09               10938
class.eventhttp.php                                30-Sep-2022 11:09                9213
class.eventhttpconnection.php                      30-Sep-2022 11:09               10085
class.eventhttprequest.php                         30-Sep-2022 11:09               20874
class.eventlistener.php                            30-Sep-2022 11:09               12755
class.eventsslcontext.php                          30-Sep-2022 11:09               17779
class.eventutil.php                                30-Sep-2022 11:09               24122
class.evfork.php                                   30-Sep-2022 11:09                8706
class.evidle.php                                   30-Sep-2022 11:09               10411
class.evio.php                                     30-Sep-2022 11:09               13364
class.evloop.php                                   30-Sep-2022 11:09               32151
class.evperiodic.php                               30-Sep-2022 11:09               15651
class.evprepare.php                                30-Sep-2022 11:09               11462
class.evsignal.php                                 30-Sep-2022 11:09               11891
class.evstat.php                                   30-Sep-2022 11:09               15437
class.evtimer.php                                  30-Sep-2022 11:09               15298
class.evwatcher.php                                30-Sep-2022 11:09               10378
class.exception.php                                30-Sep-2022 11:08               10717
class.fannconnection.php                           30-Sep-2022 11:09                6311
class.ffi-cdata.php                                30-Sep-2022 11:08                6449
class.ffi-ctype.php                                30-Sep-2022 11:08                8000
class.ffi-exception.php                            30-Sep-2022 11:08                6462
class.ffi-parserexception.php                      30-Sep-2022 11:08                6526
class.ffi.php                                      30-Sep-2022 11:08               19176
class.fiber.php                                    30-Sep-2022 11:08                8280
class.fibererror.php                               30-Sep-2022 11:08                6927
class.filesystemiterator.php                       30-Sep-2022 11:09               30814
class.filteriterator.php                           30-Sep-2022 11:09                8150
class.finfo.php                                    30-Sep-2022 11:09                5191
class.ftp-connection.php                           30-Sep-2022 11:09                1867
class.gdfont.php                                   30-Sep-2022 11:09                1782
class.gdimage.php                                  30-Sep-2022 11:09                1780
class.gearmanclient.php                            30-Sep-2022 11:09               32944
class.gearmanexception.php                         30-Sep-2022 11:09                6662
class.gearmanjob.php                               30-Sep-2022 11:09               10693
class.gearmantask.php                              30-Sep-2022 11:09                8864
class.gearmanworker.php                            30-Sep-2022 11:09               12251
class.gender.php                                   30-Sep-2022 11:09               33288
class.generator.php                                30-Sep-2022 11:08                7204
class.globiterator.php                             30-Sep-2022 11:09               26406
class.gmagick.php                                  30-Sep-2022 11:09               81725
class.gmagickdraw.php                              30-Sep-2022 11:09               22920
class.gmagickpixel.php                             30-Sep-2022 11:09                5530
class.gmp.php                                      30-Sep-2022 11:09                3480
class.hashcontext.php                              30-Sep-2022 11:09                3385
class.hrtime-performancecounter.php                30-Sep-2022 11:09                3700
class.hrtime-stopwatch.php                         30-Sep-2022 11:09                6663
class.hrtime-unit.php                              30-Sep-2022 11:09                3966
class.imagick.php                                  30-Sep-2022 11:09              255505
class.imagickdraw.php                              30-Sep-2022 11:09               72076
class.imagickkernel.php                            30-Sep-2022 11:09                5701
class.imagickpixel.php                             30-Sep-2022 11:09               11671
class.imagickpixeliterator.php                     30-Sep-2022 11:09                8978
class.imap-connection.php                          30-Sep-2022 11:09                1870
class.infiniteiterator.php                         30-Sep-2022 11:09                5500
class.inflatecontext.php                           30-Sep-2022 11:09                1894
class.internaliterator.php                         30-Sep-2022 11:08                5135
class.intlbreakiterator.php                        30-Sep-2022 11:09               27740
class.intlcalendar.php                             30-Sep-2022 11:09               63724
class.intlchar.php                                 30-Sep-2022 11:09              343531
class.intlcodepointbreakiterator.php               30-Sep-2022 11:09               18605
class.intldateformatter.php                        30-Sep-2022 11:09               25335
class.intldatepatterngenerator.php                 30-Sep-2022 11:09                4318
class.intlexception.php                            30-Sep-2022 11:09                7026
class.intlgregoriancalendar.php                    30-Sep-2022 11:09               39140
class.intliterator.php                             30-Sep-2022 11:09                5832
class.intlpartsiterator.php                        30-Sep-2022 11:09                7143
class.intlrulebasedbreakiterator.php               30-Sep-2022 11:09               21469
class.intltimezone.php                             30-Sep-2022 11:09               21046
class.invalidargumentexception.php                 30-Sep-2022 11:09                6832
class.iterator.php                                 30-Sep-2022 11:08               13266
class.iteratoraggregate.php                        30-Sep-2022 11:08                6902
class.iteratoriterator.php                         30-Sep-2022 11:09                6978
class.jsonexception.php                            30-Sep-2022 11:09                7225
class.jsonserializable.php                         30-Sep-2022 11:09                3024
class.ldap-connection.php                          30-Sep-2022 11:09                1890
class.ldap-result-entry.php                        30-Sep-2022 11:09                1905
class.ldap-result.php                              30-Sep-2022 11:09                1882
class.lengthexception.php                          30-Sep-2022 11:09                6732
class.libxmlerror.php                              30-Sep-2022 11:09                5520
class.limititerator.php                            30-Sep-2022 11:09               12320
class.locale.php                                   30-Sep-2022 11:09               24121
class.logicexception.php                           30-Sep-2022 11:09                6904
class.lua.php                                      30-Sep-2022 11:09                7401
class.luaclosure.php                               30-Sep-2022 11:09                2739
class.luasandbox.php                               30-Sep-2022 11:09               13311
class.luasandboxerror.php                          30-Sep-2022 11:09                8782
class.luasandboxerrorerror.php                     30-Sep-2022 11:09                6825
class.luasandboxfatalerror.php                     30-Sep-2022 11:09                6938
class.luasandboxfunction.php                       30-Sep-2022 11:09                3865
class.luasandboxmemoryerror.php                    30-Sep-2022 11:09                7158
class.luasandboxruntimeerror.php                   30-Sep-2022 11:09                6989
class.luasandboxsyntaxerror.php                    30-Sep-2022 11:09                6829
class.luasandboxtimeouterror.php                   30-Sep-2022 11:09                7190
class.memcache.php                                 30-Sep-2022 11:09               16119
class.memcached.php                                30-Sep-2022 11:09               37959
class.memcachedexception.php                       30-Sep-2022 11:09                6640
class.messageformatter.php                         30-Sep-2022 11:09               12578
class.mongodb-bson-binary.php                      30-Sep-2022 11:09               15139
class.mongodb-bson-binaryinterface.php             30-Sep-2022 11:09                5016
class.mongodb-bson-dbpointer.php                   30-Sep-2022 11:09                6147
class.mongodb-bson-decimal128.php                  30-Sep-2022 11:09                8109
class.mongodb-bson-decimal128interface.php         30-Sep-2022 11:09                4250
class.mongodb-bson-int64.php                       30-Sep-2022 11:09                7475
class.mongodb-bson-javascript.php                  30-Sep-2022 11:09                8721
class.mongodb-bson-javascriptinterface.php         30-Sep-2022 11:09                5212
class.mongodb-bson-maxkey.php                      30-Sep-2022 11:09                6033
class.mongodb-bson-maxkeyinterface.php             30-Sep-2022 11:09                2403
class.mongodb-bson-minkey.php                      30-Sep-2022 11:09                6043
class.mongodb-bson-minkeyinterface.php             30-Sep-2022 11:09                2384
class.mongodb-bson-objectid.php                    30-Sep-2022 11:09                9753
class.mongodb-bson-objectidinterface.php           30-Sep-2022 11:09                4749
class.mongodb-bson-persistable.php                 30-Sep-2022 11:09                5094
class.mongodb-bson-regex.php                       30-Sep-2022 11:09                8192
class.mongodb-bson-regexinterface.php              30-Sep-2022 11:09                4987
class.mongodb-bson-serializable.php                30-Sep-2022 11:09                4259
class.mongodb-bson-symbol.php                      30-Sep-2022 11:09                6042
class.mongodb-bson-timestamp.php                   30-Sep-2022 11:09                8535
class.mongodb-bson-timestampinterface.php          30-Sep-2022 11:09                5254
class.mongodb-bson-type.php                        30-Sep-2022 11:09                2177
class.mongodb-bson-undefined.php                   30-Sep-2022 11:09                6165
class.mongodb-bson-unserializable.php              30-Sep-2022 11:09                4311
class.mongodb-bson-utcdatetime.php                 30-Sep-2022 11:09                7998
class.mongodb-bson-utcdatetimeinterface.php        30-Sep-2022 11:09                4853
class.mongodb-driver-bulkwrite.php                 30-Sep-2022 11:09               27686
class.mongodb-driver-clientencryption.php          30-Sep-2022 11:09               13165
class.mongodb-driver-command.php                   30-Sep-2022 11:09               16258
class.mongodb-driver-cursor.php                    30-Sep-2022 11:09               31013
class.mongodb-driver-cursorid.php                  30-Sep-2022 11:09                5621
class.mongodb-driver-cursorinterface.php           30-Sep-2022 11:09                6651
class.mongodb-driver-exception-authenticationex..> 30-Sep-2022 11:09                8208
class.mongodb-driver-exception-bulkwriteexcepti..> 30-Sep-2022 11:09                9053
class.mongodb-driver-exception-commandexception..> 30-Sep-2022 11:09                9989
class.mongodb-driver-exception-connectionexcept..> 30-Sep-2022 11:09                8326
class.mongodb-driver-exception-connectiontimeou..> 30-Sep-2022 11:09                8740
class.mongodb-driver-exception-encryptionexcept..> 30-Sep-2022 11:09                8242
class.mongodb-driver-exception-exception.php       30-Sep-2022 11:09                2288
class.mongodb-driver-exception-executiontimeout..> 30-Sep-2022 11:09                9480
class.mongodb-driver-exception-invalidargumente..> 30-Sep-2022 11:09                7449
class.mongodb-driver-exception-logicexception.php  30-Sep-2022 11:09                7325
class.mongodb-driver-exception-runtimeexception..> 30-Sep-2022 11:09               11007
class.mongodb-driver-exception-serverexception.php 30-Sep-2022 11:09                8323
class.mongodb-driver-exception-sslconnectionexc..> 30-Sep-2022 11:09                8684
class.mongodb-driver-exception-unexpectedvaluee..> 30-Sep-2022 11:09                7474
class.mongodb-driver-exception-writeexception.php  30-Sep-2022 11:09               11479
class.mongodb-driver-manager.php                   30-Sep-2022 11:09               21060
class.mongodb-driver-monitoring-commandfailedev..> 30-Sep-2022 11:09                7978
class.mongodb-driver-monitoring-commandstartede..> 30-Sep-2022 11:09                7434
class.mongodb-driver-monitoring-commandsubscrib..> 30-Sep-2022 11:09                6794
class.mongodb-driver-monitoring-commandsucceede..> 30-Sep-2022 11:09                7513
class.mongodb-driver-monitoring-sdamsubscriber.php 30-Sep-2022 11:09               12195
class.mongodb-driver-monitoring-serverchangedev..> 30-Sep-2022 11:09                5826
class.mongodb-driver-monitoring-serverclosedeve..> 30-Sep-2022 11:09                4422
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:09                5740
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:09                4527
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:09                5715
class.mongodb-driver-monitoring-serveropeningev..> 30-Sep-2022 11:09                4379
class.mongodb-driver-monitoring-subscriber.php     30-Sep-2022 11:09                2827
class.mongodb-driver-monitoring-topologychanged..> 30-Sep-2022 11:09                4869
class.mongodb-driver-monitoring-topologyclosede..> 30-Sep-2022 11:09                3423
class.mongodb-driver-monitoring-topologyopening..> 30-Sep-2022 11:09                3438
class.mongodb-driver-query.php                     30-Sep-2022 11:09                3212
class.mongodb-driver-readconcern.php               30-Sep-2022 11:09               19407
class.mongodb-driver-readpreference.php            30-Sep-2022 11:09               19799
class.mongodb-driver-server.php                    30-Sep-2022 11:09               25617
class.mongodb-driver-serverapi.php                 30-Sep-2022 11:09               15823
class.mongodb-driver-serverdescription.php         30-Sep-2022 11:09               16461
class.mongodb-driver-session.php                   30-Sep-2022 11:09               14489
class.mongodb-driver-topologydescription.php       30-Sep-2022 11:09               10931
class.mongodb-driver-writeconcern.php              30-Sep-2022 11:09                9714
class.mongodb-driver-writeconcernerror.php         30-Sep-2022 11:09                4251
class.mongodb-driver-writeerror.php                30-Sep-2022 11:09                4568
class.mongodb-driver-writeresult.php               30-Sep-2022 11:09                8441
class.multipleiterator.php                         30-Sep-2022 11:09               10986
class.mysql-xdevapi-baseresult.php                 30-Sep-2022 11:09                3024
class.mysql-xdevapi-client.php                     30-Sep-2022 11:09                3147
class.mysql-xdevapi-collection.php                 30-Sep-2022 11:09               10439
class.mysql-xdevapi-collectionadd.php              30-Sep-2022 11:09                2966
class.mysql-xdevapi-collectionfind.php             30-Sep-2022 11:09                8695
class.mysql-xdevapi-collectionmodify.php           30-Sep-2022 11:09                9827
class.mysql-xdevapi-collectionremove.php           30-Sep-2022 11:09                5207
class.mysql-xdevapi-columnresult.php               30-Sep-2022 11:09                6433
class.mysql-xdevapi-crudoperationbindable.php      30-Sep-2022 11:09                2949
class.mysql-xdevapi-crudoperationlimitable.php     30-Sep-2022 11:09                2957
class.mysql-xdevapi-crudoperationskippable.php     30-Sep-2022 11:09                2959
class.mysql-xdevapi-crudoperationsortable.php      30-Sep-2022 11:09                2927
class.mysql-xdevapi-databaseobject.php             30-Sep-2022 11:09                3504
class.mysql-xdevapi-docresult.php                  30-Sep-2022 11:09                3972
class.mysql-xdevapi-exception.php                  30-Sep-2022 11:09                2167
class.mysql-xdevapi-executable.php                 30-Sep-2022 11:09                2633
class.mysql-xdevapi-executionstatus.php            30-Sep-2022 11:09                4888
class.mysql-xdevapi-expression.php                 30-Sep-2022 11:09                3221
class.mysql-xdevapi-result.php                     30-Sep-2022 11:09                4399
class.mysql-xdevapi-rowresult.php                  30-Sep-2022 11:09                5026
class.mysql-xdevapi-schema.php                     30-Sep-2022 11:09                7473
class.mysql-xdevapi-schemaobject.php               30-Sep-2022 11:09                2812
class.mysql-xdevapi-session.php                    30-Sep-2022 11:09                8969
class.mysql-xdevapi-sqlstatement.php               30-Sep-2022 11:09                6448
class.mysql-xdevapi-sqlstatementresult.php         30-Sep-2022 11:09                7199
class.mysql-xdevapi-statement.php                  30-Sep-2022 11:09                4818
class.mysql-xdevapi-table.php                      30-Sep-2022 11:09                7738
class.mysql-xdevapi-tabledelete.php                30-Sep-2022 11:09                5216
class.mysql-xdevapi-tableinsert.php                30-Sep-2022 11:09                3556
class.mysql-xdevapi-tableselect.php                30-Sep-2022 11:09                8430
class.mysql-xdevapi-tableupdate.php                30-Sep-2022 11:09                6220
class.mysql-xdevapi-warning.php                    30-Sep-2022 11:09                3783
class.mysqli-driver.php                            30-Sep-2022 11:09                8257
class.mysqli-result.php                            30-Sep-2022 11:09               15014
class.mysqli-sql-exception.php                     30-Sep-2022 11:09                8238
class.mysqli-stmt.php                              30-Sep-2022 11:09               17930
class.mysqli-warning.php                           30-Sep-2022 11:09                4411
class.mysqli.php                                   30-Sep-2022 11:09               35813
class.norewinditerator.php                         30-Sep-2022 11:09                7479
class.normalizer.php                               30-Sep-2022 11:09                9244
class.numberformatter.php                          30-Sep-2022 11:09               44166
class.oauth.php                                    30-Sep-2022 11:09               18101
class.oauthexception.php                           30-Sep-2022 11:09                7865
class.oauthprovider.php                            30-Sep-2022 11:09               12147
class.ocicollection.php                            30-Sep-2022 11:09                6601
class.ocilob.php                                   30-Sep-2022 11:09               13340
class.opensslasymmetrickey.php                     30-Sep-2022 11:09                1981
class.opensslcertificate.php                       30-Sep-2022 11:09                1964
class.opensslcertificatesigningrequest.php         30-Sep-2022 11:09                2051
class.outeriterator.php                            30-Sep-2022 11:09                4500
class.outofboundsexception.php                     30-Sep-2022 11:09                6966
class.outofrangeexception.php                      30-Sep-2022 11:09                6939
class.overflowexception.php                        30-Sep-2022 11:09                6786
class.parallel-channel.php                         30-Sep-2022 11:09                9608
class.parallel-events-event-type.php               30-Sep-2022 11:09                3466
class.parallel-events-event.php                    30-Sep-2022 11:09                3586
class.parallel-events-input.php                    30-Sep-2022 11:09                4937
class.parallel-events.php                          30-Sep-2022 11:09                6940
class.parallel-future.php                          30-Sep-2022 11:09                9044
class.parallel-runtime.php                         30-Sep-2022 11:09                7620
class.parallel-sync.php                            30-Sep-2022 11:09                5691
class.parentiterator.php                           30-Sep-2022 11:09               10001
class.parle-errorinfo.php                          30-Sep-2022 11:09                3866
class.parle-lexer.php                              30-Sep-2022 11:09               12884
class.parle-lexerexception.php                     30-Sep-2022 11:09                6877
class.parle-parser.php                             30-Sep-2022 11:09               15723
class.parle-parserexception.php                    30-Sep-2022 11:09                6859
class.parle-rlexer.php                             30-Sep-2022 11:09               14322
class.parle-rparser.php                            30-Sep-2022 11:09               15863
class.parle-stack.php                              30-Sep-2022 11:09                4858
class.parle-token.php                              30-Sep-2022 11:09                4711
class.parseerror.php                               30-Sep-2022 11:08                7339
class.pdo.php                                      30-Sep-2022 11:09               13743
class.pdoexception.php                             30-Sep-2022 11:09                8716
class.pdostatement.php                             30-Sep-2022 11:09               20881
class.pgsql-connection.php                         30-Sep-2022 11:09                1913
class.pgsql-lob.php                                30-Sep-2022 11:09                1855
class.pgsql-result.php                             30-Sep-2022 11:09                1887
class.phar.php                                     30-Sep-2022 11:08               62361
class.phardata.php                                 30-Sep-2022 11:09               45344
class.pharexception.php                            30-Sep-2022 11:09                6724
class.pharfileinfo.php                             30-Sep-2022 11:09               18666
class.php-user-filter.php                          30-Sep-2022 11:09                6426
class.phptoken.php                                 30-Sep-2022 11:09                8388
class.pool.php                                     30-Sep-2022 11:09                7741
class.pspell-config.php                            30-Sep-2022 11:09                1889
class.pspell-dictionary.php                        30-Sep-2022 11:09                1926
class.quickhashinthash.php                         30-Sep-2022 11:09               14056
class.quickhashintset.php                          30-Sep-2022 11:09               12197
class.quickhashintstringhash.php                   30-Sep-2022 11:09               14910
class.quickhashstringinthash.php                   30-Sep-2022 11:09               12841
class.rangeexception.php                           30-Sep-2022 11:09                7202
class.rararchive.php                               30-Sep-2022 11:09                7569
class.rarentry.php                                 30-Sep-2022 11:09               45610
class.rarexception.php                             30-Sep-2022 11:09                8260
class.recursivearrayiterator.php                   30-Sep-2022 11:09               14174
class.recursivecachingiterator.php                 30-Sep-2022 11:09               13479
class.recursivecallbackfilteriterator.php          30-Sep-2022 11:09               15065
class.recursivedirectoryiterator.php               30-Sep-2022 11:09               29658
class.recursivefilteriterator.php                  30-Sep-2022 11:09                8823
class.recursiveiterator.php                        30-Sep-2022 11:09                5024
class.recursiveiteratoriterator.php                30-Sep-2022 11:09               14217
class.recursiveregexiterator.php                   30-Sep-2022 11:09               13558
class.recursivetreeiterator.php                    30-Sep-2022 11:09               23461
class.reflection.php                               30-Sep-2022 11:09                3281
class.reflectionattribute.php                      30-Sep-2022 11:09                6606
class.reflectionclass.php                          30-Sep-2022 11:09               33647
class.reflectionclassconstant.php                  30-Sep-2022 11:09               14492
class.reflectionenum.php                           30-Sep-2022 11:09               26221
class.reflectionenumbackedcase.php                 30-Sep-2022 11:09               11397
class.reflectionenumunitcase.php                   30-Sep-2022 11:09               11188
class.reflectionexception.php                      30-Sep-2022 11:09                6680
class.reflectionextension.php                      30-Sep-2022 11:09                9561
class.reflectionfiber.php                          30-Sep-2022 11:09                5045
class.reflectionfunction.php                       30-Sep-2022 11:09               18148
class.reflectionfunctionabstract.php               30-Sep-2022 11:09               19003
class.reflectiongenerator.php                      30-Sep-2022 11:09                6342
class.reflectionintersectiontype.php               30-Sep-2022 11:09                3395
class.reflectionmethod.php                         30-Sep-2022 11:09               28581
class.reflectionnamedtype.php                      30-Sep-2022 11:09                3684
class.reflectionobject.php                         30-Sep-2022 11:09               23623
class.reflectionparameter.php                      30-Sep-2022 11:09               15509
class.reflectionproperty.php                       30-Sep-2022 11:09               20439
class.reflectionreference.php                      30-Sep-2022 11:09                4064
class.reflectiontype.php                           30-Sep-2022 11:09                4740
class.reflectionuniontype.php                      30-Sep-2022 11:09                3279
class.reflectionzendextension.php                  30-Sep-2022 11:09                7045
class.reflector.php                                30-Sep-2022 11:09                4071
class.regexiterator.php                            30-Sep-2022 11:09               16335
class.resourcebundle.php                           30-Sep-2022 11:09               10745
class.rrdcreator.php                               30-Sep-2022 11:09                4278
class.rrdgraph.php                                 30-Sep-2022 11:09                3917
class.rrdupdater.php                               30-Sep-2022 11:09                3126
class.runtimeexception.php                         30-Sep-2022 11:09                6839
class.seaslog.php                                  30-Sep-2022 11:09               19130
class.seekableiterator.php                         30-Sep-2022 11:09               13147
class.serializable.php                             30-Sep-2022 11:08                9182
class.sessionhandler.php                           30-Sep-2022 11:09               29799
class.sessionhandlerinterface.php                  30-Sep-2022 11:09               17830
class.sessionidinterface.php                       30-Sep-2022 11:09                3535
class.sessionupdatetimestamphandlerinterface.php   30-Sep-2022 11:09                4558
class.shmop.php                                    30-Sep-2022 11:09                1824
class.simplexmlelement.php                         30-Sep-2022 11:09               13506
class.simplexmliterator.php                        30-Sep-2022 11:09               13090
class.snmp.php                                     30-Sep-2022 11:09               26637
class.snmpexception.php                            30-Sep-2022 11:09                7881
class.soapclient.php                               30-Sep-2022 11:09               30205
class.soapfault.php                                30-Sep-2022 11:09               12856
class.soapheader.php                               30-Sep-2022 11:09                5604
class.soapparam.php                                30-Sep-2022 11:09                3792
class.soapserver.php                               30-Sep-2022 11:09                9576
class.soapvar.php                                  30-Sep-2022 11:09                7149
class.socket.php                                   30-Sep-2022 11:09                1848
class.sodiumexception.php                          30-Sep-2022 11:09                6701
class.solrclient.php                               30-Sep-2022 11:09               22803
class.solrclientexception.php                      30-Sep-2022 11:09                8694
class.solrcollapsefunction.php                     30-Sep-2022 11:09               11151
class.solrdismaxquery.php                          30-Sep-2022 11:09               96826
class.solrdocument.php                             30-Sep-2022 11:09               21203
class.solrdocumentfield.php                        30-Sep-2022 11:09                4579
class.solrexception.php                            30-Sep-2022 11:09                9254
class.solrgenericresponse.php                      30-Sep-2022 11:09               11166
class.solrillegalargumentexception.php             30-Sep-2022 11:09                8791
class.solrillegaloperationexception.php            30-Sep-2022 11:09                8855
class.solrinputdocument.php                        30-Sep-2022 11:09               17611
class.solrmissingmandatoryparameterexception.php   30-Sep-2022 11:09                7906
class.solrmodifiableparams.php                     30-Sep-2022 11:09                8054
class.solrobject.php                               30-Sep-2022 11:09                5629
class.solrparams.php                               30-Sep-2022 11:09                8582
class.solrpingresponse.php                         30-Sep-2022 11:09               10625
class.solrquery.php                                30-Sep-2022 11:09              113829
class.solrqueryresponse.php                        30-Sep-2022 11:09               11098
class.solrresponse.php                             30-Sep-2022 11:09               13728
class.solrserverexception.php                      30-Sep-2022 11:09                8669
class.solrupdateresponse.php                       30-Sep-2022 11:09               11154
class.solrutils.php                                30-Sep-2022 11:09                4705
class.spldoublylinkedlist.php                      30-Sep-2022 11:09               17618
class.splfileinfo.php                              30-Sep-2022 11:09               16790
class.splfileobject.php                            30-Sep-2022 11:09               31950
class.splfixedarray.php                            30-Sep-2022 11:09               18516
class.splheap.php                                  30-Sep-2022 11:09                8115
class.splmaxheap.php                               30-Sep-2022 11:09                7220
class.splminheap.php                               30-Sep-2022 11:09                7227
class.splobjectstorage.php                         30-Sep-2022 11:09               21386
class.splobserver.php                              30-Sep-2022 11:09                2997
class.splpriorityqueue.php                         30-Sep-2022 11:09               10273
class.splqueue.php                                 30-Sep-2022 11:09               12634
class.splstack.php                                 30-Sep-2022 11:09               11612
class.splsubject.php                               30-Sep-2022 11:09                3904
class.spltempfileobject.php                        30-Sep-2022 11:09               25666
class.spoofchecker.php                             30-Sep-2022 11:09               13779
class.sqlite3.php                                  30-Sep-2022 11:09               16702
class.sqlite3result.php                            30-Sep-2022 11:09                5629
class.sqlite3stmt.php                              30-Sep-2022 11:09                7818
class.stomp.php                                    30-Sep-2022 11:09               17628
class.stompexception.php                           30-Sep-2022 11:09                5435
class.stompframe.php                               30-Sep-2022 11:09                4256
class.streamwrapper.php                            30-Sep-2022 11:09               18767
class.stringable.php                               30-Sep-2022 11:08                9453
class.svm.php                                      30-Sep-2022 11:09               17288
class.svmmodel.php                                 30-Sep-2022 11:09                6591
class.swoole-async.php                             30-Sep-2022 11:09                7273
class.swoole-atomic.php                            30-Sep-2022 11:09                4664
class.swoole-buffer.php                            30-Sep-2022 11:09                6971
class.swoole-channel.php                           30-Sep-2022 11:09                3843
class.swoole-client.php                            30-Sep-2022 11:09               14979
class.swoole-connection-iterator.php               30-Sep-2022 11:09                7351
class.swoole-coroutine.php                         30-Sep-2022 11:09               20303
class.swoole-event.php                             30-Sep-2022 11:09                6811
class.swoole-exception.php                         30-Sep-2022 11:09                4150
class.swoole-http-client.php                       30-Sep-2022 11:09               13400
class.swoole-http-request.php                      30-Sep-2022 11:09                2921
class.swoole-http-response.php                     30-Sep-2022 11:09                9740
class.swoole-http-server.php                       30-Sep-2022 11:09               21606
class.swoole-lock.php                              30-Sep-2022 11:09                4815
class.swoole-mmap.php                              30-Sep-2022 11:09                2947
class.swoole-mysql-exception.php                   30-Sep-2022 11:09                4191
class.swoole-mysql.php                             30-Sep-2022 11:09                5323
class.swoole-process.php                           30-Sep-2022 11:09               12682
class.swoole-redis-server.php                      30-Sep-2022 11:09               26157
class.swoole-serialize.php                         30-Sep-2022 11:09                3413
class.swoole-server.php                            30-Sep-2022 11:09               26378
class.swoole-table.php                             30-Sep-2022 11:09               11503
class.swoole-timer.php                             30-Sep-2022 11:09                4691
class.swoole-websocket-frame.php                   30-Sep-2022 11:09                1867
class.swoole-websocket-server.php                  30-Sep-2022 11:09                7250
class.syncevent.php                                30-Sep-2022 11:09                4829
class.syncmutex.php                                30-Sep-2022 11:09                4318
class.syncreaderwriter.php                         30-Sep-2022 11:09                5138
class.syncsemaphore.php                            30-Sep-2022 11:09                4508
class.syncsharedmemory.php                         30-Sep-2022 11:09                5689
class.sysvmessagequeue.php                         30-Sep-2022 11:09                1893
class.sysvsemaphore.php                            30-Sep-2022 11:09                1889
class.sysvsharedmemory.php                         30-Sep-2022 11:09                1926
class.thread.php                                   30-Sep-2022 11:09               10638
class.threaded.php                                 30-Sep-2022 11:09                8491
class.throwable.php                                30-Sep-2022 11:08                7409
class.tidy.php                                     30-Sep-2022 11:09               18449
class.tidynode.php                                 30-Sep-2022 11:09               11342
class.transliterator.php                           30-Sep-2022 11:09                8863
class.traversable.php                              30-Sep-2022 11:08                4494
class.typeerror.php                                30-Sep-2022 11:08                8238
class.uconverter.php                               30-Sep-2022 11:09               33052
class.ui-area.php                                  30-Sep-2022 11:09               11979
class.ui-control.php                               30-Sep-2022 11:09                5814
class.ui-controls-box.php                          30-Sep-2022 11:09                9535
class.ui-controls-button.php                       30-Sep-2022 11:09                6447
class.ui-controls-check.php                        30-Sep-2022 11:09                7300
class.ui-controls-colorbutton.php                  30-Sep-2022 11:09                6529
class.ui-controls-combo.php                        30-Sep-2022 11:09                6465
class.ui-controls-editablecombo.php                30-Sep-2022 11:09                6583
class.ui-controls-entry.php                        30-Sep-2022 11:09                9179
class.ui-controls-form.php                         30-Sep-2022 11:09                7673
class.ui-controls-grid.php                         30-Sep-2022 11:09               11628
class.ui-controls-group.php                        30-Sep-2022 11:09                8145
class.ui-controls-label.php                        30-Sep-2022 11:09                6256
class.ui-controls-multilineentry.php               30-Sep-2022 11:09                9538
class.ui-controls-picker.php                       30-Sep-2022 11:09                7158
class.ui-controls-progress.php                     30-Sep-2022 11:09                5889
class.ui-controls-radio.php                        30-Sep-2022 11:09                6350
class.ui-controls-separator.php                    30-Sep-2022 11:09                6760
class.ui-controls-slider.php                       30-Sep-2022 11:09                6888
class.ui-controls-spin.php                         30-Sep-2022 11:09                6742
class.ui-controls-tab.php                          30-Sep-2022 11:09                8623
class.ui-draw-brush-gradient.php                   30-Sep-2022 11:09                6508
class.ui-draw-brush-lineargradient.php             30-Sep-2022 11:09                5757
class.ui-draw-brush-radialgradient.php             30-Sep-2022 11:09                5886
class.ui-draw-brush.php                            30-Sep-2022 11:09                4296
class.ui-draw-color.php                            30-Sep-2022 11:09                8116
class.ui-draw-line-cap.php                         30-Sep-2022 11:09                2441
class.ui-draw-line-join.php                        30-Sep-2022 11:09                2412
class.ui-draw-matrix.php                           30-Sep-2022 11:09                5637
class.ui-draw-path.php                             30-Sep-2022 11:09                9801
class.ui-draw-pen.php                              30-Sep-2022 11:09                8276
class.ui-draw-stroke.php                           30-Sep-2022 11:09                6418
class.ui-draw-text-font-descriptor.php             30-Sep-2022 11:09                5574
class.ui-draw-text-font-italic.php                 30-Sep-2022 11:09                2629
class.ui-draw-text-font-stretch.php                30-Sep-2022 11:09                4025
class.ui-draw-text-font-weight.php                 30-Sep-2022 11:09                4020
class.ui-draw-text-font.php                        30-Sep-2022 11:09                4687
class.ui-draw-text-layout.php                      30-Sep-2022 11:09                4929
class.ui-exception-invalidargumentexception.php    30-Sep-2022 11:09                6892
class.ui-exception-runtimeexception.php            30-Sep-2022 11:09                6820
class.ui-executor.php                              30-Sep-2022 11:09                5072
class.ui-key.php                                   30-Sep-2022 11:09                9178
class.ui-menu.php                                  30-Sep-2022 11:09                6052
class.ui-menuitem.php                              30-Sep-2022 11:09                3745
class.ui-point.php                                 30-Sep-2022 11:09                6227
class.ui-size.php                                  30-Sep-2022 11:09                6345
class.ui-window.php                                30-Sep-2022 11:09               12413
class.underflowexception.php                       30-Sep-2022 11:09                6987
class.unexpectedvalueexception.php                 30-Sep-2022 11:09                7226
class.unhandledmatcherror.php                      30-Sep-2022 11:08                6788
class.unitenum.php                                 30-Sep-2022 11:08                3048
class.v8js.php                                     30-Sep-2022 11:09                8141
class.v8jsexception.php                            30-Sep-2022 11:09               10343
class.valueerror.php                               30-Sep-2022 11:08                6986
class.variant.php                                  30-Sep-2022 11:09                6193
class.varnishadmin.php                             30-Sep-2022 11:09               10738
class.varnishlog.php                               30-Sep-2022 11:09               28178
class.varnishstat.php                              30-Sep-2022 11:09                2877
class.volatile.php                                 30-Sep-2022 11:09               11968
class.vtiful-kernel-excel.php                      30-Sep-2022 11:09               10364
class.vtiful-kernel-format.php                     30-Sep-2022 11:09               13216
class.weakmap.php                                  30-Sep-2022 11:08               10365
class.weakreference.php                            30-Sep-2022 11:08                5936
class.win32serviceexception.php                    30-Sep-2022 11:09                7138
class.wkhtmltox-image-converter.php                30-Sep-2022 11:09                3969
class.wkhtmltox-pdf-converter.php                  30-Sep-2022 11:09                4359
class.wkhtmltox-pdf-object.php                     30-Sep-2022 11:09                2854
class.worker.php                                   30-Sep-2022 11:09                8302
class.xmldiff-base.php                             30-Sep-2022 11:09                4471
class.xmldiff-dom.php                              30-Sep-2022 11:09                5464
class.xmldiff-file.php                             30-Sep-2022 11:09                4956
class.xmldiff-memory.php                           30-Sep-2022 11:09                4993
class.xmlparser.php                                30-Sep-2022 11:09                1866
class.xmlreader.php                                30-Sep-2022 11:09               34306
class.xmlwriter.php                                30-Sep-2022 11:09               26601
class.xsltprocessor.php                            30-Sep-2022 11:09                9933
class.yac.php                                      30-Sep-2022 11:08                8540
class.yaconf.php                                   30-Sep-2022 11:09                3549
class.yaf-action-abstract.php                      30-Sep-2022 11:09               11846
class.yaf-application.php                          30-Sep-2022 11:09               13266
class.yaf-bootstrap-abstract.php                   30-Sep-2022 11:09                6631
class.yaf-config-abstract.php                      30-Sep-2022 11:09                5177
class.yaf-config-ini.php                           30-Sep-2022 11:09               17585
class.yaf-config-simple.php                        30-Sep-2022 11:09               12184
class.yaf-controller-abstract.php                  30-Sep-2022 11:09               19978
class.yaf-dispatcher.php                           30-Sep-2022 11:09               20580
class.yaf-exception-dispatchfailed.php             30-Sep-2022 11:09                2590
class.yaf-exception-loadfailed-action.php          30-Sep-2022 11:09                2661
class.yaf-exception-loadfailed-controller.php      30-Sep-2022 11:09                2686
class.yaf-exception-loadfailed-module.php          30-Sep-2022 11:09                2650
class.yaf-exception-loadfailed-view.php            30-Sep-2022 11:09                2590
class.yaf-exception-loadfailed.php                 30-Sep-2022 11:09                2568
class.yaf-exception-routerfailed.php               30-Sep-2022 11:09                2575
class.yaf-exception-startuperror.php               30-Sep-2022 11:09                2573
class.yaf-exception-typeerror.php                  30-Sep-2022 11:09                2544
class.yaf-exception.php                            30-Sep-2022 11:09                7654
class.yaf-loader.php                               30-Sep-2022 11:09               20528
class.yaf-plugin-abstract.php                      30-Sep-2022 11:09               18988
class.yaf-registry.php                             30-Sep-2022 11:09                5932
class.yaf-request-abstract.php                     30-Sep-2022 11:09               22080
class.yaf-request-http.php                         30-Sep-2022 11:09               21371
class.yaf-request-simple.php                       30-Sep-2022 11:09               20034
class.yaf-response-abstract.php                    30-Sep-2022 11:09               10946
class.yaf-route-interface.php                      30-Sep-2022 11:09                3540
class.yaf-route-map.php                            30-Sep-2022 11:09                6247
class.yaf-route-regex.php                          30-Sep-2022 11:09                7684
class.yaf-route-rewrite.php                        30-Sep-2022 11:09                6922
class.yaf-route-simple.php                         30-Sep-2022 11:09                6435
class.yaf-route-static.php                         30-Sep-2022 11:09                4996
class.yaf-route-supervar.php                       30-Sep-2022 11:09                4439
class.yaf-router.php                               30-Sep-2022 11:09               13976
class.yaf-session.php                              30-Sep-2022 11:09               11612
class.yaf-view-interface.php                       30-Sep-2022 11:09                5628
class.yaf-view-simple.php                          30-Sep-2022 11:09               10298
class.yar-client-exception.php                     30-Sep-2022 11:09                6082
class.yar-client.php                               30-Sep-2022 11:09                5560
class.yar-concurrent-client.php                    30-Sep-2022 11:09                6344
class.yar-server-exception.php                     30-Sep-2022 11:09                6633
class.yar-server.php                               30-Sep-2022 11:09                3375
class.ziparchive.php                               30-Sep-2022 11:09               41332
class.zmq.php                                      30-Sep-2022 11:09               36768
class.zmqcontext.php                               30-Sep-2022 11:09                5203
class.zmqdevice.php                                30-Sep-2022 11:09                7155
class.zmqpoll.php                                  30-Sep-2022 11:09                4936
class.zmqsocket.php                                30-Sep-2022 11:09               10470
class.zookeeper.php                                30-Sep-2022 11:09               51577
class.zookeeperauthenticationexception.php         30-Sep-2022 11:09                6881
class.zookeeperconfig.php                          30-Sep-2022 11:09                5642
class.zookeeperconnectionexception.php             30-Sep-2022 11:09                6872
class.zookeeperexception.php                       30-Sep-2022 11:09                6709
class.zookeepermarshallingexception.php            30-Sep-2022 11:09                6935
class.zookeepernonodeexception.php                 30-Sep-2022 11:09                6871
class.zookeeperoperationtimeoutexception.php       30-Sep-2022 11:09                6954
class.zookeepersessionexception.php                30-Sep-2022 11:09                6866
classobj.configuration.php                         30-Sep-2022 11:09                1386
classobj.constants.php                             30-Sep-2022 11:09                1276
classobj.examples.php                              30-Sep-2022 11:09               16066
classobj.installation.php                          30-Sep-2022 11:09                1388
classobj.requirements.php                          30-Sep-2022 11:09                1279
classobj.resources.php                             30-Sep-2022 11:09                1332
classobj.setup.php                                 30-Sep-2022 11:09                1690
closure.bind.php                                   30-Sep-2022 11:08                8725
closure.bindto.php                                 30-Sep-2022 11:08               11391
closure.call.php                                   30-Sep-2022 11:08                6855
closure.construct.php                              30-Sep-2022 11:08                2675
closure.fromcallable.php                           30-Sep-2022 11:08                4409
cmark.installation.php                             30-Sep-2022 11:09                2216
cmark.requirements.php                             30-Sep-2022 11:09                1346
cmark.setup.php                                    30-Sep-2022 11:09                1458
collator.asort.php                                 30-Sep-2022 11:09               10129
collator.compare.php                               30-Sep-2022 11:09               11447
collator.construct.php                             30-Sep-2022 11:09                7089
collator.create.php                                30-Sep-2022 11:09                6102
collator.getattribute.php                          30-Sep-2022 11:09                6368
collator.geterrorcode.php                          30-Sep-2022 11:09                5470
collator.geterrormessage.php                       30-Sep-2022 11:09                5559
collator.getlocale.php                             30-Sep-2022 11:09                7170
collator.getsortkey.php                            30-Sep-2022 11:09                7582
collator.getstrength.php                           30-Sep-2022 11:09                5171
collator.setattribute.php                          30-Sep-2022 11:09                6880
collator.setstrength.php                           30-Sep-2022 11:09               16185
collator.sort.php                                  30-Sep-2022 11:09                8561
collator.sortwithsortkeys.php                      30-Sep-2022 11:09                6941
collectable.isgarbage.php                          30-Sep-2022 11:09                2895
com.configuration.php                              30-Sep-2022 11:09                9977
com.constants.php                                  30-Sep-2022 11:09               21727
com.construct.php                                  30-Sep-2022 11:09                9457
com.error-handling.php                             30-Sep-2022 11:09                1827
com.examples.arrays.php                            30-Sep-2022 11:09                2557
com.examples.foreach.php                           30-Sep-2022 11:09                3096
com.examples.php                                   30-Sep-2022 11:09                1461
com.installation.php                               30-Sep-2022 11:09                1748
com.requirements.php                               30-Sep-2022 11:09                1360
com.resources.php                                  30-Sep-2022 11:09                1297
com.setup.php                                      30-Sep-2022 11:09                1624
commonmark-cql.construct.php                       30-Sep-2022 11:09                2173
commonmark-cql.invoke.php                          30-Sep-2022 11:09                4051
commonmark-interfaces-ivisitable.accept.php        30-Sep-2022 11:09                3161
commonmark-interfaces-ivisitor.enter.php           30-Sep-2022 11:09                4481
commonmark-interfaces-ivisitor.leave.php           30-Sep-2022 11:09                4495
commonmark-node-bulletlist.construct.php           30-Sep-2022 11:09                3184
commonmark-node-codeblock.construct.php            30-Sep-2022 11:09                2867
commonmark-node-heading.construct.php              30-Sep-2022 11:09                2741
commonmark-node-image.construct.php                30-Sep-2022 11:09                3250
commonmark-node-link.construct.php                 30-Sep-2022 11:09                3247
commonmark-node-orderedlist.construct.php          30-Sep-2022 11:09                3965
commonmark-node-text.construct.php                 30-Sep-2022 11:09                2757
commonmark-node.accept.php                         30-Sep-2022 11:09                2901
commonmark-node.appendchild.php                    30-Sep-2022 11:09                2939
commonmark-node.insertafter.php                    30-Sep-2022 11:09                2964
commonmark-node.insertbefore.php                   30-Sep-2022 11:09                2962
commonmark-node.prependchild.php                   30-Sep-2022 11:09                2966
commonmark-node.replace.php                        30-Sep-2022 11:09                2910
commonmark-node.unlink.php                         30-Sep-2022 11:09                2606
commonmark-parser.construct.php                    30-Sep-2022 11:09                3403
commonmark-parser.finish.php                       30-Sep-2022 11:09                2586
commonmark-parser.parse.php                        30-Sep-2022 11:09                2709
compersisthelper.construct.php                     30-Sep-2022 11:09                3706
compersisthelper.getcurfilename.php                30-Sep-2022 11:09                3242
compersisthelper.getmaxstreamsize.php              30-Sep-2022 11:09                3291
compersisthelper.initnew.php                       30-Sep-2022 11:09                3254
compersisthelper.loadfromfile.php                  30-Sep-2022 11:09                4537
compersisthelper.loadfromstream.php                30-Sep-2022 11:09                3538
compersisthelper.savetofile.php                    30-Sep-2022 11:09                6422
compersisthelper.savetostream.php                  30-Sep-2022 11:09                3409
componere-abstract-definition.addinterface.php     30-Sep-2022 11:08                3450
componere-abstract-definition.addmethod.php        30-Sep-2022 11:08                4359
componere-abstract-definition.addtrait.php         30-Sep-2022 11:08                3422
componere-abstract-definition.getreflector.php     30-Sep-2022 11:08                2448
componere-definition.addconstant.php               30-Sep-2022 11:08                4856
componere-definition.addproperty.php               30-Sep-2022 11:08                4044
componere-definition.construct.php                 30-Sep-2022 11:08                5998
componere-definition.getclosure.php                30-Sep-2022 11:08                3689
componere-definition.getclosures.php               30-Sep-2022 11:08                2860
componere-definition.isregistered.php              30-Sep-2022 11:08                2323
componere-definition.register.php                  30-Sep-2022 11:08                2530
componere-method.construct.php                     30-Sep-2022 11:08                2222
componere-method.getreflector.php                  30-Sep-2022 11:08                2241
componere-method.setprivate.php                    30-Sep-2022 11:08                2573
componere-method.setprotected.php                  30-Sep-2022 11:08                2588
componere-method.setstatic.php                     30-Sep-2022 11:08                2074
componere-patch.apply.php                          30-Sep-2022 11:08                1849
componere-patch.construct.php                      30-Sep-2022 11:08                3683
componere-patch.derive.php                         30-Sep-2022 11:08                3384
componere-patch.getclosure.php                     30-Sep-2022 11:08                3201
componere-patch.getclosures.php                    30-Sep-2022 11:08                2272
componere-patch.isapplied.php                      30-Sep-2022 11:08                1773
componere-patch.revert.php                         30-Sep-2022 11:08                1838
componere-value.construct.php                      30-Sep-2022 11:08                2739
componere-value.hasdefault.php                     30-Sep-2022 11:08                1834
componere-value.isprivate.php                      30-Sep-2022 11:08                1834
componere-value.isprotected.php                    30-Sep-2022 11:08                1844
componere-value.isstatic.php                       30-Sep-2022 11:08                1828
componere-value.setprivate.php                     30-Sep-2022 11:08                2602
componere-value.setprotected.php                   30-Sep-2022 11:08                2616
componere-value.setstatic.php                      30-Sep-2022 11:08                2097
componere.cast.php                                 30-Sep-2022 11:08                5418
componere.cast_by_ref.php                          30-Sep-2022 11:08                5645
componere.installation.php                         30-Sep-2022 11:08                1367
componere.requirements.php                         30-Sep-2022 11:08                1251
componere.setup.php                                30-Sep-2022 11:08                1497
configuration.changes.modes.php                    30-Sep-2022 11:08                4515
configuration.changes.php                          30-Sep-2022 11:08               11166
configuration.file.per-user.php                    30-Sep-2022 11:08                3880
configuration.file.php                             30-Sep-2022 11:08               12530
configuration.php                                  30-Sep-2022 11:08                1851
configure.about.php                                30-Sep-2022 11:09               15502
configure.php                                      30-Sep-2022 11:09                1478
context.curl.php                                   30-Sep-2022 11:08                9739
context.ftp.php                                    30-Sep-2022 11:08                4829
context.http.php                                   30-Sep-2022 11:08               18204
context.params.php                                 30-Sep-2022 11:08                2744
context.phar.php                                   30-Sep-2022 11:08                2956
context.php                                        30-Sep-2022 11:08                3400
context.socket.php                                 30-Sep-2022 11:08               11252
context.ssl.php                                    30-Sep-2022 11:08               13396
context.zip.php                                    30-Sep-2022 11:08                4789
control-structures.alternative-syntax.php          30-Sep-2022 11:08                8172
control-structures.break.php                       30-Sep-2022 11:08                5949
control-structures.continue.php                    30-Sep-2022 11:08                8430
control-structures.declare.php                     30-Sep-2022 11:08               12206
control-structures.do.while.php                    30-Sep-2022 11:08                6266
control-structures.else.php                        30-Sep-2022 11:08                5444
control-structures.elseif.php                      30-Sep-2022 11:08                8796
control-structures.for.php                         30-Sep-2022 11:08               13949
control-structures.foreach.php                     30-Sep-2022 11:08               25050
control-structures.goto.php                        30-Sep-2022 11:08                7915
control-structures.if.php                          30-Sep-2022 11:08                5637
control-structures.intro.php                       30-Sep-2022 11:08                3023
control-structures.match.php                       30-Sep-2022 11:08               22128
control-structures.switch.php                      30-Sep-2022 11:08               26518
control-structures.while.php                       30-Sep-2022 11:08                5674
copyright.php                                      30-Sep-2022 11:08                2575
countable.count.php                                30-Sep-2022 11:09                5767
csprng.configuration.php                           30-Sep-2022 11:09                1372
csprng.constants.php                               30-Sep-2022 11:09                1240
csprng.installation.php                            30-Sep-2022 11:09                1374
csprng.requirements.php                            30-Sep-2022 11:09                1265
csprng.resources.php                               30-Sep-2022 11:09                1318
csprng.setup.php                                   30-Sep-2022 11:09                1642
ctype.configuration.php                            30-Sep-2022 11:09                1365
ctype.constants.php                                30-Sep-2022 11:09                1231
ctype.installation.php                             30-Sep-2022 11:09                1644
ctype.requirements.php                             30-Sep-2022 11:09                1379
ctype.resources.php                                30-Sep-2022 11:09                1311
ctype.setup.php                                    30-Sep-2022 11:09                1634
cubrid.configuration.php                           30-Sep-2022 11:09                1307
cubrid.constants.php                               30-Sep-2022 11:09               17646
cubrid.examples.php                                30-Sep-2022 11:09               21957
cubrid.installation.php                            30-Sep-2022 11:09                2365
cubrid.requirements.php                            30-Sep-2022 11:09                1379
cubrid.resources.php                               30-Sep-2022 11:09                3530
cubrid.setup.php                                   30-Sep-2022 11:09                1647
cubridmysql.cubrid.php                             30-Sep-2022 11:09                6173
curl.configuration.php                             30-Sep-2022 11:09                2792
curl.constants.php                                 30-Sep-2022 11:09              102219
curl.examples-basic.php                            30-Sep-2022 11:09                5011
curl.examples.php                                  30-Sep-2022 11:09                1456
curl.installation.php                              30-Sep-2022 11:09                2811
curl.requirements.php                              30-Sep-2022 11:09                1622
curl.resources.php                                 30-Sep-2022 11:09                1479
curl.setup.php                                     30-Sep-2022 11:09                1642
curlfile.construct.php                             30-Sep-2022 11:09               21957
curlfile.getfilename.php                           30-Sep-2022 11:09                2182
curlfile.getmimetype.php                           30-Sep-2022 11:09                2178
curlfile.getpostfilename.php                       30-Sep-2022 11:09                2300
curlfile.setmimetype.php                           30-Sep-2022 11:09                2461
curlfile.setpostfilename.php                       30-Sep-2022 11:09                2569
curlstringfile.construct.php                       30-Sep-2022 11:09                7334
dateinterval.construct.php                         30-Sep-2022 11:09               14432
dateinterval.createfromdatestring.php              30-Sep-2022 11:09               16134
dateinterval.format.php                            30-Sep-2022 11:09               15925
dateperiod.construct.php                           30-Sep-2022 11:09               19994
dateperiod.getdateinterval.php                     30-Sep-2022 11:09                4991
dateperiod.getenddate.php                          30-Sep-2022 11:09                8203
dateperiod.getrecurrences.php                      30-Sep-2022 11:09                2799
dateperiod.getstartdate.php                        30-Sep-2022 11:09                5415
datetime.add.php                                   30-Sep-2022 11:09                5484
datetime.configuration.php                         30-Sep-2022 11:09                6626
datetime.constants.php                             30-Sep-2022 11:09                2847
datetime.construct.php                             30-Sep-2022 11:09                5871
datetime.createfromformat.php                      30-Sep-2022 11:09                5880
datetime.createfromimmutable.php                   30-Sep-2022 11:09                4613
datetime.createfrominterface.php                   30-Sep-2022 11:09                5264
datetime.diff.php                                  30-Sep-2022 11:09               15822
datetime.examples-arithmetic.php                   30-Sep-2022 11:09               17176
datetime.examples.php                              30-Sep-2022 11:09                1488
datetime.format.php                                30-Sep-2022 11:09               26701
datetime.formats.compound.php                      30-Sep-2022 11:09               13398
datetime.formats.date.php                          30-Sep-2022 11:09               17407
datetime.formats.php                               30-Sep-2022 11:09                8774
datetime.formats.relative.php                      30-Sep-2022 11:09               19473
datetime.formats.time.php                          30-Sep-2022 11:09                8455
datetime.getlasterrors.php                         30-Sep-2022 11:09                3893
datetime.getoffset.php                             30-Sep-2022 11:09                8781
datetime.gettimestamp.php                          30-Sep-2022 11:09                7708
datetime.gettimezone.php                           30-Sep-2022 11:09                8237
datetime.installation.php                          30-Sep-2022 11:09                1835
datetime.modify.php                                30-Sep-2022 11:09               11430
datetime.requirements.php                          30-Sep-2022 11:09                1279
datetime.resources.php                             30-Sep-2022 11:09                1332
datetime.set-state.php                             30-Sep-2022 11:09                2957
datetime.setdate.php                               30-Sep-2022 11:09                5823
datetime.setisodate.php                            30-Sep-2022 11:09                6086
datetime.settime.php                               30-Sep-2022 11:09                7420
datetime.settimestamp.php                          30-Sep-2022 11:09                5579
datetime.settimezone.php                           30-Sep-2022 11:09               10184
datetime.setup.php                                 30-Sep-2022 11:09                1706
datetime.sub.php                                   30-Sep-2022 11:09                5468
datetime.wakeup.php                                30-Sep-2022 11:09                3024
datetimeimmutable.add.php                          30-Sep-2022 11:09               11489
datetimeimmutable.construct.php                    30-Sep-2022 11:09               19766
datetimeimmutable.createfromformat.php             30-Sep-2022 11:09               52060
datetimeimmutable.createfrominterface.php          30-Sep-2022 11:09                5579
datetimeimmutable.createfrommutable.php            30-Sep-2022 11:09                4738
datetimeimmutable.getlasterrors.php                30-Sep-2022 11:09                5422
datetimeimmutable.modify.php                       30-Sep-2022 11:09                9097
datetimeimmutable.set-state.php                    30-Sep-2022 11:09                2803
datetimeimmutable.setdate.php                      30-Sep-2022 11:09                9782
datetimeimmutable.setisodate.php                   30-Sep-2022 11:09               13615
datetimeimmutable.settime.php                      30-Sep-2022 11:09               12892
datetimeimmutable.settimestamp.php                 30-Sep-2022 11:09                6370
datetimeimmutable.settimezone.php                  30-Sep-2022 11:09                6531
datetimeimmutable.sub.php                          30-Sep-2022 11:09               12120
datetimezone.construct.php                         30-Sep-2022 11:09               10836
datetimezone.getlocation.php                       30-Sep-2022 11:09                6377
datetimezone.getname.php                           30-Sep-2022 11:09                3939
datetimezone.getoffset.php                         30-Sep-2022 11:09                8697
datetimezone.gettransitions.php                    30-Sep-2022 11:09               11953
datetimezone.listabbreviations.php                 30-Sep-2022 11:09                6807
datetimezone.listidentifiers.php                   30-Sep-2022 11:09               15352
dba.configuration.php                              30-Sep-2022 11:09                2390
dba.constants.php                                  30-Sep-2022 11:09                2329
dba.example.php                                    30-Sep-2022 11:09                7274
dba.examples.php                                   30-Sep-2022 11:09                1395
dba.installation.php                               30-Sep-2022 11:09               11919
dba.requirements.php                               30-Sep-2022 11:09                9076
dba.resources.php                                  30-Sep-2022 11:09                1647
dba.setup.php                                      30-Sep-2022 11:09                1624
dbase.configuration.php                            30-Sep-2022 11:09                1365
dbase.constants.php                                30-Sep-2022 11:09                3208
dbase.installation.php                             30-Sep-2022 11:09                1792
dbase.requirements.php                             30-Sep-2022 11:09                1258
dbase.resources.php                                30-Sep-2022 11:09                1569
dbase.setup.php                                    30-Sep-2022 11:09                1650
debugger-about.php                                 30-Sep-2022 11:09                2019
debugger.php                                       30-Sep-2022 11:09                1395
dio.configuration.php                              30-Sep-2022 11:09                1351
dio.constants.php                                  30-Sep-2022 11:09                7594
dio.installation.php                               30-Sep-2022 11:09                2290
dio.requirements.php                               30-Sep-2022 11:09                1244
dio.resources.php                                  30-Sep-2022 11:09                1457
dio.setup.php                                      30-Sep-2022 11:09                1665
dir.configuration.php                              30-Sep-2022 11:09                1351
dir.constants.php                                  30-Sep-2022 11:09                2276
dir.installation.php                               30-Sep-2022 11:09                1353
dir.requirements.php                               30-Sep-2022 11:09                1244
dir.resources.php                                  30-Sep-2022 11:09                1297
dir.setup.php                                      30-Sep-2022 11:09                1631
directory.close.php                                30-Sep-2022 11:09                2279
directory.read.php                                 30-Sep-2022 11:09                2361
directory.rewind.php                               30-Sep-2022 11:09                2363
directoryiterator.construct.php                    30-Sep-2022 11:09                6402
directoryiterator.current.php                      30-Sep-2022 11:09                6811
directoryiterator.getatime.php                     30-Sep-2022 11:09                6417
directoryiterator.getbasename.php                  30-Sep-2022 11:09                7439
directoryiterator.getctime.php                     30-Sep-2022 11:09                6468
directoryiterator.getextension.php                 30-Sep-2022 11:09                6604
directoryiterator.getfilename.php                  30-Sep-2022 11:09                5948
directoryiterator.getgroup.php                     30-Sep-2022 11:09                6434
directoryiterator.getinode.php                     30-Sep-2022 11:09                5071
directoryiterator.getmtime.php                     30-Sep-2022 11:09                6341
directoryiterator.getowner.php                     30-Sep-2022 11:09                5814
directoryiterator.getpath.php                      30-Sep-2022 11:09                5283
directoryiterator.getpathname.php                  30-Sep-2022 11:09                5697
directoryiterator.getperms.php                     30-Sep-2022 11:09                6607
directoryiterator.getsize.php                      30-Sep-2022 11:09                5286
directoryiterator.gettype.php                      30-Sep-2022 11:09                6401
directoryiterator.isdir.php                        30-Sep-2022 11:09                6216
directoryiterator.isdot.php                        30-Sep-2022 11:09                6371
directoryiterator.isexecutable.php                 30-Sep-2022 11:09                6043
directoryiterator.isfile.php                       30-Sep-2022 11:09                6411
directoryiterator.islink.php                       30-Sep-2022 11:09                8040
directoryiterator.isreadable.php                   30-Sep-2022 11:09                5819
directoryiterator.iswritable.php                   30-Sep-2022 11:09                6161
directoryiterator.key.php                          30-Sep-2022 11:09                7269
directoryiterator.next.php                         30-Sep-2022 11:09                6096
directoryiterator.rewind.php                       30-Sep-2022 11:09                5909
directoryiterator.seek.php                         30-Sep-2022 11:09                5957
directoryiterator.tostring.php                     30-Sep-2022 11:09                5015
directoryiterator.valid.php                        30-Sep-2022 11:09                6247
doc.changelog.php                                  30-Sep-2022 11:09              338242
dom.configuration.php                              30-Sep-2022 11:09                1351
dom.constants.php                                  30-Sep-2022 11:09               15527
dom.examples.php                                   30-Sep-2022 11:09                3147
dom.installation.php                               30-Sep-2022 11:09                1407
dom.requirements.php                               30-Sep-2022 11:09                1653
dom.resources.php                                  30-Sep-2022 11:09                1297
dom.setup.php                                      30-Sep-2022 11:09                1619
domattr.construct.php                              30-Sep-2022 11:09                5925
domattr.isid.php                                   30-Sep-2022 11:09                5710
domcdatasection.construct.php                      30-Sep-2022 11:09                5433
domcharacterdata.appenddata.php                    30-Sep-2022 11:09                3983
domcharacterdata.deletedata.php                    30-Sep-2022 11:09                5215
domcharacterdata.insertdata.php                    30-Sep-2022 11:09                4840
domcharacterdata.replacedata.php                   30-Sep-2022 11:09                5609
domcharacterdata.substringdata.php                 30-Sep-2022 11:09                5190
domchildnode.after.php                             30-Sep-2022 11:09                3819
domchildnode.before.php                            30-Sep-2022 11:09                3578
domchildnode.remove.php                            30-Sep-2022 11:09                3354
domchildnode.replacewith.php                       30-Sep-2022 11:09                4030
domcomment.construct.php                           30-Sep-2022 11:09                5384
domdocument.construct.php                          30-Sep-2022 11:09                4473
domdocument.createattribute.php                    30-Sep-2022 11:09                6482
domdocument.createattributens.php                  30-Sep-2022 11:09                7428
domdocument.createcdatasection.php                 30-Sep-2022 11:09                6130
domdocument.createcomment.php                      30-Sep-2022 11:09                6668
domdocument.createdocumentfragment.php             30-Sep-2022 11:09                6556
domdocument.createelement.php                      30-Sep-2022 11:09               12828
domdocument.createelementns.php                    30-Sep-2022 11:09               15241
domdocument.createentityreference.php              30-Sep-2022 11:09                6846
domdocument.createprocessinginstruction.php        30-Sep-2022 11:09                7140
domdocument.createtextnode.php                     30-Sep-2022 11:09                6650
domdocument.getelementbyid.php                     30-Sep-2022 11:09                8345
domdocument.getelementsbytagname.php               30-Sep-2022 11:09                6830
domdocument.getelementsbytagnamens.php             30-Sep-2022 11:09                8304
domdocument.importnode.php                         30-Sep-2022 11:09                9744
domdocument.load.php                               30-Sep-2022 11:09                7088
domdocument.loadhtml.php                           30-Sep-2022 11:09                8210
domdocument.loadhtmlfile.php                       30-Sep-2022 11:09                7678
domdocument.loadxml.php                            30-Sep-2022 11:09                7653
domdocument.normalizedocument.php                  30-Sep-2022 11:09                3255
domdocument.registernodeclass.php                  30-Sep-2022 11:09               22962
domdocument.relaxngvalidate.php                    30-Sep-2022 11:09                4374
domdocument.relaxngvalidatesource.php              30-Sep-2022 11:09                4431
domdocument.save.php                               30-Sep-2022 11:09                8158
domdocument.savehtml.php                           30-Sep-2022 11:09                7971
domdocument.savehtmlfile.php                       30-Sep-2022 11:09                8578
domdocument.savexml.php                            30-Sep-2022 11:09                9667
domdocument.schemavalidate.php                     30-Sep-2022 11:09                4887
domdocument.schemavalidatesource.php               30-Sep-2022 11:09                4926
domdocument.validate.php                           30-Sep-2022 11:09                6766
domdocument.xinclude.php                           30-Sep-2022 11:09                7696
domdocumentfragment.appendxml.php                  30-Sep-2022 11:09                5878
domdocumentfragment.construct.php                  30-Sep-2022 11:09                2137
domelement.construct.php                           30-Sep-2022 11:09                7130
domelement.getattribute.php                        30-Sep-2022 11:09                3705
domelement.getattributenode.php                    30-Sep-2022 11:09                4240
domelement.getattributenodens.php                  30-Sep-2022 11:09                4696
domelement.getattributens.php                      30-Sep-2022 11:09                4276
domelement.getelementsbytagname.php                30-Sep-2022 11:09                4009
domelement.getelementsbytagnamens.php              30-Sep-2022 11:09                4800
domelement.hasattribute.php                        30-Sep-2022 11:09                4027
domelement.hasattributens.php                      30-Sep-2022 11:09                4397
domelement.removeattribute.php                     30-Sep-2022 11:09                4136
domelement.removeattributenode.php                 30-Sep-2022 11:09                4605
domelement.removeattributens.php                   30-Sep-2022 11:09                4574
domelement.setattribute.php                        30-Sep-2022 11:09                6394
domelement.setattributenode.php                    30-Sep-2022 11:09                4270
domelement.setattributenodens.php                  30-Sep-2022 11:09                4259
domelement.setattributens.php                      30-Sep-2022 11:09                5325
domelement.setidattribute.php                      30-Sep-2022 11:09                5094
domelement.setidattributenode.php                  30-Sep-2022 11:09                5178
domelement.setidattributens.php                    30-Sep-2022 11:09                5576
domentityreference.construct.php                   30-Sep-2022 11:09                5015
domimplementation.construct.php                    30-Sep-2022 11:09                2204
domimplementation.createdocument.php               30-Sep-2022 11:09                7462
domimplementation.createdocumenttype.php           30-Sep-2022 11:09               10077
domimplementation.hasfeature.php                   30-Sep-2022 11:09               10229
domnamednodemap.count.php                          30-Sep-2022 11:09                2516
domnamednodemap.getnameditem.php                   30-Sep-2022 11:09                3503
domnamednodemap.getnameditemns.php                 30-Sep-2022 11:09                3983
domnamednodemap.item.php                           30-Sep-2022 11:09                3101
domnode.appendchild.php                            30-Sep-2022 11:09                9532
domnode.c14n.php                                   30-Sep-2022 11:09                4666
domnode.c14nfile.php                               30-Sep-2022 11:09                4937
domnode.clonenode.php                              30-Sep-2022 11:09                2768
domnode.getlineno.php                              30-Sep-2022 11:09                5239
domnode.getnodepath.php                            30-Sep-2022 11:09                5474
domnode.hasattributes.php                          30-Sep-2022 11:09                3060
domnode.haschildnodes.php                          30-Sep-2022 11:09                2957
domnode.insertbefore.php                           30-Sep-2022 11:09                5817
domnode.isdefaultnamespace.php                     30-Sep-2022 11:09                2992
domnode.issamenode.php                             30-Sep-2022 11:09                2960
domnode.issupported.php                            30-Sep-2022 11:09                3952
domnode.lookupnamespaceuri.php                     30-Sep-2022 11:09                3185
domnode.lookupprefix.php                           30-Sep-2022 11:09                3184
domnode.normalize.php                              30-Sep-2022 11:09                3055
domnode.removechild.php                            30-Sep-2022 11:09                7443
domnode.replacechild.php                           30-Sep-2022 11:09                6307
domnodelist.count.php                              30-Sep-2022 11:09                2412
domnodelist.item.php                               30-Sep-2022 11:09                7161
domparentnode.append.php                           30-Sep-2022 11:09                3333
domparentnode.prepend.php                          30-Sep-2022 11:09                3354
domprocessinginstruction.construct.php             30-Sep-2022 11:09                7070
domtext.construct.php                              30-Sep-2022 11:09                5062
domtext.iselementcontentwhitespace.php             30-Sep-2022 11:09                2650
domtext.iswhitespaceinelementcontent.php           30-Sep-2022 11:09                2951
domtext.splittext.php                              30-Sep-2022 11:09                3580
domxpath.construct.php                             30-Sep-2022 11:09                2845
domxpath.evaluate.php                              30-Sep-2022 11:09                8310
domxpath.query.php                                 30-Sep-2022 11:09               13199
domxpath.registernamespace.php                     30-Sep-2022 11:09                3249
domxpath.registerphpfunctions.php                  30-Sep-2022 11:09               15139
dotnet.construct.php                               30-Sep-2022 11:09                2924
ds-collection.clear.php                            30-Sep-2022 11:09                4228
ds-collection.copy.php                             30-Sep-2022 11:09                4586
ds-collection.isempty.php                          30-Sep-2022 11:09                4482
ds-collection.toarray.php                          30-Sep-2022 11:09                4348
ds-deque.allocate.php                              30-Sep-2022 11:09                5277
ds-deque.apply.php                                 30-Sep-2022 11:09                5444
ds-deque.capacity.php                              30-Sep-2022 11:09                4202
ds-deque.clear.php                                 30-Sep-2022 11:09                4217
ds-deque.construct.php                             30-Sep-2022 11:09                4647
ds-deque.contains.php                              30-Sep-2022 11:09                8029
ds-deque.copy.php                                  30-Sep-2022 11:09                4597
ds-deque.count.php                                 30-Sep-2022 11:09                1629
ds-deque.filter.php                                30-Sep-2022 11:09                8225
ds-deque.find.php                                  30-Sep-2022 11:09                5840
ds-deque.first.php                                 30-Sep-2022 11:09                4280
ds-deque.get.php                                   30-Sep-2022 11:09                7180
ds-deque.insert.php                                30-Sep-2022 11:09                7609
ds-deque.isempty.php                               30-Sep-2022 11:09                4465
ds-deque.join.php                                  30-Sep-2022 11:09                6253
ds-deque.jsonserialize.php                         30-Sep-2022 11:09                1899
ds-deque.last.php                                  30-Sep-2022 11:09                4306
ds-deque.map.php                                   30-Sep-2022 11:09                6063
ds-deque.merge.php                                 30-Sep-2022 11:09                5515
ds-deque.pop.php                                   30-Sep-2022 11:09                4705
ds-deque.push.php                                  30-Sep-2022 11:09                5109
ds-deque.reduce.php                                30-Sep-2022 11:09                9332
ds-deque.remove.php                                30-Sep-2022 11:09                5275
ds-deque.reverse.php                               30-Sep-2022 11:09                4063
ds-deque.reversed.php                              30-Sep-2022 11:09                4479
ds-deque.rotate.php                                30-Sep-2022 11:09                5609
ds-deque.set.php                                   30-Sep-2022 11:09                6724
ds-deque.shift.php                                 30-Sep-2022 11:09                4797
ds-deque.slice.php                                 30-Sep-2022 11:09                8092
ds-deque.sort.php                                  30-Sep-2022 11:09                8186
ds-deque.sorted.php                                30-Sep-2022 11:09                8384
ds-deque.sum.php                                   30-Sep-2022 11:09                5742
ds-deque.toarray.php                               30-Sep-2022 11:09                4327
ds-deque.unshift.php                               30-Sep-2022 11:09                5286
ds-hashable.equals.php                             30-Sep-2022 11:09                3925
ds-hashable.hash.php                               30-Sep-2022 11:09               10129
ds-map.allocate.php                                30-Sep-2022 11:09                5169
ds-map.apply.php                                   30-Sep-2022 11:09                6242
ds-map.capacity.php                                30-Sep-2022 11:09                3499
ds-map.clear.php                                   30-Sep-2022 11:09                4756
ds-map.construct.php                               30-Sep-2022 11:09                5189
ds-map.copy.php                                    30-Sep-2022 11:09                4491
ds-map.count.php                                   30-Sep-2022 11:09                1618
ds-map.diff.php                                    30-Sep-2022 11:09                6298
ds-map.filter.php                                  30-Sep-2022 11:09                9079
ds-map.first.php                                   30-Sep-2022 11:09                4497
ds-map.get.php                                     30-Sep-2022 11:09                9781
ds-map.haskey.php                                  30-Sep-2022 11:09                4959
ds-map.hasvalue.php                                30-Sep-2022 11:09                5020
ds-map.intersect.php                               30-Sep-2022 11:09                6836
ds-map.isempty.php                                 30-Sep-2022 11:09                4669
ds-map.jsonserialize.php                           30-Sep-2022 11:09                1885
ds-map.keys.php                                    30-Sep-2022 11:09                4342
ds-map.ksort.php                                   30-Sep-2022 11:09                9014
ds-map.ksorted.php                                 30-Sep-2022 11:09                9178
ds-map.last.php                                    30-Sep-2022 11:09                4491
ds-map.map.php                                     30-Sep-2022 11:09                6962
ds-map.merge.php                                   30-Sep-2022 11:09                6449
ds-map.pairs.php                                   30-Sep-2022 11:09                4737
ds-map.put.php                                     30-Sep-2022 11:09               16249
ds-map.putall.php                                  30-Sep-2022 11:09                6080
ds-map.reduce.php                                  30-Sep-2022 11:09               10417
ds-map.remove.php                                  30-Sep-2022 11:09                8172
ds-map.reverse.php                                 30-Sep-2022 11:09                4515
ds-map.reversed.php                                30-Sep-2022 11:09                4643
ds-map.skip.php                                    30-Sep-2022 11:09                4984
ds-map.slice.php                                   30-Sep-2022 11:09                9072
ds-map.sort.php                                    30-Sep-2022 11:09                8840
ds-map.sorted.php                                  30-Sep-2022 11:09                9099
ds-map.sum.php                                     30-Sep-2022 11:09                6197
ds-map.toarray.php                                 30-Sep-2022 11:09                5456
ds-map.union.php                                   30-Sep-2022 11:09                6627
ds-map.values.php                                  30-Sep-2022 11:09                4385
ds-map.xor.php                                     30-Sep-2022 11:09                6352
ds-pair.clear.php                                  30-Sep-2022 11:09                4021
ds-pair.construct.php                              30-Sep-2022 11:09                2757
ds-pair.copy.php                                   30-Sep-2022 11:09                4357
ds-pair.isempty.php                                30-Sep-2022 11:09                4326
ds-pair.jsonserialize.php                          30-Sep-2022 11:09                1865
ds-pair.toarray.php                                30-Sep-2022 11:09                4075
ds-priorityqueue.allocate.php                      30-Sep-2022 11:09                5436
ds-priorityqueue.capacity.php                      30-Sep-2022 11:09                3687
ds-priorityqueue.clear.php                         30-Sep-2022 11:09                4816
ds-priorityqueue.construct.php                     30-Sep-2022 11:09                3123
ds-priorityqueue.copy.php                          30-Sep-2022 11:09                4825
ds-priorityqueue.count.php                         30-Sep-2022 11:09                1710
ds-priorityqueue.isempty.php                       30-Sep-2022 11:09                5303
ds-priorityqueue.jsonserialize.php                 30-Sep-2022 11:09                2008
ds-priorityqueue.peek.php                          30-Sep-2022 11:09                5160
ds-priorityqueue.pop.php                           30-Sep-2022 11:09                6027
ds-priorityqueue.push.php                          30-Sep-2022 11:09                5963
ds-priorityqueue.toarray.php                       30-Sep-2022 11:09                5394
ds-queue.allocate.php                              30-Sep-2022 11:09                5515
ds-queue.capacity.php                              30-Sep-2022 11:09                4182
ds-queue.clear.php                                 30-Sep-2022 11:09                4116
ds-queue.construct.php                             30-Sep-2022 11:09                4618
ds-queue.copy.php                                  30-Sep-2022 11:09                4670
ds-queue.count.php                                 30-Sep-2022 11:09                1577
ds-queue.isempty.php                               30-Sep-2022 11:09                4385
ds-queue.jsonserialize.php                         30-Sep-2022 11:09                1878
ds-queue.peek.php                                  30-Sep-2022 11:09                4730
ds-queue.pop.php                                   30-Sep-2022 11:09                5268
ds-queue.push.php                                  30-Sep-2022 11:09                5046
ds-queue.toarray.php                               30-Sep-2022 11:09                4466
ds-sequence.allocate.php                           30-Sep-2022 11:09                5056
ds-sequence.apply.php                              30-Sep-2022 11:09                5556
ds-sequence.capacity.php                           30-Sep-2022 11:09                4759
ds-sequence.contains.php                           30-Sep-2022 11:09                8093
ds-sequence.filter.php                             30-Sep-2022 11:09                8357
ds-sequence.find.php                               30-Sep-2022 11:09                5945
ds-sequence.first.php                              30-Sep-2022 11:09                4286
ds-sequence.get.php                                30-Sep-2022 11:09                7300
ds-sequence.insert.php                             30-Sep-2022 11:09                7694
ds-sequence.join.php                               30-Sep-2022 11:09                6339
ds-sequence.last.php                               30-Sep-2022 11:09                4294
ds-sequence.map.php                                30-Sep-2022 11:09                6042
ds-sequence.merge.php                              30-Sep-2022 11:09                5509
ds-sequence.pop.php                                30-Sep-2022 11:09                4809
ds-sequence.push.php                               30-Sep-2022 11:09                5207
ds-sequence.reduce.php                             30-Sep-2022 11:09                9440
ds-sequence.remove.php                             30-Sep-2022 11:09                5379
ds-sequence.reverse.php                            30-Sep-2022 11:09                4116
ds-sequence.reversed.php                           30-Sep-2022 11:09                4496
ds-sequence.rotate.php                             30-Sep-2022 11:09                5716
ds-sequence.set.php                                30-Sep-2022 11:09                6840
ds-sequence.shift.php                              30-Sep-2022 11:09                4878
ds-sequence.slice.php                              30-Sep-2022 11:09                8239
ds-sequence.sort.php                               30-Sep-2022 11:09                8252
ds-sequence.sorted.php                             30-Sep-2022 11:09                8430
ds-sequence.sum.php                                30-Sep-2022 11:09                5755
ds-sequence.unshift.php                            30-Sep-2022 11:09                5364
ds-set.add.php                                     30-Sep-2022 11:09               14179
ds-set.allocate.php                                30-Sep-2022 11:09                4939
ds-set.capacity.php                                30-Sep-2022 11:09                4132
ds-set.clear.php                                   30-Sep-2022 11:09                4090
ds-set.construct.php                               30-Sep-2022 11:09                4594
ds-set.contains.php                                30-Sep-2022 11:09                8090
ds-set.copy.php                                    30-Sep-2022 11:09                4625
ds-set.count.php                                   30-Sep-2022 11:09                1577
ds-set.diff.php                                    30-Sep-2022 11:09                5395
ds-set.filter.php                                  30-Sep-2022 11:09                8049
ds-set.first.php                                   30-Sep-2022 11:09                4118
ds-set.get.php                                     30-Sep-2022 11:09                7095
ds-set.intersect.php                               30-Sep-2022 11:09                5393
ds-set.isempty.php                                 30-Sep-2022 11:09                4331
ds-set.join.php                                    30-Sep-2022 11:09                6173
ds-set.jsonserialize.php                           30-Sep-2022 11:09                1842
ds-set.last.php                                    30-Sep-2022 11:09                4144
ds-set.merge.php                                   30-Sep-2022 11:09                5282
ds-set.reduce.php                                  30-Sep-2022 11:09                9262
ds-set.remove.php                                  30-Sep-2022 11:09                5682
ds-set.reverse.php                                 30-Sep-2022 11:09                3940
ds-set.reversed.php                                30-Sep-2022 11:09                4300
ds-set.slice.php                                   30-Sep-2022 11:09                8067
ds-set.sort.php                                    30-Sep-2022 11:09                8051
ds-set.sorted.php                                  30-Sep-2022 11:09                8224
ds-set.sum.php                                     30-Sep-2022 11:09                5569
ds-set.toarray.php                                 30-Sep-2022 11:09                4181
ds-set.union.php                                   30-Sep-2022 11:09                5399
ds-set.xor.php                                     30-Sep-2022 11:09                5552
ds-stack.allocate.php                              30-Sep-2022 11:09                3122
ds-stack.capacity.php                              30-Sep-2022 11:09                2225
ds-stack.clear.php                                 30-Sep-2022 11:09                4134
ds-stack.construct.php                             30-Sep-2022 11:09                4603
ds-stack.copy.php                                  30-Sep-2022 11:09                4676
ds-stack.count.php                                 30-Sep-2022 11:09                1607
ds-stack.isempty.php                               30-Sep-2022 11:09                4382
ds-stack.jsonserialize.php                         30-Sep-2022 11:09                1868
ds-stack.peek.php                                  30-Sep-2022 11:09                4712
ds-stack.pop.php                                   30-Sep-2022 11:09                5250
ds-stack.push.php                                  30-Sep-2022 11:09                5027
ds-stack.toarray.php                               30-Sep-2022 11:09                4206
ds-vector.allocate.php                             30-Sep-2022 11:09                4978
ds-vector.apply.php                                30-Sep-2022 11:09                5430
ds-vector.capacity.php                             30-Sep-2022 11:09                4642
ds-vector.clear.php                                30-Sep-2022 11:09                4139
ds-vector.construct.php                            30-Sep-2022 11:09                4648
ds-vector.contains.php                             30-Sep-2022 11:09                7968
ds-vector.copy.php                                 30-Sep-2022 11:09                4688
ds-vector.count.php                                30-Sep-2022 11:09                1586
ds-vector.filter.php                               30-Sep-2022 11:09                8139
ds-vector.find.php                                 30-Sep-2022 11:09                5835
ds-vector.first.php                                30-Sep-2022 11:09                4161
ds-vector.get.php                                  30-Sep-2022 11:09                7181
ds-vector.insert.php                               30-Sep-2022 11:09                7577
ds-vector.isempty.php                              30-Sep-2022 11:09                4363
ds-vector.join.php                                 30-Sep-2022 11:09                6246
ds-vector.jsonserialize.php                        30-Sep-2022 11:09                1877
ds-vector.last.php                                 30-Sep-2022 11:09                4191
ds-vector.map.php                                  30-Sep-2022 11:09                5915
ds-vector.merge.php                                30-Sep-2022 11:09                5387
ds-vector.pop.php                                  30-Sep-2022 11:09                4696
ds-vector.push.php                                 30-Sep-2022 11:09                5052
ds-vector.reduce.php                               30-Sep-2022 11:09                9314
ds-vector.remove.php                               30-Sep-2022 11:09                5270
ds-vector.reverse.php                              30-Sep-2022 11:09                3999
ds-vector.reversed.php                             30-Sep-2022 11:09                4367
ds-vector.rotate.php                               30-Sep-2022 11:09                5513
ds-vector.set.php                                  30-Sep-2022 11:09                6725
ds-vector.shift.php                                30-Sep-2022 11:09                4761
ds-vector.slice.php                                30-Sep-2022 11:09                8001
ds-vector.sort.php                                 30-Sep-2022 11:09                8128
ds-vector.sorted.php                               30-Sep-2022 11:09                8319
ds-vector.sum.php                                  30-Sep-2022 11:09                5646
ds-vector.toarray.php                              30-Sep-2022 11:09                4250
ds-vector.unshift.php                              30-Sep-2022 11:09                5217
ds.constants.php                                   30-Sep-2022 11:09                1231
ds.examples.php                                    30-Sep-2022 11:09                5090
ds.installation.php                                30-Sep-2022 11:09                2826
ds.requirements.php                                30-Sep-2022 11:09                1253
ds.setup.php                                       30-Sep-2022 11:09                1450
eio.configuration.php                              30-Sep-2022 11:09                1349
eio.constants.php                                  30-Sep-2022 11:09               17735
eio.examples.php                                   30-Sep-2022 11:09               30812
eio.installation.php                               30-Sep-2022 11:09                1977
eio.requirements.php                               30-Sep-2022 11:09                1380
eio.resources.php                                  30-Sep-2022 11:09                1301
eio.setup.php                                      30-Sep-2022 11:09                1631
emptyiterator.current.php                          30-Sep-2022 11:09                3039
emptyiterator.key.php                              30-Sep-2022 11:09                2999
emptyiterator.next.php                             30-Sep-2022 11:09                2624
emptyiterator.rewind.php                           30-Sep-2022 11:09                2646
emptyiterator.valid.php                            30-Sep-2022 11:09                2546
enchant.configuration.php                          30-Sep-2022 11:09                1379
enchant.constants.php                              30-Sep-2022 11:09                2694
enchant.examples.php                               30-Sep-2022 11:09                5914
enchant.installation.php                           30-Sep-2022 11:09                3944
enchant.requirements.php                           30-Sep-2022 11:09                2009
enchant.resources.php                              30-Sep-2022 11:09                1445
enchant.setup.php                                  30-Sep-2022 11:09                1676
error.clone.php                                    30-Sep-2022 11:08                3121
error.construct.php                                30-Sep-2022 11:08                3648
error.getcode.php                                  30-Sep-2022 11:08                4290
error.getfile.php                                  30-Sep-2022 11:08                4075
error.getline.php                                  30-Sep-2022 11:08                4444
error.getmessage.php                               30-Sep-2022 11:08                4156
error.getprevious.php                              30-Sep-2022 11:08                7324
error.gettrace.php                                 30-Sep-2022 11:08                4535
error.gettraceasstring.php                         30-Sep-2022 11:08                4467
error.tostring.php                                 30-Sep-2022 11:08                4240
errorexception.construct.php                       30-Sep-2022 11:08                5893
errorexception.getseverity.php                     30-Sep-2022 11:08                4733
errorfunc.configuration.php                        30-Sep-2022 11:08               29431
errorfunc.constants.php                            30-Sep-2022 11:08               12837
errorfunc.examples.php                             30-Sep-2022 11:08               25985
errorfunc.installation.php                         30-Sep-2022 11:08                1395
errorfunc.requirements.php                         30-Sep-2022 11:08                1286
errorfunc.resources.php                            30-Sep-2022 11:08                1339
errorfunc.setup.php                                30-Sep-2022 11:08                1708
ev.backend.php                                     30-Sep-2022 11:09                3889
ev.configuration.php                               30-Sep-2022 11:09                1344
ev.depth.php                                       30-Sep-2022 11:09                3587
ev.embeddablebackends.php                          30-Sep-2022 11:09                7674
ev.examples.php                                    30-Sep-2022 11:09               51614
ev.feedsignal.php                                  30-Sep-2022 11:09                3880
ev.feedsignalevent.php                             30-Sep-2022 11:09                3421
ev.global.constants.php                            30-Sep-2022 11:09                1438
ev.installation.php                                30-Sep-2022 11:09                1945
ev.iteration.php                                   30-Sep-2022 11:09                2948
ev.now.php                                         30-Sep-2022 11:09                3434
ev.nowupdate.php                                   30-Sep-2022 11:09                3644
ev.periodic-modes.php                              30-Sep-2022 11:09                9537
ev.recommendedbackends.php                         30-Sep-2022 11:09                8707
ev.requirements.php                                30-Sep-2022 11:09                1307
ev.resources.php                                   30-Sep-2022 11:09                1297
ev.resume.php                                      30-Sep-2022 11:09                4464
ev.run.php                                         30-Sep-2022 11:09                5664
ev.setup.php                                       30-Sep-2022 11:09                1586
ev.sleep.php                                       30-Sep-2022 11:09                2534
ev.stop.php                                        30-Sep-2022 11:09                3093
ev.supportedbackends.php                           30-Sep-2022 11:09                7624
ev.suspend.php                                     30-Sep-2022 11:09                4083
ev.time.php                                        30-Sep-2022 11:09                2995
ev.verify.php                                      30-Sep-2022 11:09                2490
ev.watcher-callbacks.php                           30-Sep-2022 11:09                4993
ev.watchers.php                                    30-Sep-2022 11:09                4307
evcheck.construct.php                              30-Sep-2022 11:09                3841
evcheck.createstopped.php                          30-Sep-2022 11:09                3836
evchild.construct.php                              30-Sep-2022 11:09                7649
evchild.createstopped.php                          30-Sep-2022 11:09                5313
evchild.set.php                                    30-Sep-2022 11:09                3245
evembed.construct.php                              30-Sep-2022 11:09                9535
evembed.createstopped.php                          30-Sep-2022 11:09                5180
evembed.set.php                                    30-Sep-2022 11:09                2646
evembed.sweep.php                                  30-Sep-2022 11:09                3421
event.add.php                                      30-Sep-2022 11:09               12160
event.addsignal.php                                30-Sep-2022 11:09                1678
event.addtimer.php                                 30-Sep-2022 11:09                1687
event.callbacks.php                                30-Sep-2022 11:09                6126
event.configuration.php                            30-Sep-2022 11:09                1365
event.construct.php                                30-Sep-2022 11:09                5350
event.constructing.signal.events.php               30-Sep-2022 11:09                7413
event.del.php                                      30-Sep-2022 11:09                2825
event.delsignal.php                                30-Sep-2022 11:09                1677
event.deltimer.php                                 30-Sep-2022 11:09                1674
event.examples.php                                 30-Sep-2022 11:09              204200
event.flags.php                                    30-Sep-2022 11:09                2903
event.free.php                                     30-Sep-2022 11:09                3377
event.getsupportedmethods.php                      30-Sep-2022 11:09                2795
event.installation.php                             30-Sep-2022 11:09                1968
event.pending.php                                  30-Sep-2022 11:09                3089
event.persistence.php                              30-Sep-2022 11:09                3922
event.requirements.php                             30-Sep-2022 11:09                1617
event.resources.php                                30-Sep-2022 11:09                1273
event.set.php                                      30-Sep-2022 11:09                5189
event.setpriority.php                              30-Sep-2022 11:09                2577
event.settimer.php                                 30-Sep-2022 11:09                4731
event.setup.php                                    30-Sep-2022 11:09                1625
event.signal.php                                   30-Sep-2022 11:09                4913
event.timer.php                                    30-Sep-2022 11:09                4202
eventbase.construct.php                            30-Sep-2022 11:09                2943
eventbase.dispatch.php                             30-Sep-2022 11:09                3616
eventbase.exit.php                                 30-Sep-2022 11:09                3324
eventbase.free.php                                 30-Sep-2022 11:09                3726
eventbase.getfeatures.php                          30-Sep-2022 11:09                6374
eventbase.getmethod.php                            30-Sep-2022 11:09                5075
eventbase.gettimeofdaycached.php                   30-Sep-2022 11:09                3039
eventbase.gotexit.php                              30-Sep-2022 11:09                3615
eventbase.gotstop.php                              30-Sep-2022 11:09                3602
eventbase.loop.php                                 30-Sep-2022 11:09                3846
eventbase.priorityinit.php                         30-Sep-2022 11:09                3191
eventbase.reinit.php                               30-Sep-2022 11:09                2504
eventbase.stop.php                                 30-Sep-2022 11:09                3051
eventbuffer.add.php                                30-Sep-2022 11:09                3130
eventbuffer.addbuffer.php                          30-Sep-2022 11:09                3645
eventbuffer.appendfrom.php                         30-Sep-2022 11:09                5429
eventbuffer.construct.php                          30-Sep-2022 11:09                2245
eventbuffer.copyout.php                            30-Sep-2022 11:09                4229
eventbuffer.drain.php                              30-Sep-2022 11:09                3750
eventbuffer.enablelocking.php                      30-Sep-2022 11:09                3261
eventbuffer.expand.php                             30-Sep-2022 11:09                3009
eventbuffer.freeze.php                             30-Sep-2022 11:09                3346
eventbuffer.lock.php                               30-Sep-2022 11:09                3527
eventbuffer.prepend.php                            30-Sep-2022 11:09                3708
eventbuffer.prependbuffer.php                      30-Sep-2022 11:09                3959
eventbuffer.pullup.php                             30-Sep-2022 11:09                5343
eventbuffer.read.php                               30-Sep-2022 11:09                5542
eventbuffer.readfrom.php                           30-Sep-2022 11:09                4829
eventbuffer.readline.php                           30-Sep-2022 11:09                4745
eventbuffer.search.php                             30-Sep-2022 11:09                9423
eventbuffer.searcheol.php                          30-Sep-2022 11:09                5252
eventbuffer.substr.php                             30-Sep-2022 11:09                3687
eventbuffer.unfreeze.php                           30-Sep-2022 11:09                3333
eventbuffer.unlock.php                             30-Sep-2022 11:09                2959
eventbuffer.write.php                              30-Sep-2022 11:09                3761
eventbufferevent.about.callbacks.php               30-Sep-2022 11:09                6353
eventbufferevent.close.php                         30-Sep-2022 11:09                2747
eventbufferevent.connect.php                       30-Sep-2022 11:09               28494
eventbufferevent.connecthost.php                   30-Sep-2022 11:09               19964
eventbufferevent.construct.php                     30-Sep-2022 11:09                7747
eventbufferevent.createpair.php                    30-Sep-2022 11:09                4429
eventbufferevent.disable.php                       30-Sep-2022 11:09                3456
eventbufferevent.enable.php                        30-Sep-2022 11:09                3723
eventbufferevent.free.php                          30-Sep-2022 11:09                3272
eventbufferevent.getdnserrorstring.php             30-Sep-2022 11:09                3483
eventbufferevent.getenabled.php                    30-Sep-2022 11:09                3596
eventbufferevent.getinput.php                      30-Sep-2022 11:09                5679
eventbufferevent.getoutput.php                     30-Sep-2022 11:09                9047
eventbufferevent.read.php                          30-Sep-2022 11:09                3274
eventbufferevent.readbuffer.php                    30-Sep-2022 11:09                3358
eventbufferevent.setcallbacks.php                  30-Sep-2022 11:09                5139
eventbufferevent.setpriority.php                   30-Sep-2022 11:09                3010
eventbufferevent.settimeouts.php                   30-Sep-2022 11:09                3251
eventbufferevent.setwatermark.php                  30-Sep-2022 11:09                4457
eventbufferevent.sslerror.php                      30-Sep-2022 11:09                6911
eventbufferevent.sslfilter.php                     30-Sep-2022 11:09               41936
eventbufferevent.sslgetcipherinfo.php              30-Sep-2022 11:09                3161
eventbufferevent.sslgetciphername.php              30-Sep-2022 11:09                2985
eventbufferevent.sslgetcipherversion.php           30-Sep-2022 11:09                3067
eventbufferevent.sslgetprotocol.php                30-Sep-2022 11:09                2968
eventbufferevent.sslrenegotiate.php                30-Sep-2022 11:09                3258
eventbufferevent.sslsocket.php                     30-Sep-2022 11:09                6043
eventbufferevent.write.php                         30-Sep-2022 11:09                3356
eventbufferevent.writebuffer.php                   30-Sep-2022 11:09                3569
eventconfig.avoidmethod.php                        30-Sep-2022 11:09                4767
eventconfig.construct.php                          30-Sep-2022 11:09                4864
eventconfig.requirefeatures.php                    30-Sep-2022 11:09                6695
eventconfig.setflags.php                           30-Sep-2022 11:09                3612
eventconfig.setmaxdispatchinterval.php             30-Sep-2022 11:09                5130
eventdnsbase.addnameserverip.php                   30-Sep-2022 11:09                2978
eventdnsbase.addsearch.php                         30-Sep-2022 11:09                2677
eventdnsbase.clearsearch.php                       30-Sep-2022 11:09                3059
eventdnsbase.construct.php                         30-Sep-2022 11:09                3609
eventdnsbase.countnameservers.php                  30-Sep-2022 11:09                2841
eventdnsbase.loadhosts.php                         30-Sep-2022 11:09                2870
eventdnsbase.parseresolvconf.php                   30-Sep-2022 11:09                4641
eventdnsbase.setoption.php                         30-Sep-2022 11:09                3438
eventdnsbase.setsearchndots.php                    30-Sep-2022 11:09                3055
eventhttp.accept.php                               30-Sep-2022 11:09               14196
eventhttp.addserveralias.php                       30-Sep-2022 11:09                6867
eventhttp.bind.php                                 30-Sep-2022 11:09                8471
eventhttp.construct.php                            30-Sep-2022 11:09               20875
eventhttp.removeserveralias.php                    30-Sep-2022 11:09                3362
eventhttp.setallowedmethods.php                    30-Sep-2022 11:09                3750
eventhttp.setcallback.php                          30-Sep-2022 11:09               20862
eventhttp.setdefaultcallback.php                   30-Sep-2022 11:09                8508
eventhttp.setmaxbodysize.php                       30-Sep-2022 11:09                3165
eventhttp.setmaxheaderssize.php                    30-Sep-2022 11:09                3027
eventhttp.settimeout.php                           30-Sep-2022 11:09                2658
eventhttpconnection.construct.php                  30-Sep-2022 11:09                5576
eventhttpconnection.getbase.php                    30-Sep-2022 11:09                2812
eventhttpconnection.getpeer.php                    30-Sep-2022 11:09                3161
eventhttpconnection.makerequest.php                30-Sep-2022 11:09               13068
eventhttpconnection.setclosecallback.php           30-Sep-2022 11:09               12827
eventhttpconnection.setlocaladdress.php            30-Sep-2022 11:09                3476
eventhttpconnection.setlocalport.php               30-Sep-2022 11:09                3294
eventhttpconnection.setmaxbodysize.php             30-Sep-2022 11:09                3412
eventhttpconnection.setmaxheaderssize.php          30-Sep-2022 11:09                3447
eventhttpconnection.setretries.php                 30-Sep-2022 11:09                2998
eventhttpconnection.settimeout.php                 30-Sep-2022 11:09                2793
eventhttprequest.addheader.php                     30-Sep-2022 11:09                3977
eventhttprequest.cancel.php                        30-Sep-2022 11:09                3301
eventhttprequest.clearheaders.php                  30-Sep-2022 11:09                3057
eventhttprequest.closeconnection.php               30-Sep-2022 11:09                2543
eventhttprequest.construct.php                     30-Sep-2022 11:09               13124
eventhttprequest.findheader.php                    30-Sep-2022 11:09                3578
eventhttprequest.free.php                          30-Sep-2022 11:09                2490
eventhttprequest.getbufferevent.php                30-Sep-2022 11:09                4159
eventhttprequest.getcommand.php                    30-Sep-2022 11:09                2820
eventhttprequest.getconnection.php                 30-Sep-2022 11:09                5034
eventhttprequest.gethost.php                       30-Sep-2022 11:09                3007
eventhttprequest.getinputbuffer.php                30-Sep-2022 11:09                2939
eventhttprequest.getinputheaders.php               30-Sep-2022 11:09                3084
eventhttprequest.getoutputbuffer.php               30-Sep-2022 11:09                3000
eventhttprequest.getoutputheaders.php              30-Sep-2022 11:09                3019
eventhttprequest.getresponsecode.php               30-Sep-2022 11:09                3309
eventhttprequest.geturi.php                        30-Sep-2022 11:09                3222
eventhttprequest.removeheader.php                  30-Sep-2022 11:09                3587
eventhttprequest.senderror.php                     30-Sep-2022 11:09                6033
eventhttprequest.sendreply.php                     30-Sep-2022 11:09                4309
eventhttprequest.sendreplychunk.php                30-Sep-2022 11:09                3890
eventhttprequest.sendreplyend.php                  30-Sep-2022 11:09                3432
eventhttprequest.sendreplystart.php                30-Sep-2022 11:09                4828
eventlistener.construct.php                        30-Sep-2022 11:09               29052
eventlistener.disable.php                          30-Sep-2022 11:09                2989
eventlistener.enable.php                           30-Sep-2022 11:09                2974
eventlistener.getbase.php                          30-Sep-2022 11:09                2511
eventlistener.getsocketname.php                    30-Sep-2022 11:09                3501
eventlistener.setcallback.php                      30-Sep-2022 11:09                6152
eventlistener.seterrorcallback.php                 30-Sep-2022 11:09                4535
eventsslcontext.construct.php                      30-Sep-2022 11:09                6111
eventutil.construct.php                            30-Sep-2022 11:09                2559
eventutil.getlastsocketerrno.php                   30-Sep-2022 11:09                3541
eventutil.getlastsocketerror.php                   30-Sep-2022 11:09                3396
eventutil.getsocketfd.php                          30-Sep-2022 11:09                3489
eventutil.getsocketname.php                        30-Sep-2022 11:09                3991
eventutil.setsocketoption.php                      30-Sep-2022 11:09                6097
eventutil.sslrandpoll.php                          30-Sep-2022 11:09                2553
evfork.construct.php                               30-Sep-2022 11:09                3889
evfork.createstopped.php                           30-Sep-2022 11:09                4052
evidle.construct.php                               30-Sep-2022 11:09                4002
evidle.createstopped.php                           30-Sep-2022 11:09                4464
evio.construct.php                                 30-Sep-2022 11:09                5157
evio.createstopped.php                             30-Sep-2022 11:09                5552
evio.set.php                                       30-Sep-2022 11:09                2969
evloop.backend.php                                 30-Sep-2022 11:09                2930
evloop.check.php                                   30-Sep-2022 11:09                3352
evloop.child.php                                   30-Sep-2022 11:09                3705
evloop.construct.php                               30-Sep-2022 11:09                4158
evloop.defaultloop.php                             30-Sep-2022 11:09                4973
evloop.embed.php                                   30-Sep-2022 11:09                3807
evloop.fork.php                                    30-Sep-2022 11:09                3584
evloop.idle.php                                    30-Sep-2022 11:09                3600
evloop.invokepending.php                           30-Sep-2022 11:09                2460
evloop.io.php                                      30-Sep-2022 11:09                4036
evloop.loopfork.php                                30-Sep-2022 11:09                2883
evloop.now.php                                     30-Sep-2022 11:09                3215
evloop.nowupdate.php                               30-Sep-2022 11:09                3528
evloop.periodic.php                                30-Sep-2022 11:09                4081
evloop.prepare.php                                 30-Sep-2022 11:09                3606
evloop.resume.php                                  30-Sep-2022 11:09                3166
evloop.run.php                                     30-Sep-2022 11:09                5624
evloop.signal.php                                  30-Sep-2022 11:09                3868
evloop.stat.php                                    30-Sep-2022 11:09                3990
evloop.stop.php                                    30-Sep-2022 11:09                3202
evloop.suspend.php                                 30-Sep-2022 11:09                3107
evloop.timer.php                                   30-Sep-2022 11:09                4007
evloop.verify.php                                  30-Sep-2022 11:09                2932
evperiodic.again.php                               30-Sep-2022 11:09                2854
evperiodic.at.php                                  30-Sep-2022 11:09                2904
evperiodic.construct.php                           30-Sep-2022 11:09               11070
evperiodic.createstopped.php                       30-Sep-2022 11:09                6351
evperiodic.set.php                                 30-Sep-2022 11:09                3363
evprepare.construct.php                            30-Sep-2022 11:09                3480
evprepare.createstopped.php                        30-Sep-2022 11:09                4615
evsignal.construct.php                             30-Sep-2022 11:09                5882
evsignal.createstopped.php                         30-Sep-2022 11:09                5198
evsignal.set.php                                   30-Sep-2022 11:09                2576
evstat.attr.php                                    30-Sep-2022 11:09                9643
evstat.construct.php                               30-Sep-2022 11:09                7853
evstat.createstopped.php                           30-Sep-2022 11:09                5616
evstat.prev.php                                    30-Sep-2022 11:09                3230
evstat.set.php                                     30-Sep-2022 11:09                3005
evstat.stat.php                                    30-Sep-2022 11:09                3209
evtimer.again.php                                  30-Sep-2022 11:09                3593
evtimer.construct.php                              30-Sep-2022 11:09               15493
evtimer.createstopped.php                          30-Sep-2022 11:09                9313
evtimer.set.php                                    30-Sep-2022 11:09                3267
evwatcher.clear.php                                30-Sep-2022 11:09                3368
evwatcher.construct.php                            30-Sep-2022 11:09                2258
evwatcher.feed.php                                 30-Sep-2022 11:09                2772
evwatcher.getloop.php                              30-Sep-2022 11:09                2477
evwatcher.invoke.php                               30-Sep-2022 11:09                2819
evwatcher.keepalive.php                            30-Sep-2022 11:09                5749
evwatcher.setcallback.php                          30-Sep-2022 11:09                2806
evwatcher.start.php                                30-Sep-2022 11:09                2801
evwatcher.stop.php                                 30-Sep-2022 11:09                2772
example.xml-external-entity.php                    30-Sep-2022 11:09               26857
example.xml-map-tags.php                           30-Sep-2022 11:09                9430
example.xml-structure.php                          30-Sep-2022 11:09                7138
example.xmlwriter-namespace.php                    30-Sep-2022 11:09                5745
example.xmlwriter-oop.php                          30-Sep-2022 11:09                3657
example.xmlwriter-simple.php                       30-Sep-2022 11:09                9190
exception.clone.php                                30-Sep-2022 11:08                3175
exception.construct.php                            30-Sep-2022 11:08                3883
exception.getcode.php                              30-Sep-2022 11:08                4884
exception.getfile.php                              30-Sep-2022 11:08                4191
exception.getline.php                              30-Sep-2022 11:08                4589
exception.getmessage.php                           30-Sep-2022 11:08                4331
exception.getprevious.php                          30-Sep-2022 11:08                7621
exception.gettrace.php                             30-Sep-2022 11:08                4672
exception.gettraceasstring.php                     30-Sep-2022 11:08                4603
exception.tostring.php                             30-Sep-2022 11:08                4419
exec.configuration.php                             30-Sep-2022 11:09                1358
exec.constants.php                                 30-Sep-2022 11:09                1276
exec.installation.php                              30-Sep-2022 11:09                1360
exec.requirements.php                              30-Sep-2022 11:09                1251
exec.resources.php                                 30-Sep-2022 11:09                1447
exec.setup.php                                     30-Sep-2022 11:09                1659
exif.configuration.php                             30-Sep-2022 11:09                8843
exif.constants.php                                 30-Sep-2022 11:09                2257
exif.installation.php                              30-Sep-2022 11:09                1866
exif.requirements.php                              30-Sep-2022 11:09                2047
exif.resources.php                                 30-Sep-2022 11:09                1304
exif.setup.php                                     30-Sep-2022 11:09                1643
expect.configuration.php                           30-Sep-2022 11:09                6028
expect.constants.php                               30-Sep-2022 11:09                3841
expect.examples-usage.php                          30-Sep-2022 11:09               17692
expect.examples.php                                30-Sep-2022 11:09                1453
expect.installation.php                            30-Sep-2022 11:09                2667
expect.requirements.php                            30-Sep-2022 11:09                1394
expect.resources.php                               30-Sep-2022 11:09                1514
expect.setup.php                                   30-Sep-2022 11:09                1668
ext-weakmap.construct.php                          30-Sep-2022 11:08                1949
extensions.alphabetical.php                        30-Sep-2022 11:09               21086
extensions.membership.php                          30-Sep-2022 11:09               21193
extensions.php                                     30-Sep-2022 11:09                1869
extensions.state.php                               30-Sep-2022 11:09                3023
fann.configuration.php                             30-Sep-2022 11:09                1358
fann.constants.php                                 30-Sep-2022 11:09               22165
fann.examples-1.php                                30-Sep-2022 11:09                9289
fann.examples.php                                  30-Sep-2022 11:09                1369
fann.installation.php                              30-Sep-2022 11:09                6156
fann.requirements.php                              30-Sep-2022 11:09                1192
fann.resources.php                                 30-Sep-2022 11:09                1208
fann.setup.php                                     30-Sep-2022 11:09                1616
fannconnection.construct.php                       30-Sep-2022 11:09                2944
fannconnection.getfromneuron.php                   30-Sep-2022 11:09                2432
fannconnection.gettoneuron.php                     30-Sep-2022 11:09                2404
fannconnection.getweight.php                       30-Sep-2022 11:09                2319
fannconnection.setweight.php                       30-Sep-2022 11:09                3014
faq.build.php                                      30-Sep-2022 11:09               29660
faq.com.php                                        30-Sep-2022 11:09               15341
faq.databases.php                                  30-Sep-2022 11:09               10269
faq.general.php                                    30-Sep-2022 11:09                6038
faq.html.php                                       30-Sep-2022 11:09               24781
faq.installation.php                               30-Sep-2022 11:09               31687
faq.mailinglist.php                                30-Sep-2022 11:09               15310
faq.misc.php                                       30-Sep-2022 11:09                5576
faq.obtaining.php                                  30-Sep-2022 11:09               12395
faq.passwords.php                                  30-Sep-2022 11:09               13821
faq.php                                            30-Sep-2022 11:09                2248
faq.using.php                                      30-Sep-2022 11:09               28223
fdf.configuration.php                              30-Sep-2022 11:09                1351
fdf.constants.php                                  30-Sep-2022 11:09                6556
fdf.examples.php                                   30-Sep-2022 11:09                6810
fdf.installation.php                               30-Sep-2022 11:09                4201
fdf.requirements.php                               30-Sep-2022 11:09                1674
fdf.resources.php                                  30-Sep-2022 11:09                1877
fdf.setup.php                                      30-Sep-2022 11:09                1624
features.commandline.differences.php               30-Sep-2022 11:08               14525
features.commandline.ini.php                       30-Sep-2022 11:08                2408
features.commandline.interactive.php               30-Sep-2022 11:08               11193
features.commandline.introduction.php              30-Sep-2022 11:08                8518
features.commandline.io-streams.php                30-Sep-2022 11:08                6899
features.commandline.options.php                   30-Sep-2022 11:08               31238
features.commandline.php                           30-Sep-2022 11:08                2317
features.commandline.usage.php                     30-Sep-2022 11:08               18353
features.commandline.webserver.php                 30-Sep-2022 11:08               15903
features.connection-handling.php                   30-Sep-2022 11:08                7883
features.cookies.php                               30-Sep-2022 11:08                3744
features.dtrace.dtrace.php                         30-Sep-2022 11:08               16506
features.dtrace.introduction.php                   30-Sep-2022 11:08                5172
features.dtrace.php                                30-Sep-2022 11:08                1808
features.dtrace.systemtap.php                      30-Sep-2022 11:08                8585
features.file-upload.common-pitfalls.php           30-Sep-2022 11:08                7532
features.file-upload.errors.php                    30-Sep-2022 11:08                4648
features.file-upload.errors.seealso.php            30-Sep-2022 11:08                1457
features.file-upload.multiple.php                  30-Sep-2022 11:08                8087
features.file-upload.php                           30-Sep-2022 11:08                2113
features.file-upload.post-method.php               30-Sep-2022 11:08               21030
features.file-upload.put-method.php                30-Sep-2022 11:08                7482
features.gc.collecting-cycles.php                  30-Sep-2022 11:08               10702
features.gc.performance-considerations.php         30-Sep-2022 11:08               16909
features.gc.php                                    30-Sep-2022 11:08                1989
features.gc.refcounting-basics.php                 30-Sep-2022 11:08               25663
features.http-auth.php                             30-Sep-2022 11:08               28308
features.persistent-connections.php                30-Sep-2022 11:08               14539
features.php                                       30-Sep-2022 11:08                4782
features.remote-files.php                          30-Sep-2022 11:08               10169
features.session.security.management.php           30-Sep-2022 11:09               35915
features.sessions.php                              30-Sep-2022 11:08                1600
features.xforms.php                                30-Sep-2022 11:08                6999
ffi-ctype.getalignment.php                         30-Sep-2022 11:08                2461
ffi-ctype.getarrayelementtype.php                  30-Sep-2022 11:08                2605
ffi-ctype.getarraylength.php                       30-Sep-2022 11:08                2504
ffi-ctype.getattributes.php                        30-Sep-2022 11:08                2480
ffi-ctype.getenumkind.php                          30-Sep-2022 11:08                2456
ffi-ctype.getfuncabi.php                           30-Sep-2022 11:08                2464
ffi-ctype.getfuncparametercount.php                30-Sep-2022 11:08                2570
ffi-ctype.getfuncparametertype.php                 30-Sep-2022 11:08                2791
ffi-ctype.getfuncreturntype.php                    30-Sep-2022 11:08                2587
ffi-ctype.getkind.php                              30-Sep-2022 11:08                2418
ffi-ctype.getname.php                              30-Sep-2022 11:08                2422
ffi-ctype.getpointertype.php                       30-Sep-2022 11:08                2531
ffi-ctype.getsize.php                              30-Sep-2022 11:08                2436
ffi-ctype.getstructfieldnames.php                  30-Sep-2022 11:08                2546
ffi-ctype.getstructfieldoffset.php                 30-Sep-2022 11:08                2727
ffi-ctype.getstructfieldtype.php                   30-Sep-2022 11:08                2747
ffi.addr.php                                       30-Sep-2022 11:08                3120
ffi.alignof.php                                    30-Sep-2022 11:08                3054
ffi.arraytype.php                                  30-Sep-2022 11:08                4751
ffi.cast.php                                       30-Sep-2022 11:08                5454
ffi.cdef.php                                       30-Sep-2022 11:08                4802
ffi.configuration.php                              30-Sep-2022 11:08                4836
ffi.constants.php                                  30-Sep-2022 11:08                1214
ffi.examples-basic.php                             30-Sep-2022 11:08               18374
ffi.examples-callback.php                          30-Sep-2022 11:08                5515
ffi.examples-complete.php                          30-Sep-2022 11:08                5883
ffi.examples.php                                   30-Sep-2022 11:08                1632
ffi.free.php                                       30-Sep-2022 11:08                2630
ffi.installation.php                               30-Sep-2022 11:08                1523
ffi.isnull.php                                     30-Sep-2022 11:08                2666
ffi.load.php                                       30-Sep-2022 11:08                5056
ffi.memcmp.php                                     30-Sep-2022 11:08                3945
ffi.memcpy.php                                     30-Sep-2022 11:08                3418
ffi.memset.php                                     30-Sep-2022 11:08                3214
ffi.new.php                                        30-Sep-2022 11:08                6035
ffi.requirements.php                               30-Sep-2022 11:08                1330
ffi.resources.php                                  30-Sep-2022 11:08                1297
ffi.scope.php                                      30-Sep-2022 11:08                3609
ffi.setup.php                                      30-Sep-2022 11:08                1614
ffi.sizeof.php                                     30-Sep-2022 11:08                2850
ffi.string.php                                     30-Sep-2022 11:08                4008
ffi.type.php                                       30-Sep-2022 11:08                3855
ffi.typeof.php                                     30-Sep-2022 11:08                2949
fiber.construct.php                                30-Sep-2022 11:08                2500
fiber.getcurrent.php                               30-Sep-2022 11:08                2556
fiber.getreturn.php                                30-Sep-2022 11:08                2888
fiber.isrunning.php                                30-Sep-2022 11:08                2752
fiber.isstarted.php                                30-Sep-2022 11:08                2322
fiber.issuspended.php                              30-Sep-2022 11:08                2353
fiber.isterminated.php                             30-Sep-2022 11:08                2431
fiber.resume.php                                   30-Sep-2022 11:08                3746
fiber.start.php                                    30-Sep-2022 11:08                3491
fiber.suspend.php                                  30-Sep-2022 11:08                4588
fiber.throw.php                                    30-Sep-2022 11:08                3587
fileinfo.configuration.php                         30-Sep-2022 11:09                1386
fileinfo.constants.php                             30-Sep-2022 11:09                5718
fileinfo.installation.php                          30-Sep-2022 11:09                2125
fileinfo.requirements.php                          30-Sep-2022 11:09                1279
fileinfo.resources.php                             30-Sep-2022 11:09                1539
fileinfo.setup.php                                 30-Sep-2022 11:09                1689
filesystem.configuration.php                       30-Sep-2022 11:09                8488
filesystem.constants.php                           30-Sep-2022 11:09                9714
filesystem.installation.php                        30-Sep-2022 11:09                1402
filesystem.requirements.php                        30-Sep-2022 11:09                1293
filesystem.resources.php                           30-Sep-2022 11:09                1615
filesystem.setup.php                               30-Sep-2022 11:09                1736
filesystemiterator.construct.php                   30-Sep-2022 11:09                7847
filesystemiterator.current.php                     30-Sep-2022 11:09                5868
filesystemiterator.getflags.php                    30-Sep-2022 11:09                3498
filesystemiterator.key.php                         30-Sep-2022 11:09                5733
filesystemiterator.next.php                        30-Sep-2022 11:09                4963
filesystemiterator.rewind.php                      30-Sep-2022 11:09                5521
filesystemiterator.setflags.php                    30-Sep-2022 11:09                7308
filter.configuration.php                           30-Sep-2022 11:09                6003
filter.constants.php                               30-Sep-2022 11:09               20519
filter.examples.php                                30-Sep-2022 11:09                1543
filter.examples.sanitization.php                   30-Sep-2022 11:09                6453
filter.examples.validation.php                     30-Sep-2022 11:09               11527
filter.filters.flags.php                           30-Sep-2022 11:09               13246
filter.filters.misc.php                            30-Sep-2022 11:09                2090
filter.filters.php                                 30-Sep-2022 11:09                1739
filter.filters.sanitize.php                        30-Sep-2022 11:09               11840
filter.filters.validate.php                        30-Sep-2022 11:09               13335
filter.installation.php                            30-Sep-2022 11:09                1380
filter.requirements.php                            30-Sep-2022 11:09                1265
filter.resources.php                               30-Sep-2022 11:09                1290
filter.setup.php                                   30-Sep-2022 11:09                1653
filteriterator.accept.php                          30-Sep-2022 11:09                5854
filteriterator.construct.php                       30-Sep-2022 11:09                3410
filteriterator.current.php                         30-Sep-2022 11:09                3419
filteriterator.getinneriterator.php                30-Sep-2022 11:09                2763
filteriterator.key.php                             30-Sep-2022 11:09                3317
filteriterator.next.php                            30-Sep-2022 11:09                3339
filteriterator.rewind.php                          30-Sep-2022 11:09                3547
filteriterator.valid.php                           30-Sep-2022 11:09                2786
filters.compression.php                            30-Sep-2022 11:09               19705
filters.convert.php                                30-Sep-2022 11:09               13265
filters.encryption.php                             30-Sep-2022 11:09               46834
filters.php                                        30-Sep-2022 11:09                4502
filters.string.php                                 30-Sep-2022 11:09               11380
finfo.buffer.php                                   30-Sep-2022 11:09                2484
finfo.construct.php                                30-Sep-2022 11:09                2874
finfo.file.php                                     30-Sep-2022 11:09                2475
finfo.set-flags.php                                30-Sep-2022 11:09                2001
fpm.observability.php                              30-Sep-2022 11:09                1457
fpm.setup.php                                      30-Sep-2022 11:09                1365
fpm.status.php                                     30-Sep-2022 11:09               13432
ftp.configuration.php                              30-Sep-2022 11:09                1351
ftp.constants.php                                  30-Sep-2022 11:09                4631
ftp.examples-basic.php                             30-Sep-2022 11:09                5746
ftp.examples.php                                   30-Sep-2022 11:09                1409
ftp.installation.php                               30-Sep-2022 11:09                1569
ftp.requirements.php                               30-Sep-2022 11:09                1244
ftp.resources.php                                  30-Sep-2022 11:09                1625
ftp.setup.php                                      30-Sep-2022 11:09                1624
funchand.configuration.php                         30-Sep-2022 11:09                1386
funchand.constants.php                             30-Sep-2022 11:09                1320
funchand.installation.php                          30-Sep-2022 11:09                1388
funchand.requirements.php                          30-Sep-2022 11:09                1279
funchand.resources.php                             30-Sep-2022 11:09                1332
funchand.setup.php                                 30-Sep-2022 11:09                1699
funcref.php                                        30-Sep-2022 11:09               16424
function.abs.php                                   30-Sep-2022 11:09                5557
function.acos.php                                  30-Sep-2022 11:09                3675
function.acosh.php                                 30-Sep-2022 11:09                3482
function.addcslashes.php                           30-Sep-2022 11:09                9279
function.addslashes.php                            30-Sep-2022 11:09                7315
function.apache-child-terminate.php                30-Sep-2022 11:09                3976
function.apache-get-modules.php                    30-Sep-2022 11:09                3576
function.apache-get-version.php                    30-Sep-2022 11:09                4073
function.apache-getenv.php                         30-Sep-2022 11:09                5669
function.apache-lookup-uri.php                     30-Sep-2022 11:09                6431
function.apache-note.php                           30-Sep-2022 11:09                7935
function.apache-request-headers.php                30-Sep-2022 11:09                6432
function.apache-response-headers.php               30-Sep-2022 11:09                4752
function.apache-setenv.php                         30-Sep-2022 11:09                6206
function.apcu-add.php                              30-Sep-2022 11:08                9278
function.apcu-cache-info.php                       30-Sep-2022 11:08                7245
function.apcu-cas.php                              30-Sep-2022 11:08                9277
function.apcu-clear-cache.php                      30-Sep-2022 11:08                2648
function.apcu-dec.php                              30-Sep-2022 11:08                8808
function.apcu-delete.php                           30-Sep-2022 11:08                6445
function.apcu-enabled.php                          30-Sep-2022 11:08                2411
function.apcu-entry.php                            30-Sep-2022 11:08               10088
function.apcu-exists.php                           30-Sep-2022 11:08                7481
function.apcu-fetch.php                            30-Sep-2022 11:08                6261
function.apcu-inc.php                              30-Sep-2022 11:08                8807
function.apcu-key-info.php                         30-Sep-2022 11:08                5135
function.apcu-sma-info.php                         30-Sep-2022 11:08                4746
function.apcu-store.php                            30-Sep-2022 11:08                8002
function.array-change-key-case.php                 30-Sep-2022 11:09                6255
function.array-chunk.php                           30-Sep-2022 11:09                8222
function.array-column.php                          30-Sep-2022 11:09               19753
function.array-combine.php                         30-Sep-2022 11:09                7760
function.array-count-values.php                    30-Sep-2022 11:09                6247
function.array-diff-assoc.php                      30-Sep-2022 11:09               12667
function.array-diff-key.php                        30-Sep-2022 11:09               14615
function.array-diff-uassoc.php                     30-Sep-2022 11:09               13456
function.array-diff-ukey.php                       30-Sep-2022 11:09               13690
function.array-diff.php                            30-Sep-2022 11:09               13993
function.array-fill-keys.php                       30-Sep-2022 11:09                5871
function.array-fill.php                            30-Sep-2022 11:09               10140
function.array-filter.php                          30-Sep-2022 11:09               18493
function.array-flip.php                            30-Sep-2022 11:09                8009
function.array-intersect-assoc.php                 30-Sep-2022 11:09               10376
function.array-intersect-key.php                   30-Sep-2022 11:09               11930
function.array-intersect-uassoc.php                30-Sep-2022 11:09                9507
function.array-intersect-ukey.php                  30-Sep-2022 11:09               13294
function.array-intersect.php                       30-Sep-2022 11:09                7766
function.array-is-list.php                         30-Sep-2022 11:09                7603
function.array-key-exists.php                      30-Sep-2022 11:09                9573
function.array-key-first.php                       30-Sep-2022 11:09                7916
function.array-key-last.php                        30-Sep-2022 11:09                3475
function.array-keys.php                            30-Sep-2022 11:09                9426
function.array-map.php                             30-Sep-2022 11:09               30795
function.array-merge-recursive.php                 30-Sep-2022 11:09                7888
function.array-merge.php                           30-Sep-2022 11:09               14365
function.array-multisort.php                       30-Sep-2022 11:09               26930
function.array-pad.php                             30-Sep-2022 11:09                7885
function.array-pop.php                             30-Sep-2022 11:09                6199
function.array-product.php                         30-Sep-2022 11:09                4549
function.array-push.php                            30-Sep-2022 11:09                8069
function.array-rand.php                            30-Sep-2022 11:09                7673
function.array-reduce.php                          30-Sep-2022 11:09               11266
function.array-replace-recursive.php               30-Sep-2022 11:09               12602
function.array-replace.php                         30-Sep-2022 11:09                7923
function.array-reverse.php                         30-Sep-2022 11:09                6473
function.array-search.php                          30-Sep-2022 11:09                9306
function.array-shift.php                           30-Sep-2022 11:09                6353
function.array-slice.php                           30-Sep-2022 11:09               15460
function.array-splice.php                          30-Sep-2022 11:09               19932
function.array-sum.php                             30-Sep-2022 11:09                5298
function.array-udiff-assoc.php                     30-Sep-2022 11:09               16429
function.array-udiff-uassoc.php                    30-Sep-2022 11:09               18050
function.array-udiff.php                           30-Sep-2022 11:09               31394
function.array-uintersect-assoc.php                30-Sep-2022 11:09                9054
function.array-uintersect-uassoc.php               30-Sep-2022 11:09                9513
function.array-uintersect.php                      30-Sep-2022 11:09                8460
function.array-unique.php                          30-Sep-2022 11:09               10757
function.array-unshift.php                         30-Sep-2022 11:09                7035
function.array-values.php                          30-Sep-2022 11:09                5030
function.array-walk-recursive.php                  30-Sep-2022 11:09                8401
function.array-walk.php                            30-Sep-2022 11:09               15818
function.array.php                                 30-Sep-2022 11:09               13922
function.arsort.php                                30-Sep-2022 11:09                9582
function.asin.php                                  30-Sep-2022 11:09                3661
function.asinh.php                                 30-Sep-2022 11:09                3464
function.asort.php                                 30-Sep-2022 11:09                9569
function.assert-options.php                        30-Sep-2022 11:08               13202
function.assert.php                                30-Sep-2022 11:08               31941
function.atan.php                                  30-Sep-2022 11:09                3678
function.atan2.php                                 30-Sep-2022 11:09                3551
function.atanh.php                                 30-Sep-2022 11:09                3498
function.autoload.php                              30-Sep-2022 11:09                3599
function.base-convert.php                          30-Sep-2022 11:09                7769
function.base64-decode.php                         30-Sep-2022 11:09                5374
function.base64-encode.php                         30-Sep-2022 11:09                5201
function.basename.php                              30-Sep-2022 11:09                8493
function.bcadd.php                                 30-Sep-2022 11:09                6154
function.bccomp.php                                30-Sep-2022 11:09                5919
function.bcdiv.php                                 30-Sep-2022 11:09                5589
function.bcmod.php                                 30-Sep-2022 11:09                7903
function.bcmul.php                                 30-Sep-2022 11:09                7916
function.bcpow.php                                 30-Sep-2022 11:09                8070
function.bcpowmod.php                              30-Sep-2022 11:09                8011
function.bcscale.php                               30-Sep-2022 11:09                6026
function.bcsqrt.php                                30-Sep-2022 11:09                5315
function.bcsub.php                                 30-Sep-2022 11:09                6141
function.bin2hex.php                               30-Sep-2022 11:09                4913
function.bind-textdomain-codeset.php               30-Sep-2022 11:09                4752
function.bindec.php                                30-Sep-2022 11:09               17882
function.bindtextdomain.php                        30-Sep-2022 11:09                5767
function.boolval.php                               30-Sep-2022 11:09               11294
function.bzclose.php                               30-Sep-2022 11:08                3167
function.bzcompress.php                            30-Sep-2022 11:08                5591
function.bzdecompress.php                          30-Sep-2022 11:08                6806
function.bzerrno.php                               30-Sep-2022 11:08                3368
function.bzerror.php                               30-Sep-2022 11:08                4702
function.bzerrstr.php                              30-Sep-2022 11:08                3384
function.bzflush.php                               30-Sep-2022 11:08                3633
function.bzopen.php                                30-Sep-2022 11:08                5284
function.bzread.php                                30-Sep-2022 11:08                7048
function.bzwrite.php                               30-Sep-2022 11:08                6640
function.cal-days-in-month.php                     30-Sep-2022 11:09                4823
function.cal-from-jd.php                           30-Sep-2022 11:09                7870
function.cal-info.php                              30-Sep-2022 11:09                6267
function.cal-to-jd.php                             30-Sep-2022 11:09                6506
function.call-user-func-array.php                  30-Sep-2022 11:09               15344
function.call-user-func.php                        30-Sep-2022 11:09               16371
function.ceil.php                                  30-Sep-2022 11:09                5321
function.chdir.php                                 30-Sep-2022 11:09                6154
function.checkdate.php                             30-Sep-2022 11:09                6038
function.checkdnsrr.php                            30-Sep-2022 11:09                5717
function.chgrp.php                                 30-Sep-2022 11:09                7236
function.chmod.php                                 30-Sep-2022 11:09               10985
function.chop.php                                  30-Sep-2022 11:09                2189
function.chown.php                                 30-Sep-2022 11:09                7487
function.chr.php                                   30-Sep-2022 11:09                9971
function.chroot.php                                30-Sep-2022 11:09                5165
function.chunk-split.php                           30-Sep-2022 11:09                5722
function.class-alias.php                           30-Sep-2022 11:09                7978
function.class-exists.php                          30-Sep-2022 11:09                7676
function.class-implements.php                      30-Sep-2022 11:09                6996
function.class-parents.php                         30-Sep-2022 11:09                6614
function.class-uses.php                            30-Sep-2022 11:09                6794
function.clearstatcache.php                        30-Sep-2022 11:09               12170
function.cli-get-process-title.php                 30-Sep-2022 11:08                4939
function.cli-set-process-title.php                 30-Sep-2022 11:08                6285
function.closedir.php                              30-Sep-2022 11:09                5450
function.closelog.php                              30-Sep-2022 11:09                3281
function.com-create-guid.php                       30-Sep-2022 11:09                3047
function.com-event-sink.php                        30-Sep-2022 11:09               11596
function.com-get-active-object.php                 30-Sep-2022 11:09                6316
function.com-load-typelib.php                      30-Sep-2022 11:09                6019
function.com-message-pump.php                      30-Sep-2022 11:09                4575
function.com-print-typeinfo.php                    30-Sep-2022 11:09                5430
function.commonmark-parse.php                      30-Sep-2022 11:09                3672
function.commonmark-render-html.php                30-Sep-2022 11:09                4139
function.commonmark-render-latex.php               30-Sep-2022 11:09                4409
function.commonmark-render-man.php                 30-Sep-2022 11:09                4391
function.commonmark-render-xml.php                 30-Sep-2022 11:09                4096
function.commonmark-render.php                     30-Sep-2022 11:09                4337
function.compact.php                               30-Sep-2022 11:09                8947
function.connection-aborted.php                    30-Sep-2022 11:09                3341
function.connection-status.php                     30-Sep-2022 11:09                3474
function.constant.php                              30-Sep-2022 11:09                8474
function.convert-cyr-string.php                    30-Sep-2022 11:09                5562
function.convert-uudecode.php                      30-Sep-2022 11:09                4827
function.convert-uuencode.php                      30-Sep-2022 11:09                6120
function.copy.php                                  30-Sep-2022 11:09                6472
function.cos.php                                   30-Sep-2022 11:09                4149
function.cosh.php                                  30-Sep-2022 11:09                3390
function.count-chars.php                           30-Sep-2022 11:09                8482
function.count.php                                 30-Sep-2022 11:09               18161
function.crc32.php                                 30-Sep-2022 11:09                8414
function.create-function.php                       30-Sep-2022 11:09               36546
function.crypt.php                                 30-Sep-2022 11:09               23113
function.ctype-alnum.php                           30-Sep-2022 11:09                7762
function.ctype-alpha.php                           30-Sep-2022 11:09                8238
function.ctype-cntrl.php                           30-Sep-2022 11:09                7809
function.ctype-digit.php                           30-Sep-2022 11:09               10256
function.ctype-graph.php                           30-Sep-2022 11:09                8679
function.ctype-lower.php                           30-Sep-2022 11:09                8006
function.ctype-print.php                           30-Sep-2022 11:09                8712
function.ctype-punct.php                           30-Sep-2022 11:09                7937
function.ctype-space.php                           30-Sep-2022 11:09                8977
function.ctype-upper.php                           30-Sep-2022 11:09                8026
function.ctype-xdigit.php                          30-Sep-2022 11:09                7688
function.cubrid-affected-rows.php                  30-Sep-2022 11:09               10031
function.cubrid-bind.php                           30-Sep-2022 11:09               22740
function.cubrid-client-encoding.php                30-Sep-2022 11:09                5693
function.cubrid-close-prepare.php                  30-Sep-2022 11:09                7000
function.cubrid-close-request.php                  30-Sep-2022 11:09                7007
function.cubrid-close.php                          30-Sep-2022 11:09                7127
function.cubrid-col-get.php                        30-Sep-2022 11:09                8990
function.cubrid-col-size.php                       30-Sep-2022 11:09                9088
function.cubrid-column-names.php                   30-Sep-2022 11:09                9070
function.cubrid-column-types.php                   30-Sep-2022 11:09                9036
function.cubrid-commit.php                         30-Sep-2022 11:09               16903
function.cubrid-connect-with-url.php               30-Sep-2022 11:09               17814
function.cubrid-connect.php                        30-Sep-2022 11:09               13303
function.cubrid-current-oid.php                    30-Sep-2022 11:09                6362
function.cubrid-data-seek.php                      30-Sep-2022 11:09                7757
function.cubrid-db-name.php                        30-Sep-2022 11:09                6911
function.cubrid-disconnect.php                     30-Sep-2022 11:09                8037
function.cubrid-drop.php                           30-Sep-2022 11:09               11952
function.cubrid-errno.php                          30-Sep-2022 11:09                7402
function.cubrid-error-code-facility.php            30-Sep-2022 11:09                6217
function.cubrid-error-code.php                     30-Sep-2022 11:09                6253
function.cubrid-error-msg.php                      30-Sep-2022 11:09                5646
function.cubrid-error.php                          30-Sep-2022 11:09                6927
function.cubrid-execute.php                        30-Sep-2022 11:09               16037
function.cubrid-fetch-array.php                    30-Sep-2022 11:09               11134
function.cubrid-fetch-assoc.php                    30-Sep-2022 11:09               10269
function.cubrid-fetch-field.php                    30-Sep-2022 11:09               15777
function.cubrid-fetch-lengths.php                  30-Sep-2022 11:09                6465
function.cubrid-fetch-object.php                   30-Sep-2022 11:09               13196
function.cubrid-fetch-row.php                      30-Sep-2022 11:09               10119
function.cubrid-fetch.php                          30-Sep-2022 11:09               11632
function.cubrid-field-flags.php                    30-Sep-2022 11:09                8255
function.cubrid-field-len.php                      30-Sep-2022 11:09                8874
function.cubrid-field-name.php                     30-Sep-2022 11:09                7555
function.cubrid-field-seek.php                     30-Sep-2022 11:09               12108
function.cubrid-field-table.php                    30-Sep-2022 11:09                7892
function.cubrid-field-type.php                     30-Sep-2022 11:09                7811
function.cubrid-free-result.php                    30-Sep-2022 11:09                6288
function.cubrid-get-autocommit.php                 30-Sep-2022 11:09                3991
function.cubrid-get-charset.php                    30-Sep-2022 11:09                5330
function.cubrid-get-class-name.php                 30-Sep-2022 11:09                6689
function.cubrid-get-client-info.php                30-Sep-2022 11:09                8763
function.cubrid-get-db-parameter.php               30-Sep-2022 11:09               17270
function.cubrid-get-query-timeout.php              30-Sep-2022 11:09                7071
function.cubrid-get-server-info.php                30-Sep-2022 11:09                8952
function.cubrid-get.php                            30-Sep-2022 11:09               10963
function.cubrid-insert-id.php                      30-Sep-2022 11:09                8113
function.cubrid-is-instance.php                    30-Sep-2022 11:09                8031
function.cubrid-list-dbs.php                       30-Sep-2022 11:09                4622
function.cubrid-load-from-glo.php                  30-Sep-2022 11:09                7446
function.cubrid-lob-close.php                      30-Sep-2022 11:09                7752
function.cubrid-lob-export.php                     30-Sep-2022 11:09                8342
function.cubrid-lob-get.php                        30-Sep-2022 11:09                8335
function.cubrid-lob-send.php                       30-Sep-2022 11:09                7447
function.cubrid-lob-size.php                       30-Sep-2022 11:09                6286
function.cubrid-lob2-bind.php                      30-Sep-2022 11:09               10550
function.cubrid-lob2-close.php                     30-Sep-2022 11:09                3618
function.cubrid-lob2-export.php                    30-Sep-2022 11:09                9535
function.cubrid-lob2-import.php                    30-Sep-2022 11:09                9391
function.cubrid-lob2-new.php                       30-Sep-2022 11:09                4227
function.cubrid-lob2-read.php                      30-Sep-2022 11:09               15181
function.cubrid-lob2-seek.php                      30-Sep-2022 11:09               12604
function.cubrid-lob2-seek64.php                    30-Sep-2022 11:09               14375
function.cubrid-lob2-size.php                      30-Sep-2022 11:09                4743
function.cubrid-lob2-size64.php                    30-Sep-2022 11:09                5058
function.cubrid-lob2-tell.php                      30-Sep-2022 11:09                4759
function.cubrid-lob2-tell64.php                    30-Sep-2022 11:09                5096
function.cubrid-lob2-write.php                     30-Sep-2022 11:09               15049
function.cubrid-lock-read.php                      30-Sep-2022 11:09                9733
function.cubrid-lock-write.php                     30-Sep-2022 11:09               10148
function.cubrid-move-cursor.php                    30-Sep-2022 11:09               10402
function.cubrid-new-glo.php                        30-Sep-2022 11:09                7569
function.cubrid-next-result.php                    30-Sep-2022 11:09               18301
function.cubrid-num-cols.php                       30-Sep-2022 11:09                6543
function.cubrid-num-fields.php                     30-Sep-2022 11:09                6118
function.cubrid-num-rows.php                       30-Sep-2022 11:09                8014
function.cubrid-pconnect-with-url.php              30-Sep-2022 11:09               17364
function.cubrid-pconnect.php                       30-Sep-2022 11:09               13284
function.cubrid-ping.php                           30-Sep-2022 11:09                6674
function.cubrid-prepare.php                        30-Sep-2022 11:09               11364
function.cubrid-put.php                            30-Sep-2022 11:09               12576
function.cubrid-query.php                          30-Sep-2022 11:09               16991
function.cubrid-real-escape-string.php             30-Sep-2022 11:09                8780
function.cubrid-result.php                         30-Sep-2022 11:09                7908
function.cubrid-rollback.php                       30-Sep-2022 11:09               15919
function.cubrid-save-to-glo.php                    30-Sep-2022 11:09                7334
function.cubrid-schema.php                         30-Sep-2022 11:09               21386
function.cubrid-send-glo.php                       30-Sep-2022 11:09                6779
function.cubrid-seq-drop.php                       30-Sep-2022 11:09               10360
function.cubrid-seq-insert.php                     30-Sep-2022 11:09               10843
function.cubrid-seq-put.php                        30-Sep-2022 11:09               10781
function.cubrid-set-add.php                        30-Sep-2022 11:09                9982
function.cubrid-set-autocommit.php                 30-Sep-2022 11:09                4397
function.cubrid-set-db-parameter.php               30-Sep-2022 11:09                8685
function.cubrid-set-drop.php                       30-Sep-2022 11:09                9953
function.cubrid-set-query-timeout.php              30-Sep-2022 11:09                3641
function.cubrid-unbuffered-query.php               30-Sep-2022 11:09                8010
function.cubrid-version.php                        30-Sep-2022 11:09                9179
function.curl-close.php                            30-Sep-2022 11:09                6649
function.curl-copy-handle.php                      30-Sep-2022 11:09                6884
function.curl-errno.php                            30-Sep-2022 11:09                6474
function.curl-error.php                            30-Sep-2022 11:09                6493
function.curl-escape.php                           30-Sep-2022 11:09                7951
function.curl-exec.php                             30-Sep-2022 11:09                8027
function.curl-getinfo.php                          30-Sep-2022 11:09               34135
function.curl-init.php                             30-Sep-2022 11:09                7868
function.curl-multi-add-handle.php                 30-Sep-2022 11:09               10955
function.curl-multi-close.php                      30-Sep-2022 11:09               10392
function.curl-multi-errno.php                      30-Sep-2022 11:09                4019
function.curl-multi-exec.php                       30-Sep-2022 11:09               11280
function.curl-multi-getcontent.php                 30-Sep-2022 11:09                4301
function.curl-multi-info-read.php                  30-Sep-2022 11:09               13167
function.curl-multi-init.php                       30-Sep-2022 11:09                9729
function.curl-multi-remove-handle.php              30-Sep-2022 11:09                5829
function.curl-multi-select.php                     30-Sep-2022 11:09                4657
function.curl-multi-setopt.php                     30-Sep-2022 11:09               12159
function.curl-multi-strerror.php                   30-Sep-2022 11:09                7751
function.curl-pause.php                            30-Sep-2022 11:09                3851
function.curl-reset.php                            30-Sep-2022 11:09                6982
function.curl-setopt-array.php                     30-Sep-2022 11:09                8690
function.curl-setopt.php                           30-Sep-2022 11:09              152632
function.curl-share-close.php                      30-Sep-2022 11:09                9038
function.curl-share-errno.php                      30-Sep-2022 11:09                4248
function.curl-share-init.php                       30-Sep-2022 11:09                8631
function.curl-share-setopt.php                     30-Sep-2022 11:09               11444
function.curl-share-strerror.php                   30-Sep-2022 11:09                3543
function.curl-strerror.php                         30-Sep-2022 11:09                6670
function.curl-unescape.php                         30-Sep-2022 11:09                8479
function.curl-version.php                          30-Sep-2022 11:09                7944
function.curl_upkeep.php                           30-Sep-2022 11:09                7041
function.current.php                               30-Sep-2022 11:09               12237
function.date-add.php                              30-Sep-2022 11:09                1757
function.date-create-from-format.php               30-Sep-2022 11:09                1932
function.date-create-immutable-from-format.php     30-Sep-2022 11:09                2044
function.date-create-immutable.php                 30-Sep-2022 11:09                1936
function.date-create.php                           30-Sep-2022 11:09                4606
function.date-date-set.php                         30-Sep-2022 11:09                1816
function.date-default-timezone-get.php             30-Sep-2022 11:09                7747
function.date-default-timezone-set.php             30-Sep-2022 11:09                6418
function.date-diff.php                             30-Sep-2022 11:09                1776
function.date-format.php                           30-Sep-2022 11:09                1784
function.date-get-last-errors.php                  30-Sep-2022 11:09                1913
function.date-interval-create-from-date-string.php 30-Sep-2022 11:09                2060
function.date-interval-format.php                  30-Sep-2022 11:09                1911
function.date-isodate-set.php                      30-Sep-2022 11:09                1839
function.date-modify.php                           30-Sep-2022 11:09                1788
function.date-offset-get.php                       30-Sep-2022 11:09                1832
function.date-parse-from-format.php                30-Sep-2022 11:09               15655
function.date-parse.php                            30-Sep-2022 11:09               22824
function.date-sub.php                              30-Sep-2022 11:09                2495
function.date-sun-info.php                         30-Sep-2022 11:09               18367
function.date-sunrise.php                          30-Sep-2022 11:09               15216
function.date-sunset.php                           30-Sep-2022 11:09               15315
function.date-time-set.php                         30-Sep-2022 11:09                1802
function.date-timestamp-get.php                    30-Sep-2022 11:09                1861
function.date-timestamp-set.php                    30-Sep-2022 11:09                1869
function.date-timezone-get.php                     30-Sep-2022 11:09                1858
function.date-timezone-set.php                     30-Sep-2022 11:09                1830
function.date.php                                  30-Sep-2022 11:09               26293
function.db2-autocommit.php                        30-Sep-2022 11:09               12368
function.db2-bind-param.php                        30-Sep-2022 11:09               25671
function.db2-client-info.php                       30-Sep-2022 11:09               13156
function.db2-close.php                             30-Sep-2022 11:09                6192
function.db2-column-privileges.php                 30-Sep-2022 11:09                9662
function.db2-columns.php                           30-Sep-2022 11:09               11684
function.db2-commit.php                            30-Sep-2022 11:09                4111
function.db2-conn-error.php                        30-Sep-2022 11:09                7966
function.db2-conn-errormsg.php                     30-Sep-2022 11:09                7781
function.db2-connect.php                           30-Sep-2022 11:09               47717
function.db2-cursor-type.php                       30-Sep-2022 11:09                3232
function.db2-escape-string.php                     30-Sep-2022 11:09                8383
function.db2-exec.php                              30-Sep-2022 11:09               31035
function.db2-execute.php                           30-Sep-2022 11:09               30423
function.db2-fetch-array.php                       30-Sep-2022 11:09               13180
function.db2-fetch-assoc.php                       30-Sep-2022 11:09               13130
function.db2-fetch-both.php                        30-Sep-2022 11:09               13962
function.db2-fetch-object.php                      30-Sep-2022 11:09               10954
function.db2-fetch-row.php                         30-Sep-2022 11:09               18446
function.db2-field-display-size.php                30-Sep-2022 11:09                5679
function.db2-field-name.php                        30-Sep-2022 11:09                5413
function.db2-field-num.php                         30-Sep-2022 11:09                5490
function.db2-field-precision.php                   30-Sep-2022 11:09                5491
function.db2-field-scale.php                       30-Sep-2022 11:09                5441
function.db2-field-type.php                        30-Sep-2022 11:09                5491
function.db2-field-width.php                       30-Sep-2022 11:09                5865
function.db2-foreign-keys.php                      30-Sep-2022 11:09               10646
function.db2-free-result.php                       30-Sep-2022 11:09                3621
function.db2-free-stmt.php                         30-Sep-2022 11:09                3592
function.db2-get-option.php                        30-Sep-2022 11:09               27780
function.db2-last-insert-id.php                    30-Sep-2022 11:09                9634
function.db2-lob-read.php                          30-Sep-2022 11:09               18636
function.db2-next-result.php                       30-Sep-2022 11:09               10284
function.db2-num-fields.php                        30-Sep-2022 11:09                7997
function.db2-num-rows.php                          30-Sep-2022 11:09                5587
function.db2-pclose.php                            30-Sep-2022 11:09                6731
function.db2-pconnect.php                          30-Sep-2022 11:09               40005
function.db2-prepare.php                           30-Sep-2022 11:09               12994
function.db2-primary-keys.php                      30-Sep-2022 11:09                8843
function.db2-procedure-columns.php                 30-Sep-2022 11:09               14160
function.db2-procedures.php                        30-Sep-2022 11:09                9551
function.db2-result.php                            30-Sep-2022 11:09                9106
function.db2-rollback.php                          30-Sep-2022 11:09               10486
function.db2-server-info.php                       30-Sep-2022 11:09               27536
function.db2-set-option.php                        30-Sep-2022 11:09               71249
function.db2-special-columns.php                   30-Sep-2022 11:09               12292
function.db2-statistics.php                        30-Sep-2022 11:09               15304
function.db2-stmt-error.php                        30-Sep-2022 11:09                5044
function.db2-stmt-errormsg.php                     30-Sep-2022 11:09                4620
function.db2-table-privileges.php                  30-Sep-2022 11:09                9746
function.db2-tables.php                            30-Sep-2022 11:09                9648
function.dba-close.php                             30-Sep-2022 11:09                3439
function.dba-delete.php                            30-Sep-2022 11:09                4253
function.dba-exists.php                            30-Sep-2022 11:09                4225
function.dba-fetch.php                             30-Sep-2022 11:09                6149
function.dba-firstkey.php                          30-Sep-2022 11:09                3922
function.dba-handlers.php                          30-Sep-2022 11:09                6148
function.dba-insert.php                            30-Sep-2022 11:09                4946
function.dba-key-split.php                         30-Sep-2022 11:09                3973
function.dba-list.php                              30-Sep-2022 11:09                2337
function.dba-nextkey.php                           30-Sep-2022 11:09                3808
function.dba-open.php                              30-Sep-2022 11:09               13669
function.dba-optimize.php                          30-Sep-2022 11:09                3263
function.dba-popen.php                             30-Sep-2022 11:09                7639
function.dba-replace.php                           30-Sep-2022 11:09                4759
function.dba-sync.php                              30-Sep-2022 11:09                3335
function.dbase-add-record.php                      30-Sep-2022 11:09                7477
function.dbase-close.php                           30-Sep-2022 11:09                5445
function.dbase-create.php                          30-Sep-2022 11:09                9038
function.dbase-delete-record.php                   30-Sep-2022 11:09                5154
function.dbase-get-header-info.php                 30-Sep-2022 11:09                7794
function.dbase-get-record-with-names.php           30-Sep-2022 11:09               10197
function.dbase-get-record.php                      30-Sep-2022 11:09                5993
function.dbase-numfields.php                       30-Sep-2022 11:09                9569
function.dbase-numrecords.php                      30-Sep-2022 11:09                6636
function.dbase-open.php                            30-Sep-2022 11:09                7245
function.dbase-pack.php                            30-Sep-2022 11:09                6781
function.dbase-replace-record.php                  30-Sep-2022 11:09               10330
function.dcgettext.php                             30-Sep-2022 11:09                3488
function.dcngettext.php                            30-Sep-2022 11:09                4124
function.debug-backtrace.php                       30-Sep-2022 11:08               10505
function.debug-print-backtrace.php                 30-Sep-2022 11:08                7208
function.debug-zval-dump.php                       30-Sep-2022 11:09               12131
function.decbin.php                                30-Sep-2022 11:09                9687
function.dechex.php                                30-Sep-2022 11:09                8301
function.decoct.php                                30-Sep-2022 11:09                5712
function.define.php                                30-Sep-2022 11:09               12990
function.defined.php                               30-Sep-2022 11:09                5965
function.deflate-add.php                           30-Sep-2022 11:09                5654
function.deflate-init.php                          30-Sep-2022 11:09                8352
function.deg2rad.php                               30-Sep-2022 11:09                4155
function.delete.php                                30-Sep-2022 11:09                2756
function.dgettext.php                              30-Sep-2022 11:09                3322
function.die.php                                   30-Sep-2022 11:09                1595
function.dio-close.php                             30-Sep-2022 11:09                4311
function.dio-fcntl.php                             30-Sep-2022 11:09                9992
function.dio-open.php                              30-Sep-2022 11:09                8387
function.dio-read.php                              30-Sep-2022 11:09                3672
function.dio-seek.php                              30-Sep-2022 11:09                7786
function.dio-stat.php                              30-Sep-2022 11:09                4632
function.dio-tcsetattr.php                         30-Sep-2022 11:09                7598
function.dio-truncate.php                          30-Sep-2022 11:09                3947
function.dio-write.php                             30-Sep-2022 11:09                3975
function.dir.php                                   30-Sep-2022 11:09                7995
function.dirname.php                               30-Sep-2022 11:09               11320
function.disk-free-space.php                       30-Sep-2022 11:09                6174
function.disk-total-space.php                      30-Sep-2022 11:09                5635
function.diskfreespace.php                         30-Sep-2022 11:09                1805
function.dl.php                                    30-Sep-2022 11:08               11313
function.dngettext.php                             30-Sep-2022 11:09                3918
function.dns-check-record.php                      30-Sep-2022 11:09                1762
function.dns-get-mx.php                            30-Sep-2022 11:09                1732
function.dns-get-record.php                        30-Sep-2022 11:09               27276
function.dom-import-simplexml.php                  30-Sep-2022 11:09                7590
function.doubleval.php                             30-Sep-2022 11:09                1737
function.each.php                                  30-Sep-2022 11:09               12965
function.easter-date.php                           30-Sep-2022 11:09               13668
function.easter-days.php                           30-Sep-2022 11:09                8345
function.echo.php                                  30-Sep-2022 11:09               22896
function.eio-busy.php                              30-Sep-2022 11:09                5104
function.eio-cancel.php                            30-Sep-2022 11:09                8161
function.eio-chmod.php                             30-Sep-2022 11:09                6615
function.eio-chown.php                             30-Sep-2022 11:09                6809
function.eio-close.php                             30-Sep-2022 11:09                6061
function.eio-custom.php                            30-Sep-2022 11:09               11632
function.eio-dup2.php                              30-Sep-2022 11:09                6253
function.eio-event-loop.php                        30-Sep-2022 11:09                6339
function.eio-fallocate.php                         30-Sep-2022 11:09                7931
function.eio-fchmod.php                            30-Sep-2022 11:09                6632
function.eio-fchown.php                            30-Sep-2022 11:09                6921
function.eio-fdatasync.php                         30-Sep-2022 11:09                6026
function.eio-fstat.php                             30-Sep-2022 11:09               12870
function.eio-fstatvfs.php                          30-Sep-2022 11:09                6184
function.eio-fsync.php                             30-Sep-2022 11:09                6160
function.eio-ftruncate.php                         30-Sep-2022 11:09                6572
function.eio-futime.php                            30-Sep-2022 11:09                7032
function.eio-get-event-stream.php                  30-Sep-2022 11:09                9198
function.eio-get-last-error.php                    30-Sep-2022 11:09                3396
function.eio-grp-add.php                           30-Sep-2022 11:09               13000
function.eio-grp-cancel.php                        30-Sep-2022 11:09                3336
function.eio-grp-limit.php                         30-Sep-2022 11:09                3261
function.eio-grp.php                               30-Sep-2022 11:09               13159
function.eio-init.php                              30-Sep-2022 11:09                2874
function.eio-link.php                              30-Sep-2022 11:09               13348
function.eio-lstat.php                             30-Sep-2022 11:09               10566
function.eio-mkdir.php                             30-Sep-2022 11:09                9970
function.eio-mknod.php                             30-Sep-2022 11:09               12592
function.eio-nop.php                               30-Sep-2022 11:09                5787
function.eio-npending.php                          30-Sep-2022 11:09                3381
function.eio-nready.php                            30-Sep-2022 11:09                3001
function.eio-nreqs.php                             30-Sep-2022 11:09                6024
function.eio-nthreads.php                          30-Sep-2022 11:09                4032
function.eio-open.php                              30-Sep-2022 11:09               13334
function.eio-poll.php                              30-Sep-2022 11:09                6434
function.eio-read.php                              30-Sep-2022 11:09               14299
function.eio-readahead.php                         30-Sep-2022 11:09                6772
function.eio-readdir.php                           30-Sep-2022 11:09               18103
function.eio-readlink.php                          30-Sep-2022 11:09               13106
function.eio-realpath.php                          30-Sep-2022 11:09                5410
function.eio-rename.php                            30-Sep-2022 11:09                9987
function.eio-rmdir.php                             30-Sep-2022 11:09                8849
function.eio-seek.php                              30-Sep-2022 11:09                7741
function.eio-sendfile.php                          30-Sep-2022 11:09                6995
function.eio-set-max-idle.php                      30-Sep-2022 11:09                3535
function.eio-set-max-parallel.php                  30-Sep-2022 11:09                3578
function.eio-set-max-poll-reqs.php                 30-Sep-2022 11:09                2589
function.eio-set-max-poll-time.php                 30-Sep-2022 11:09                2746
function.eio-set-min-parallel.php                  30-Sep-2022 11:09                3566
function.eio-stat.php                              30-Sep-2022 11:09               10632
function.eio-statvfs.php                           30-Sep-2022 11:09                8984
function.eio-symlink.php                           30-Sep-2022 11:09               11585
function.eio-sync-file-range.php                   30-Sep-2022 11:09                7806
function.eio-sync.php                              30-Sep-2022 11:09                2940
function.eio-syncfs.php                            30-Sep-2022 11:09                5558
function.eio-truncate.php                          30-Sep-2022 11:09                6418
function.eio-unlink.php                            30-Sep-2022 11:09                5576
function.eio-utime.php                             30-Sep-2022 11:09                6497
function.eio-write.php                             30-Sep-2022 11:09                7296
function.empty.php                                 30-Sep-2022 11:09               10744
function.enchant-broker-describe.php               30-Sep-2022 11:09                6423
function.enchant-broker-dict-exists.php            30-Sep-2022 11:09                5962
function.enchant-broker-free-dict.php              30-Sep-2022 11:09                5097
function.enchant-broker-free.php                   30-Sep-2022 11:09                4617
function.enchant-broker-get-dict-path.php          30-Sep-2022 11:09                5492
function.enchant-broker-get-error.php              30-Sep-2022 11:09                3767
function.enchant-broker-init.php                   30-Sep-2022 11:09                3673
function.enchant-broker-list-dicts.php             30-Sep-2022 11:09                7175
function.enchant-broker-request-dict.php           30-Sep-2022 11:09                7637
function.enchant-broker-request-pwl-dict.php       30-Sep-2022 11:09                5928
function.enchant-broker-set-dict-path.php          30-Sep-2022 11:09                5690
function.enchant-broker-set-ordering.php           30-Sep-2022 11:09                5105
function.enchant-dict-add-to-personal.php          30-Sep-2022 11:09                2199
function.enchant-dict-add-to-session.php           30-Sep-2022 11:09                4722
function.enchant-dict-add.php                      30-Sep-2022 11:09                6636
function.enchant-dict-check.php                    30-Sep-2022 11:09                4205
function.enchant-dict-describe.php                 30-Sep-2022 11:09                6895
function.enchant-dict-get-error.php                30-Sep-2022 11:09                3967
function.enchant-dict-is-added.php                 30-Sep-2022 11:09                4633
function.enchant-dict-is-in-session.php            30-Sep-2022 11:09                2188
function.enchant-dict-quick-check.php              30-Sep-2022 11:09                8582
function.enchant-dict-store-replacement.php        30-Sep-2022 11:09                4886
function.enchant-dict-suggest.php                  30-Sep-2022 11:09                8032
function.end.php                                   30-Sep-2022 11:09                7006
function.enum-exists.php                           30-Sep-2022 11:09                5672
function.error-clear-last.php                      30-Sep-2022 11:08                4853
function.error-get-last.php                        30-Sep-2022 11:08                5376
function.error-log.php                             30-Sep-2022 11:08               12229
function.error-reporting.php                       30-Sep-2022 11:08               10419
function.escapeshellarg.php                        30-Sep-2022 11:09                6481
function.escapeshellcmd.php                        30-Sep-2022 11:09                8996
function.eval.php                                  30-Sep-2022 11:09               10463
function.exec.php                                  30-Sep-2022 11:09               10712
function.exif-imagetype.php                        30-Sep-2022 11:09                9343
function.exif-read-data.php                        30-Sep-2022 11:09               25880
function.exif-tagname.php                          30-Sep-2022 11:09                4900
function.exif-thumbnail.php                        30-Sep-2022 11:09                9595
function.exit.php                                  30-Sep-2022 11:09               10764
function.exp.php                                   30-Sep-2022 11:09                4525
function.expect-expectl.php                        30-Sep-2022 11:09               12563
function.expect-popen.php                          30-Sep-2022 11:09                4932
function.explode.php                               30-Sep-2022 11:09               17102
function.expm1.php                                 30-Sep-2022 11:09                3719
function.extension-loaded.php                      30-Sep-2022 11:08                6071
function.extract.php                               30-Sep-2022 11:09               16432
function.ezmlm-hash.php                            30-Sep-2022 11:09                4844
function.fann-cascadetrain-on-data.php             30-Sep-2022 11:09                7269
function.fann-cascadetrain-on-file.php             30-Sep-2022 11:09                5684
function.fann-clear-scaling-params.php             30-Sep-2022 11:09                2726
function.fann-copy.php                             30-Sep-2022 11:09                3447
function.fann-create-from-file.php                 30-Sep-2022 11:09                3526
function.fann-create-shortcut-array.php            30-Sep-2022 11:09                4789
function.fann-create-shortcut.php                  30-Sep-2022 11:09                5972
function.fann-create-sparse-array.php              30-Sep-2022 11:09                5556
function.fann-create-sparse.php                    30-Sep-2022 11:09                6242
function.fann-create-standard-array.php            30-Sep-2022 11:09                5216
function.fann-create-standard.php                  30-Sep-2022 11:09                5946
function.fann-create-train-from-callback.php       30-Sep-2022 11:09               10300
function.fann-create-train.php                     30-Sep-2022 11:09                4922
function.fann-descale-input.php                    30-Sep-2022 11:09                4114
function.fann-descale-output.php                   30-Sep-2022 11:09                4135
function.fann-descale-train.php                    30-Sep-2022 11:09                4103
function.fann-destroy-train.php                    30-Sep-2022 11:09                2681
function.fann-destroy.php                          30-Sep-2022 11:09                2723
function.fann-duplicate-train-data.php             30-Sep-2022 11:09                2879
function.fann-get-activation-function.php          30-Sep-2022 11:09                5718
function.fann-get-activation-steepness.php         30-Sep-2022 11:09                6431
function.fann-get-bias-array.php                   30-Sep-2022 11:09                2635
function.fann-get-bit-fail-limit.php               30-Sep-2022 11:09                4426
function.fann-get-bit-fail.php                     30-Sep-2022 11:09                5536
function.fann-get-cascade-activation-functions-..> 30-Sep-2022 11:09                4056
function.fann-get-cascade-activation-functions.php 30-Sep-2022 11:09                4623
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:09                4077
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:09                4350
function.fann-get-cascade-candidate-change-frac..> 30-Sep-2022 11:09                5862
function.fann-get-cascade-candidate-limit.php      30-Sep-2022 11:09                3940
function.fann-get-cascade-candidate-stagnation-..> 30-Sep-2022 11:09                4681
function.fann-get-cascade-max-cand-epochs.php      30-Sep-2022 11:09                3735
function.fann-get-cascade-max-out-epochs.php       30-Sep-2022 11:09                3665
function.fann-get-cascade-min-cand-epochs.php      30-Sep-2022 11:09                4107
function.fann-get-cascade-min-out-epochs.php       30-Sep-2022 11:09                4098
function.fann-get-cascade-num-candidate-groups.php 30-Sep-2022 11:09                4255
function.fann-get-cascade-num-candidates.php       30-Sep-2022 11:09                6846
function.fann-get-cascade-output-change-fractio..> 30-Sep-2022 11:09                5806
function.fann-get-cascade-output-stagnation-epo..> 30-Sep-2022 11:09                4663
function.fann-get-cascade-weight-multiplier.php    30-Sep-2022 11:09                3761
function.fann-get-connection-array.php             30-Sep-2022 11:09                2604
function.fann-get-connection-rate.php              30-Sep-2022 11:09                2838
function.fann-get-errno.php                        30-Sep-2022 11:09                3339
function.fann-get-errstr.php                       30-Sep-2022 11:09                3368
function.fann-get-layer-array.php                  30-Sep-2022 11:09                2769
function.fann-get-learning-momentum.php            30-Sep-2022 11:09                4147
function.fann-get-learning-rate.php                30-Sep-2022 11:09                3911
function.fann-get-mse.php                          30-Sep-2022 11:09                3496
function.fann-get-network-type.php                 30-Sep-2022 11:09                2719
function.fann-get-num-input.php                    30-Sep-2022 11:09                2642
function.fann-get-num-layers.php                   30-Sep-2022 11:09                2676
function.fann-get-num-output.php                   30-Sep-2022 11:09                2664
function.fann-get-quickprop-decay.php              30-Sep-2022 11:09                3751
function.fann-get-quickprop-mu.php                 30-Sep-2022 11:09                3535
function.fann-get-rprop-decrease-factor.php        30-Sep-2022 11:09                3637
function.fann-get-rprop-delta-max.php              30-Sep-2022 11:09                3713
function.fann-get-rprop-delta-min.php              30-Sep-2022 11:09                3443
function.fann-get-rprop-delta-zero.php             30-Sep-2022 11:09                3871
function.fann-get-rprop-increase-factor.php        30-Sep-2022 11:09                3663
function.fann-get-sarprop-step-error-shift.php     30-Sep-2022 11:09                3838
function.fann-get-sarprop-step-error-threshold-..> 30-Sep-2022 11:09                4071
function.fann-get-sarprop-temperature.php          30-Sep-2022 11:09                3728
function.fann-get-sarprop-weight-decay-shift.php   30-Sep-2022 11:09                3859
function.fann-get-total-connections.php            30-Sep-2022 11:09                2825
function.fann-get-total-neurons.php                30-Sep-2022 11:09                2939
function.fann-get-train-error-function.php         30-Sep-2022 11:09                3887
function.fann-get-train-stop-function.php          30-Sep-2022 11:09                3810
function.fann-get-training-algorithm.php           30-Sep-2022 11:09                3943
function.fann-init-weights.php                     30-Sep-2022 11:09                4994
function.fann-length-train-data.php                30-Sep-2022 11:09                2885
function.fann-merge-train-data.php                 30-Sep-2022 11:09                3178
function.fann-num-input-train-data.php             30-Sep-2022 11:09                3757
function.fann-num-output-train-data.php            30-Sep-2022 11:09                3758
function.fann-print-error.php                      30-Sep-2022 11:09                3072
function.fann-randomize-weights.php                30-Sep-2022 11:09                4037
function.fann-read-train-from-file.php             30-Sep-2022 11:09                5542
function.fann-reset-errno.php                      30-Sep-2022 11:09                3329
function.fann-reset-errstr.php                     30-Sep-2022 11:09                3320
function.fann-reset-mse.php                        30-Sep-2022 11:09                3699
function.fann-run.php                              30-Sep-2022 11:09                2974
function.fann-save-train.php                       30-Sep-2022 11:09                3582
function.fann-save.php                             30-Sep-2022 11:09                4646
function.fann-scale-input-train-data.php           30-Sep-2022 11:09                4482
function.fann-scale-input.php                      30-Sep-2022 11:09                4138
function.fann-scale-output-train-data.php          30-Sep-2022 11:09                4513
function.fann-scale-output.php                     30-Sep-2022 11:09                4147
function.fann-scale-train-data.php                 30-Sep-2022 11:09                4504
function.fann-scale-train.php                      30-Sep-2022 11:09                4098
function.fann-set-activation-function-hidden.php   30-Sep-2022 11:09                4775
function.fann-set-activation-function-layer.php    30-Sep-2022 11:09                5301
function.fann-set-activation-function-output.php   30-Sep-2022 11:09                4792
function.fann-set-activation-function.php          30-Sep-2022 11:09                6874
function.fann-set-activation-steepness-hidden.php  30-Sep-2022 11:09                5140
function.fann-set-activation-steepness-layer.php   30-Sep-2022 11:09                5599
function.fann-set-activation-steepness-output.php  30-Sep-2022 11:09                5081
function.fann-set-activation-steepness.php         30-Sep-2022 11:09                6803
function.fann-set-bit-fail-limit.php               30-Sep-2022 11:09                3590
function.fann-set-callback.php                     30-Sep-2022 11:09                6114
function.fann-set-cascade-activation-functions.php 30-Sep-2022 11:09                4323
function.fann-set-cascade-activation-steepnesse..> 30-Sep-2022 11:09                4536
function.fann-set-cascade-candidate-change-frac..> 30-Sep-2022 11:09                3900
function.fann-set-cascade-candidate-limit.php      30-Sep-2022 11:09                3641
function.fann-set-cascade-candidate-stagnation-..> 30-Sep-2022 11:09                4005
function.fann-set-cascade-max-cand-epochs.php      30-Sep-2022 11:09                3698
function.fann-set-cascade-max-out-epochs.php       30-Sep-2022 11:09                3681
function.fann-set-cascade-min-cand-epochs.php      30-Sep-2022 11:09                4078
function.fann-set-cascade-min-out-epochs.php       30-Sep-2022 11:09                4122
function.fann-set-cascade-num-candidate-groups.php 30-Sep-2022 11:09                3767
function.fann-set-cascade-output-change-fractio..> 30-Sep-2022 11:09                3890
function.fann-set-cascade-output-stagnation-epo..> 30-Sep-2022 11:09                3977
function.fann-set-cascade-weight-multiplier.php    30-Sep-2022 11:09                3602
function.fann-set-error-log.php                    30-Sep-2022 11:09                3030
function.fann-set-input-scaling-params.php         30-Sep-2022 11:09                4880
function.fann-set-learning-momentum.php            30-Sep-2022 11:09                3955
function.fann-set-learning-rate.php                30-Sep-2022 11:09                3905
function.fann-set-output-scaling-params.php        30-Sep-2022 11:09                4899
function.fann-set-quickprop-decay.php              30-Sep-2022 11:09                3693
function.fann-set-quickprop-mu.php                 30-Sep-2022 11:09                3395
function.fann-set-rprop-decrease-factor.php        30-Sep-2022 11:09                3773
function.fann-set-rprop-delta-max.php              30-Sep-2022 11:09                3907
function.fann-set-rprop-delta-min.php              30-Sep-2022 11:09                3669
function.fann-set-rprop-delta-zero.php             30-Sep-2022 11:09                4080
function.fann-set-rprop-increase-factor.php        30-Sep-2022 11:09                3798
function.fann-set-sarprop-step-error-shift.php     30-Sep-2022 11:09                4077
function.fann-set-sarprop-step-error-threshold-..> 30-Sep-2022 11:09                4351
function.fann-set-sarprop-temperature.php          30-Sep-2022 11:09                3967
function.fann-set-sarprop-weight-decay-shift.php   30-Sep-2022 11:09                4080
function.fann-set-scaling-params.php               30-Sep-2022 11:09                6132
function.fann-set-train-error-function.php         30-Sep-2022 11:09                3997
function.fann-set-train-stop-function.php          30-Sep-2022 11:09                4006
function.fann-set-training-algorithm.php           30-Sep-2022 11:09                3819
function.fann-set-weight-array.php                 30-Sep-2022 11:09                3249
function.fann-set-weight.php                       30-Sep-2022 11:09                3471
function.fann-shuffle-train-data.php               30-Sep-2022 11:09                2997
function.fann-subset-train-data.php                30-Sep-2022 11:09                4292
function.fann-test-data.php                        30-Sep-2022 11:09                4443
function.fann-test.php                             30-Sep-2022 11:09                4992
function.fann-train-epoch.php                      30-Sep-2022 11:09                5093
function.fann-train-on-data.php                    30-Sep-2022 11:09                7039
function.fann-train-on-file.php                    30-Sep-2022 11:09                7039
function.fann-train.php                            30-Sep-2022 11:09                4987
function.fastcgi-finish-request.php                30-Sep-2022 11:09                2726
function.fbird-add-user.php                        30-Sep-2022 11:09                2403
function.fbird-affected-rows.php                   30-Sep-2022 11:09                2414
function.fbird-backup.php                          30-Sep-2022 11:09                1776
function.fbird-blob-add.php                        30-Sep-2022 11:09                2785
function.fbird-blob-cancel.php                     30-Sep-2022 11:09                3782
function.fbird-blob-close.php                      30-Sep-2022 11:09                2816
function.fbird-blob-create.php                     30-Sep-2022 11:09                2816
function.fbird-blob-echo.php                       30-Sep-2022 11:09                2586
function.fbird-blob-get.php                        30-Sep-2022 11:09                2579
function.fbird-blob-import.php                     30-Sep-2022 11:09                2812
function.fbird-blob-info.php                       30-Sep-2022 11:09                1808
function.fbird-blob-open.php                       30-Sep-2022 11:09                2576
function.fbird-close.php                           30-Sep-2022 11:09                2337
function.fbird-commit-ret.php                      30-Sep-2022 11:09                1801
function.fbird-commit.php                          30-Sep-2022 11:09                1769
function.fbird-connect.php                         30-Sep-2022 11:09                2343
function.fbird-db-info.php                         30-Sep-2022 11:09                1782
function.fbird-delete-user.php                     30-Sep-2022 11:09                2411
function.fbird-drop-db.php                         30-Sep-2022 11:09                2359
function.fbird-errcode.php                         30-Sep-2022 11:09                2157
function.fbird-errmsg.php                          30-Sep-2022 11:09                2150
function.fbird-execute.php                         30-Sep-2022 11:09                2162
function.fbird-fetch-assoc.php                     30-Sep-2022 11:09                2427
function.fbird-fetch-object.php                    30-Sep-2022 11:09                2438
function.fbird-fetch-row.php                       30-Sep-2022 11:09                2415
function.fbird-field-info.php                      30-Sep-2022 11:09                2232
function.fbird-free-event-handler.php              30-Sep-2022 11:09                2336
function.fbird-free-query.php                      30-Sep-2022 11:09                1837
function.fbird-free-result.php                     30-Sep-2022 11:09                1822
function.fbird-gen-id.php                          30-Sep-2022 11:09                1779
function.fbird-maintain-db.php                     30-Sep-2022 11:09                1824
function.fbird-modify-user.php                     30-Sep-2022 11:09                2427
function.fbird-name-result.php                     30-Sep-2022 11:09                2410
function.fbird-num-fields.php                      30-Sep-2022 11:09                2221
function.fbird-num-params.php                      30-Sep-2022 11:09                2405
function.fbird-param-info.php                      30-Sep-2022 11:09                2410
function.fbird-pconnect.php                        30-Sep-2022 11:09                2360
function.fbird-prepare.php                         30-Sep-2022 11:09                1772
function.fbird-query.php                           30-Sep-2022 11:09                2726
function.fbird-restore.php                         30-Sep-2022 11:09                1779
function.fbird-rollback-ret.php                    30-Sep-2022 11:09                1831
function.fbird-rollback.php                        30-Sep-2022 11:09                1803
function.fbird-server-info.php                     30-Sep-2022 11:09                1834
function.fbird-service-attach.php                  30-Sep-2022 11:09                1873
function.fbird-service-detach.php                  30-Sep-2022 11:09                1885
function.fbird-set-event-handler.php               30-Sep-2022 11:09                2520
function.fbird-trans.php                           30-Sep-2022 11:09                1778
function.fbird-wait-event.php                      30-Sep-2022 11:09                2445
function.fclose.php                                30-Sep-2022 11:09                4727
function.fdatasync.php                             30-Sep-2022 11:09                6481
function.fdf-add-doc-javascript.php                30-Sep-2022 11:09                5622
function.fdf-add-template.php                      30-Sep-2022 11:09                2655
function.fdf-close.php                             30-Sep-2022 11:09                3203
function.fdf-create.php                            30-Sep-2022 11:09                5871
function.fdf-enum-values.php                       30-Sep-2022 11:09                2556
function.fdf-errno.php                             30-Sep-2022 11:09                2991
function.fdf-error.php                             30-Sep-2022 11:09                3429
function.fdf-get-ap.php                            30-Sep-2022 11:09                4079
function.fdf-get-attachment.php                    30-Sep-2022 11:09                6538
function.fdf-get-encoding.php                      30-Sep-2022 11:09                3526
function.fdf-get-file.php                          30-Sep-2022 11:09                3306
function.fdf-get-flags.php                         30-Sep-2022 11:09                2260
function.fdf-get-opt.php                           30-Sep-2022 11:09                2411
function.fdf-get-status.php                        30-Sep-2022 11:09                3300
function.fdf-get-value.php                         30-Sep-2022 11:09                4761
function.fdf-get-version.php                       30-Sep-2022 11:09                3774
function.fdf-header.php                            30-Sep-2022 11:09                2563
function.fdf-next-field-name.php                   30-Sep-2022 11:09                5641
function.fdf-open-string.php                       30-Sep-2022 11:09                5148
function.fdf-open.php                              30-Sep-2022 11:09                6337
function.fdf-remove-item.php                       30-Sep-2022 11:09                2305
function.fdf-save-string.php                       30-Sep-2022 11:09                5856
function.fdf-save.php                              30-Sep-2022 11:09                4174
function.fdf-set-ap.php                            30-Sep-2022 11:09                4256
function.fdf-set-encoding.php                      30-Sep-2022 11:09                3800
function.fdf-set-file.php                          30-Sep-2022 11:09                7496
function.fdf-set-flags.php                         30-Sep-2022 11:09                4281
function.fdf-set-javascript-action.php             30-Sep-2022 11:09                4498
function.fdf-set-on-import-javascript.php          30-Sep-2022 11:09                3203
function.fdf-set-opt.php                           30-Sep-2022 11:09                4499
function.fdf-set-status.php                        30-Sep-2022 11:09                3863
function.fdf-set-submit-form-action.php            30-Sep-2022 11:09                4764
function.fdf-set-target-frame.php                  30-Sep-2022 11:09                3854
function.fdf-set-value.php                         30-Sep-2022 11:09                5683
function.fdf-set-version.php                       30-Sep-2022 11:09                4134
function.fdiv.php                                  30-Sep-2022 11:09                6563
function.feof.php                                  30-Sep-2022 11:09                8534
function.fflush.php                                30-Sep-2022 11:09                5902
function.fgetc.php                                 30-Sep-2022 11:09                7244
function.fgetcsv.php                               30-Sep-2022 11:09               14950
function.fgets.php                                 30-Sep-2022 11:09                9783
function.fgetss.php                                30-Sep-2022 11:09               10714
function.file-exists.php                           30-Sep-2022 11:09                8348
function.file-get-contents.php                     30-Sep-2022 11:09               21207
function.file-put-contents.php                     30-Sep-2022 11:09               14848
function.file.php                                  30-Sep-2022 11:09               13391
function.fileatime.php                             30-Sep-2022 11:09                8527
function.filectime.php                             30-Sep-2022 11:09                8367
function.filegroup.php                             30-Sep-2022 11:09                6387
function.fileinode.php                             30-Sep-2022 11:09                5902
function.filemtime.php                             30-Sep-2022 11:09                7781
function.fileowner.php                             30-Sep-2022 11:09                6233
function.fileperms.php                             30-Sep-2022 11:09               19685
function.filesize.php                              30-Sep-2022 11:09                6661
function.filetype.php                              30-Sep-2022 11:09                7374
function.filter-has-var.php                        30-Sep-2022 11:09                3114
function.filter-id.php                             30-Sep-2022 11:09                3068
function.filter-input-array.php                    30-Sep-2022 11:09               15377
function.filter-input.php                          30-Sep-2022 11:09                8759
function.filter-list.php                           30-Sep-2022 11:09                4047
function.filter-var-array.php                      30-Sep-2022 11:09               14718
function.filter-var.php                            30-Sep-2022 11:09               15095
function.finfo-buffer.php                          30-Sep-2022 11:09                8277
function.finfo-close.php                           30-Sep-2022 11:09                3716
function.finfo-file.php                            30-Sep-2022 11:09                8926
function.finfo-open.php                            30-Sep-2022 11:09               10951
function.finfo-set-flags.php                       30-Sep-2022 11:09                4939
function.floatval.php                              30-Sep-2022 11:09                6982
function.flock.php                                 30-Sep-2022 11:09               15669
function.floor.php                                 30-Sep-2022 11:09                5755
function.flush.php                                 30-Sep-2022 11:08                6113
function.fmod.php                                  30-Sep-2022 11:09                5335
function.fnmatch.php                               30-Sep-2022 11:09                8959
function.fopen.php                                 30-Sep-2022 11:09               28599
function.forward-static-call-array.php             30-Sep-2022 11:09               10788
function.forward-static-call.php                   30-Sep-2022 11:09               10299
function.fpassthru.php                             30-Sep-2022 11:09                8537
function.fpm-get-status.php                        30-Sep-2022 11:09                3051
function.fprintf.php                               30-Sep-2022 11:09               22429
function.fputcsv.php                               30-Sep-2022 11:09               11317
function.fputs.php                                 30-Sep-2022 11:09                1693
function.fread.php                                 30-Sep-2022 11:09               17011
function.frenchtojd.php                            30-Sep-2022 11:09                4632
function.fscanf.php                                30-Sep-2022 11:09               10729
function.fseek.php                                 30-Sep-2022 11:09                9105
function.fsockopen.php                             30-Sep-2022 11:09               19593
function.fstat.php                                 30-Sep-2022 11:09                6686
function.fsync.php                                 30-Sep-2022 11:09                6199
function.ftell.php                                 30-Sep-2022 11:09                6949
function.ftok.php                                  30-Sep-2022 11:09                3966
function.ftp-alloc.php                             30-Sep-2022 11:09                9278
function.ftp-append.php                            30-Sep-2022 11:09                4564
function.ftp-cdup.php                              30-Sep-2022 11:09                7293
function.ftp-chdir.php                             30-Sep-2022 11:09                8339
function.ftp-chmod.php                             30-Sep-2022 11:09                7893
function.ftp-close.php                             30-Sep-2022 11:09                6643
function.ftp-connect.php                           30-Sep-2022 11:09                7385
function.ftp-delete.php                            30-Sep-2022 11:09                6618
function.ftp-exec.php                              30-Sep-2022 11:09                7318
function.ftp-fget.php                              30-Sep-2022 11:09               10813
function.ftp-fput.php                              30-Sep-2022 11:09               10119
function.ftp-get-option.php                        30-Sep-2022 11:09                6427
function.ftp-get.php                               30-Sep-2022 11:09               10047
function.ftp-login.php                             30-Sep-2022 11:09                7239
function.ftp-mdtm.php                              30-Sep-2022 11:09                7936
function.ftp-mkdir.php                             30-Sep-2022 11:09                7468
function.ftp-mlsd.php                              30-Sep-2022 11:09                9827
function.ftp-nb-continue.php                       30-Sep-2022 11:09                5805
function.ftp-nb-fget.php                           30-Sep-2022 11:09               11193
function.ftp-nb-fput.php                           30-Sep-2022 11:09               10958
function.ftp-nb-get.php                            30-Sep-2022 11:09               15657
function.ftp-nb-put.php                            30-Sep-2022 11:09               12780
function.ftp-nlist.php                             30-Sep-2022 11:09                7522
function.ftp-pasv.php                              30-Sep-2022 11:09                8027
function.ftp-put.php                               30-Sep-2022 11:09                9629
function.ftp-pwd.php                               30-Sep-2022 11:09                6549
function.ftp-quit.php                              30-Sep-2022 11:09                1680
function.ftp-raw.php                               30-Sep-2022 11:09                5899
function.ftp-rawlist.php                           30-Sep-2022 11:09                8920
function.ftp-rename.php                            30-Sep-2022 11:09                7683
function.ftp-rmdir.php                             30-Sep-2022 11:09                7123
function.ftp-set-option.php                        30-Sep-2022 11:09                8011
function.ftp-site.php                              30-Sep-2022 11:09                7512
function.ftp-size.php                              30-Sep-2022 11:09                7556
function.ftp-ssl-connect.php                       30-Sep-2022 11:09               10287
function.ftp-systype.php                           30-Sep-2022 11:09                6018
function.ftruncate.php                             30-Sep-2022 11:09                6983
function.func-get-arg.php                          30-Sep-2022 11:09               13061
function.func-get-args.php                         30-Sep-2022 11:09               13834
function.func-num-args.php                         30-Sep-2022 11:09                6685
function.function-exists.php                       30-Sep-2022 11:09                6762
function.fwrite.php                                30-Sep-2022 11:09               17393
function.gc-collect-cycles.php                     30-Sep-2022 11:08                2702
function.gc-disable.php                            30-Sep-2022 11:08                2802
function.gc-enable.php                             30-Sep-2022 11:08                2760
function.gc-enabled.php                            30-Sep-2022 11:08                3565
function.gc-mem-caches.php                         30-Sep-2022 11:08                2672
function.gc-status.php                             30-Sep-2022 11:08                6373
function.gd-info.php                               30-Sep-2022 11:09                9425
function.geoip-asnum-by-name.php                   30-Sep-2022 11:09                4385
function.geoip-continent-code-by-name.php          30-Sep-2022 11:09                6211
function.geoip-country-code-by-name.php            30-Sep-2022 11:09                6012
function.geoip-country-code3-by-name.php           30-Sep-2022 11:09                5422
function.geoip-country-name-by-name.php            30-Sep-2022 11:09                5355
function.geoip-database-info.php                   30-Sep-2022 11:09                4587
function.geoip-db-avail.php                        30-Sep-2022 11:09                4850
function.geoip-db-filename.php                     30-Sep-2022 11:09                4522
function.geoip-db-get-all-info.php                 30-Sep-2022 11:09                7522
function.geoip-domain-by-name.php                  30-Sep-2022 11:09                4792
function.geoip-id-by-name.php                      30-Sep-2022 11:09                6229
function.geoip-isp-by-name.php                     30-Sep-2022 11:09                4752
function.geoip-netspeedcell-by-name.php            30-Sep-2022 11:09                5737
function.geoip-org-by-name.php                     30-Sep-2022 11:09                4918
function.geoip-record-by-name.php                  30-Sep-2022 11:09                8683
function.geoip-region-by-name.php                  30-Sep-2022 11:09                5593
function.geoip-region-name-by-code.php             30-Sep-2022 11:09                8131
function.geoip-setup-custom-directory.php          30-Sep-2022 11:09                4477
function.geoip-time-zone-by-country-and-region.php 30-Sep-2022 11:09                8348
function.get-browser.php                           30-Sep-2022 11:09                9155
function.get-called-class.php                      30-Sep-2022 11:09                5532
function.get-cfg-var.php                           30-Sep-2022 11:08                4192
function.get-class-methods.php                     30-Sep-2022 11:09                7718
function.get-class-vars.php                        30-Sep-2022 11:09               11100
function.get-class.php                             30-Sep-2022 11:09               14336
function.get-current-user.php                      30-Sep-2022 11:08                4802
function.get-debug-type.php                        30-Sep-2022 11:09               10815
function.get-declared-classes.php                  30-Sep-2022 11:09                6101
function.get-declared-interfaces.php               30-Sep-2022 11:09                4711
function.get-declared-traits.php                   30-Sep-2022 11:09                3205
function.get-defined-constants.php                 30-Sep-2022 11:08                8436
function.get-defined-functions.php                 30-Sep-2022 11:09                7696
function.get-defined-vars.php                      30-Sep-2022 11:09                7207
function.get-extension-funcs.php                   30-Sep-2022 11:08                5867
function.get-headers.php                           30-Sep-2022 11:09                9762
function.get-html-translation-table.php            30-Sep-2022 11:09               15557
function.get-include-path.php                      30-Sep-2022 11:08                4842
function.get-included-files.php                    30-Sep-2022 11:08                6639
function.get-loaded-extensions.php                 30-Sep-2022 11:08                5904
function.get-magic-quotes-gpc.php                  30-Sep-2022 11:08                4570
function.get-magic-quotes-runtime.php              30-Sep-2022 11:08                5382
function.get-mangled-object-vars.php               30-Sep-2022 11:09                9046
function.get-meta-tags.php                         30-Sep-2022 11:09                9089
function.get-object-vars.php                       30-Sep-2022 11:09                6820
function.get-parent-class.php                      30-Sep-2022 11:09                8766
function.get-required-files.php                    30-Sep-2022 11:08                1873
function.get-resource-id.php                       30-Sep-2022 11:09                5194
function.get-resource-type.php                     30-Sep-2022 11:09                5229
function.get-resources.php                         30-Sep-2022 11:08                8597
function.getallheaders.php                         30-Sep-2022 11:09                5170
function.getcwd.php                                30-Sep-2022 11:09                6080
function.getdate.php                               30-Sep-2022 11:09               10581
function.getenv.php                                30-Sep-2022 11:08                9096
function.gethostbyaddr.php                         30-Sep-2022 11:09                4686
function.gethostbyname.php                         30-Sep-2022 11:09                4945
function.gethostbynamel.php                        30-Sep-2022 11:09                5545
function.gethostname.php                           30-Sep-2022 11:09                4355
function.getimagesize.php                          30-Sep-2022 11:09               20542
function.getimagesizefromstring.php                30-Sep-2022 11:09                6085
function.getlastmod.php                            30-Sep-2022 11:08                5936
function.getmxrr.php                               30-Sep-2022 11:09                6663
function.getmygid.php                              30-Sep-2022 11:08                3752
function.getmyinode.php                            30-Sep-2022 11:08                3698
function.getmypid.php                              30-Sep-2022 11:08                4245
function.getmyuid.php                              30-Sep-2022 11:08                3722
function.getopt.php                                30-Sep-2022 11:08               17754
function.getprotobyname.php                        30-Sep-2022 11:09                4929
function.getprotobynumber.php                      30-Sep-2022 11:09                3377
function.getrandmax.php                            30-Sep-2022 11:09                3424
function.getrusage.php                             30-Sep-2022 11:08               13470
function.getservbyname.php                         30-Sep-2022 11:09                6955
function.getservbyport.php                         30-Sep-2022 11:09                4043
function.gettext.php                               30-Sep-2022 11:09                6457
function.gettimeofday.php                          30-Sep-2022 11:09                5221
function.gettype.php                               30-Sep-2022 11:09               10557
function.glob.php                                  30-Sep-2022 11:09               11340
function.gmdate.php                                30-Sep-2022 11:09                8435
function.gmmktime.php                              30-Sep-2022 11:09               12738
function.gmp-abs.php                               30-Sep-2022 11:09                4791
function.gmp-add.php                               30-Sep-2022 11:09                4772
function.gmp-and.php                               30-Sep-2022 11:09                5251
function.gmp-binomial.php                          30-Sep-2022 11:09                4045
function.gmp-clrbit.php                            30-Sep-2022 11:09                6217
function.gmp-cmp.php                               30-Sep-2022 11:09                5712
function.gmp-com.php                               30-Sep-2022 11:09                4096
function.gmp-div-q.php                             30-Sep-2022 11:09               10767
function.gmp-div-qr.php                            30-Sep-2022 11:09                6827
function.gmp-div-r.php                             30-Sep-2022 11:09                6332
function.gmp-div.php                               30-Sep-2022 11:09                1699
function.gmp-divexact.php                          30-Sep-2022 11:09                6047
function.gmp-export.php                            30-Sep-2022 11:09                5729
function.gmp-fact.php                              30-Sep-2022 11:09                5073
function.gmp-gcd.php                               30-Sep-2022 11:09                5344
function.gmp-gcdext.php                            30-Sep-2022 11:09               10036
function.gmp-hamdist.php                           30-Sep-2022 11:09                6793
function.gmp-import.php                            30-Sep-2022 11:09                6197
function.gmp-init.php                              30-Sep-2022 11:09                6218
function.gmp-intval.php                            30-Sep-2022 11:09                5822
function.gmp-invert.php                            30-Sep-2022 11:09                5493
function.gmp-jacobi.php                            30-Sep-2022 11:09                5793
function.gmp-kronecker.php                         30-Sep-2022 11:09                3987
function.gmp-lcm.php                               30-Sep-2022 11:09                3828
function.gmp-legendre.php                          30-Sep-2022 11:09                5807
function.gmp-mod.php                               30-Sep-2022 11:09                5028
function.gmp-mul.php                               30-Sep-2022 11:09                5062
function.gmp-neg.php                               30-Sep-2022 11:09                4565
function.gmp-nextprime.php                         30-Sep-2022 11:09                5517
function.gmp-or.php                                30-Sep-2022 11:09                5474
function.gmp-perfect-power.php                     30-Sep-2022 11:09                3680
function.gmp-perfect-square.php                    30-Sep-2022 11:09                6052
function.gmp-popcount.php                          30-Sep-2022 11:09                5084
function.gmp-pow.php                               30-Sep-2022 11:09                6057
function.gmp-powm.php                              30-Sep-2022 11:09                6141
function.gmp-prob-prime.php                        30-Sep-2022 11:09                6330
function.gmp-random-bits.php                       30-Sep-2022 11:09                4918
function.gmp-random-range.php                      30-Sep-2022 11:09                5795
function.gmp-random-seed.php                       30-Sep-2022 11:09                7234
function.gmp-random.php                            30-Sep-2022 11:09                6237
function.gmp-root.php                              30-Sep-2022 11:09                3310
function.gmp-rootrem.php                           30-Sep-2022 11:09                3641
function.gmp-scan0.php                             30-Sep-2022 11:09                5805
function.gmp-scan1.php                             30-Sep-2022 11:09                5795
function.gmp-setbit.php                            30-Sep-2022 11:09               12676
function.gmp-sign.php                              30-Sep-2022 11:09                5354
function.gmp-sqrt.php                              30-Sep-2022 11:09                5129
function.gmp-sqrtrem.php                           30-Sep-2022 11:09                6676
function.gmp-strval.php                            30-Sep-2022 11:09                4851
function.gmp-sub.php                               30-Sep-2022 11:09                5096
function.gmp-testbit.php                           30-Sep-2022 11:09                5958
function.gmp-xor.php                               30-Sep-2022 11:09                5520
function.gmstrftime.php                            30-Sep-2022 11:09               10328
function.gnupg-adddecryptkey.php                   30-Sep-2022 11:09                5438
function.gnupg-addencryptkey.php                   30-Sep-2022 11:09                5001
function.gnupg-addsignkey.php                      30-Sep-2022 11:09                5423
function.gnupg-cleardecryptkeys.php                30-Sep-2022 11:09                4625
function.gnupg-clearencryptkeys.php                30-Sep-2022 11:09                4629
function.gnupg-clearsignkeys.php                   30-Sep-2022 11:09                4572
function.gnupg-decrypt.php                         30-Sep-2022 11:09                6331
function.gnupg-decryptverify.php                   30-Sep-2022 11:09                7544
function.gnupg-deletekey.php                       30-Sep-2022 11:09                5297
function.gnupg-encrypt.php                         30-Sep-2022 11:09                6218
function.gnupg-encryptsign.php                     30-Sep-2022 11:09                7253
function.gnupg-export.php                          30-Sep-2022 11:09                5328
function.gnupg-getengineinfo.php                   30-Sep-2022 11:09                5864
function.gnupg-geterror.php                        30-Sep-2022 11:09                4549
function.gnupg-geterrorinfo.php                    30-Sep-2022 11:09                6063
function.gnupg-getprotocol.php                     30-Sep-2022 11:09                4598
function.gnupg-gettrustlist.php                    30-Sep-2022 11:09                5519
function.gnupg-import.php                          30-Sep-2022 11:09                5603
function.gnupg-init.php                            30-Sep-2022 11:09                8048
function.gnupg-keyinfo.php                         30-Sep-2022 11:09                5582
function.gnupg-listsignatures.php                  30-Sep-2022 11:09                5659
function.gnupg-setarmor.php                        30-Sep-2022 11:09                6153
function.gnupg-seterrormode.php                    30-Sep-2022 11:09                6031
function.gnupg-setsignmode.php                     30-Sep-2022 11:09                5927
function.gnupg-sign.php                            30-Sep-2022 11:09                6642
function.gnupg-verify.php                          30-Sep-2022 11:09                8929
function.grapheme-extract.php                      30-Sep-2022 11:09               10088
function.grapheme-stripos.php                      30-Sep-2022 11:09                9276
function.grapheme-stristr.php                      30-Sep-2022 11:09                8519
function.grapheme-strlen.php                       30-Sep-2022 11:09                6056
function.grapheme-strpos.php                       30-Sep-2022 11:09                8866
function.grapheme-strripos.php                     30-Sep-2022 11:09                8745
function.grapheme-strrpos.php                      30-Sep-2022 11:09                8326
function.grapheme-strstr.php                       30-Sep-2022 11:09                8077
function.grapheme-substr.php                       30-Sep-2022 11:09                9085
function.gregoriantojd.php                         30-Sep-2022 11:09                8894
function.gzclose.php                               30-Sep-2022 11:09                4451
function.gzcompress.php                            30-Sep-2022 11:09                6407
function.gzdecode.php                              30-Sep-2022 11:09                3869
function.gzdeflate.php                             30-Sep-2022 11:09                5755
function.gzencode.php                              30-Sep-2022 11:09                7220
function.gzeof.php                                 30-Sep-2022 11:09                4428
function.gzfile.php                                30-Sep-2022 11:09                5146
function.gzgetc.php                                30-Sep-2022 11:09                4956
function.gzgets.php                                30-Sep-2022 11:09                6671
function.gzgetss.php                               30-Sep-2022 11:09                6681
function.gzinflate.php                             30-Sep-2022 11:09                5649
function.gzopen.php                                30-Sep-2022 11:09                6272
function.gzpassthru.php                            30-Sep-2022 11:09                5294
function.gzputs.php                                30-Sep-2022 11:09                1665
function.gzread.php                                30-Sep-2022 11:09                7282
function.gzrewind.php                              30-Sep-2022 11:09                3517
function.gzseek.php                                30-Sep-2022 11:09                7087
function.gztell.php                                30-Sep-2022 11:09                3704
function.gzuncompress.php                          30-Sep-2022 11:09                5615
function.gzwrite.php                               30-Sep-2022 11:09                6958
function.halt-compiler.php                         30-Sep-2022 11:09                5730
function.hash-algos.php                            30-Sep-2022 11:09                6257
function.hash-copy.php                             30-Sep-2022 11:09                5767
function.hash-equals.php                           30-Sep-2022 11:09                7224
function.hash-file.php                             30-Sep-2022 11:09                8266
function.hash-final.php                            30-Sep-2022 11:09                7039
function.hash-hkdf.php                             30-Sep-2022 11:09               10330
function.hash-hmac-algos.php                       30-Sep-2022 11:09                5863
function.hash-hmac-file.php                        30-Sep-2022 11:09                8405
function.hash-hmac.php                             30-Sep-2022 11:09                8187
function.hash-init.php                             30-Sep-2022 11:09                9574
function.hash-pbkdf2.php                           30-Sep-2022 11:09               14332
function.hash-update-file.php                      30-Sep-2022 11:09                6268
function.hash-update-stream.php                    30-Sep-2022 11:09                7919
function.hash-update.php                           30-Sep-2022 11:09                4806
function.hash.php                                  30-Sep-2022 11:09                8028
function.header-register-callback.php              30-Sep-2022 11:09                7882
function.header-remove.php                         30-Sep-2022 11:09                7541
function.header.php                                30-Sep-2022 11:09               22916
function.headers-list.php                          30-Sep-2022 11:09                7014
function.headers-sent.php                          30-Sep-2022 11:09                9392
function.hebrev.php                                30-Sep-2022 11:09                3710
function.hebrevc.php                               30-Sep-2022 11:09                4262
function.hex2bin.php                               30-Sep-2022 11:09                5712
function.hexdec.php                                30-Sep-2022 11:09                7552
function.highlight-file.php                        30-Sep-2022 11:09                6234
function.highlight-string.php                      30-Sep-2022 11:09                6286
function.hrtime.php                                30-Sep-2022 11:09                5458
function.html-entity-decode.php                    30-Sep-2022 11:09               16801
function.htmlentities.php                          30-Sep-2022 11:09               20266
function.htmlspecialchars-decode.php               30-Sep-2022 11:09               10054
function.htmlspecialchars.php                      30-Sep-2022 11:09               24998
function.http-build-query.php                      30-Sep-2022 11:09               21970
function.http-response-code.php                    30-Sep-2022 11:09                7636
function.hypot.php                                 30-Sep-2022 11:09                3127
function.ibase-add-user.php                        30-Sep-2022 11:09                5183
function.ibase-affected-rows.php                   30-Sep-2022 11:09                3784
function.ibase-backup.php                          30-Sep-2022 11:09               11962
function.ibase-blob-add.php                        30-Sep-2022 11:09                4357
function.ibase-blob-cancel.php                     30-Sep-2022 11:09                3933
function.ibase-blob-close.php                      30-Sep-2022 11:09                4271
function.ibase-blob-create.php                     30-Sep-2022 11:09                4351
function.ibase-blob-echo.php                       30-Sep-2022 11:09                4369
function.ibase-blob-get.php                        30-Sep-2022 11:09                7146
function.ibase-blob-import.php                     30-Sep-2022 11:09                9029
function.ibase-blob-info.php                       30-Sep-2022 11:09                3707
function.ibase-blob-open.php                       30-Sep-2022 11:09                4599
function.ibase-close.php                           30-Sep-2022 11:09                4066
function.ibase-commit-ret.php                      30-Sep-2022 11:09                3584
function.ibase-commit.php                          30-Sep-2022 11:09                3256
function.ibase-connect.php                         30-Sep-2022 11:09               11634
function.ibase-db-info.php                         30-Sep-2022 11:09                2565
function.ibase-delete-user.php                     30-Sep-2022 11:09                3703
function.ibase-drop-db.php                         30-Sep-2022 11:09                3875
function.ibase-errcode.php                         30-Sep-2022 11:09                2829
function.ibase-errmsg.php                          30-Sep-2022 11:09                2837
function.ibase-execute.php                         30-Sep-2022 11:09                7721
function.ibase-fetch-assoc.php                     30-Sep-2022 11:09                5466
function.ibase-fetch-object.php                    30-Sep-2022 11:09                7242
function.ibase-fetch-row.php                       30-Sep-2022 11:09                4997
function.ibase-field-info.php                      30-Sep-2022 11:09                7394
function.ibase-free-event-handler.php              30-Sep-2022 11:09                3732
function.ibase-free-query.php                      30-Sep-2022 11:09                2866
function.ibase-free-result.php                     30-Sep-2022 11:09                2949
function.ibase-gen-id.php                          30-Sep-2022 11:09                2955
function.ibase-maintain-db.php                     30-Sep-2022 11:09                3036
function.ibase-modify-user.php                     30-Sep-2022 11:09                5130
function.ibase-name-result.php                     30-Sep-2022 11:09                6146
function.ibase-num-fields.php                      30-Sep-2022 11:09                6972
function.ibase-num-params.php                      30-Sep-2022 11:09                3813
function.ibase-param-info.php                      30-Sep-2022 11:09                3850
function.ibase-pconnect.php                        30-Sep-2022 11:09                8867
function.ibase-prepare.php                         30-Sep-2022 11:09                4585
function.ibase-query.php                           30-Sep-2022 11:09                8100
function.ibase-restore.php                         30-Sep-2022 11:09               11830
function.ibase-rollback-ret.php                    30-Sep-2022 11:09                3646
function.ibase-rollback.php                        30-Sep-2022 11:09                3322
function.ibase-server-info.php                     30-Sep-2022 11:09               11683
function.ibase-service-attach.php                  30-Sep-2022 11:09               13684
function.ibase-service-detach.php                  30-Sep-2022 11:09                7518
function.ibase-set-event-handler.php               30-Sep-2022 11:09                8699
function.ibase-trans.php                           30-Sep-2022 11:09                6416
function.ibase-wait-event.php                      30-Sep-2022 11:09                4443
function.iconv-get-encoding.php                    30-Sep-2022 11:09                6342
function.iconv-mime-decode-headers.php             30-Sep-2022 11:09               11747
function.iconv-mime-decode.php                     30-Sep-2022 11:09                9339
function.iconv-mime-encode.php                     30-Sep-2022 11:09               13110
function.iconv-set-encoding.php                    30-Sep-2022 11:09                5342
function.iconv-strlen.php                          30-Sep-2022 11:09                5379
function.iconv-strpos.php                          30-Sep-2022 11:09                7959
function.iconv-strrpos.php                         30-Sep-2022 11:09                7046
function.iconv-substr.php                          30-Sep-2022 11:09                9019
function.iconv.php                                 30-Sep-2022 11:09               10263
function.idate.php                                 30-Sep-2022 11:09               12929
function.idn-to-ascii.php                          30-Sep-2022 11:09                7730
function.idn-to-utf8.php                           30-Sep-2022 11:09                7692
function.igbinary-serialize.php                    30-Sep-2022 11:09               11763
function.igbinary-unserialize.php                  30-Sep-2022 11:09               11276
function.ignore-user-abort.php                     30-Sep-2022 11:09                9052
function.image-type-to-extension.php               30-Sep-2022 11:09                5599
function.image-type-to-mime-type.php               30-Sep-2022 11:09                8320
function.image2wbmp.php                            30-Sep-2022 11:09                7190
function.imageaffine.php                           30-Sep-2022 11:09                5246
function.imageaffinematrixconcat.php               30-Sep-2022 11:09                7371
function.imageaffinematrixget.php                  30-Sep-2022 11:09                6719
function.imagealphablending.php                    30-Sep-2022 11:09                8850
function.imageantialias.php                        30-Sep-2022 11:09               12350
function.imagearc.php                              30-Sep-2022 11:09               14609
function.imageavif.php                             30-Sep-2022 11:09                6802
function.imagebmp.php                              30-Sep-2022 11:09                8539
function.imagechar.php                             30-Sep-2022 11:09               10816
function.imagecharup.php                           30-Sep-2022 11:09               10659
function.imagecolorallocate.php                    30-Sep-2022 11:09               11055
function.imagecolorallocatealpha.php               30-Sep-2022 11:09               20082
function.imagecolorat.php                          30-Sep-2022 11:09               11238
function.imagecolorclosest.php                     30-Sep-2022 11:09               13829
function.imagecolorclosestalpha.php                30-Sep-2022 11:09               14174
function.imagecolorclosesthwb.php                  30-Sep-2022 11:09                7177
function.imagecolordeallocate.php                  30-Sep-2022 11:09                6384
function.imagecolorexact.php                       30-Sep-2022 11:09                9257
function.imagecolorexactalpha.php                  30-Sep-2022 11:09               10275
function.imagecolormatch.php                       30-Sep-2022 11:09                9193
function.imagecolorresolve.php                     30-Sep-2022 11:09                8467
function.imagecolorresolvealpha.php                30-Sep-2022 11:09                9210
function.imagecolorset.php                         30-Sep-2022 11:09                9395
function.imagecolorsforindex.php                   30-Sep-2022 11:09                8179
function.imagecolorstotal.php                      30-Sep-2022 11:09                6565
function.imagecolortransparent.php                 30-Sep-2022 11:09               10225
function.imageconvolution.php                      30-Sep-2022 11:09               12777
function.imagecopy.php                             30-Sep-2022 11:09                9902
function.imagecopymerge.php                        30-Sep-2022 11:09               10317
function.imagecopymergegray.php                    30-Sep-2022 11:09               11130
function.imagecopyresampled.php                    30-Sep-2022 11:09               21854
function.imagecopyresized.php                      30-Sep-2022 11:09               16312
function.imagecreate.php                           30-Sep-2022 11:09                9398
function.imagecreatefromavif.php                   30-Sep-2022 11:09                3139
function.imagecreatefrombmp.php                    30-Sep-2022 11:09                6439
function.imagecreatefromgd.php                     30-Sep-2022 11:09                7362
function.imagecreatefromgd2.php                    30-Sep-2022 11:09                7510
function.imagecreatefromgd2part.php                30-Sep-2022 11:09               10105
function.imagecreatefromgif.php                    30-Sep-2022 11:09               11551
function.imagecreatefromjpeg.php                   30-Sep-2022 11:09               10957
function.imagecreatefrompng.php                    30-Sep-2022 11:09               10910
function.imagecreatefromstring.php                 30-Sep-2022 11:09                9250
function.imagecreatefromtga.php                    30-Sep-2022 11:09                3896
function.imagecreatefromwbmp.php                   30-Sep-2022 11:09               10965
function.imagecreatefromwebp.php                   30-Sep-2022 11:09                6647
function.imagecreatefromxbm.php                    30-Sep-2022 11:09                6386
function.imagecreatefromxpm.php                    30-Sep-2022 11:09                7296
function.imagecreatetruecolor.php                  30-Sep-2022 11:09                7967
function.imagecrop.php                             30-Sep-2022 11:09                8653
function.imagecropauto.php                         30-Sep-2022 11:09               12605
function.imagedashedline.php                       30-Sep-2022 11:09               14352
function.imagedestroy.php                          30-Sep-2022 11:09                5627
function.imageellipse.php                          30-Sep-2022 11:09               10711
function.imagefill.php                             30-Sep-2022 11:09                8095
function.imagefilledarc.php                        30-Sep-2022 11:09               19461
function.imagefilledellipse.php                    30-Sep-2022 11:09               10387
function.imagefilledpolygon.php                    30-Sep-2022 11:09               13691
function.imagefilledrectangle.php                  30-Sep-2022 11:09                8884
function.imagefilltoborder.php                     30-Sep-2022 11:09               12282
function.imagefilter.php                           30-Sep-2022 11:09               37150
function.imageflip.php                             30-Sep-2022 11:09               10675
function.imagefontheight.php                       30-Sep-2022 11:09                7165
function.imagefontwidth.php                        30-Sep-2022 11:09                7092
function.imageftbbox.php                           30-Sep-2022 11:09               15678
function.imagefttext.php                           30-Sep-2022 11:09               17827
function.imagegammacorrect.php                     30-Sep-2022 11:09                6471
function.imagegd.php                               30-Sep-2022 11:09               12080
function.imagegd2.php                              30-Sep-2022 11:09               12759
function.imagegetclip.php                          30-Sep-2022 11:09                6794
function.imagegetinterpolation.php                 30-Sep-2022 11:09                4022
function.imagegif.php                              30-Sep-2022 11:09               18774
function.imagegrabscreen.php                       30-Sep-2022 11:09                5281
function.imagegrabwindow.php                       30-Sep-2022 11:09               10502
function.imageinterlace.php                        30-Sep-2022 11:09                7505
function.imageistruecolor.php                      30-Sep-2022 11:09                8267
function.imagejpeg.php                             30-Sep-2022 11:09               17063
function.imagelayereffect.php                      30-Sep-2022 11:09               12704
function.imageline.php                             30-Sep-2022 11:09               16941
function.imageloadfont.php                         30-Sep-2022 11:09               10622
function.imageopenpolygon.php                      30-Sep-2022 11:09               11422
function.imagepalettecopy.php                      30-Sep-2022 11:09                8257
function.imagepalettetotruecolor.php               30-Sep-2022 11:09               11273
function.imagepng.php                              30-Sep-2022 11:09                9762
function.imagepolygon.php                          30-Sep-2022 11:09               11775
function.imagerectangle.php                        30-Sep-2022 11:09               11162
function.imageresolution.php                       30-Sep-2022 11:09                8873
function.imagerotate.php                           30-Sep-2022 11:09               10413
function.imagesavealpha.php                        30-Sep-2022 11:09                7571
function.imagescale.php                            30-Sep-2022 11:09                7343
function.imagesetbrush.php                         30-Sep-2022 11:09               10233
function.imagesetclip.php                          30-Sep-2022 11:09                5522
function.imagesetinterpolation.php                 30-Sep-2022 11:09               11589
function.imagesetpixel.php                         30-Sep-2022 11:09               12319
function.imagesetstyle.php                         30-Sep-2022 11:09               13334
function.imagesetthickness.php                     30-Sep-2022 11:09                9139
function.imagesettile.php                          30-Sep-2022 11:09                9735
function.imagestring.php                           30-Sep-2022 11:09               11013
function.imagestringup.php                         30-Sep-2022 11:09               10066
function.imagesx.php                               30-Sep-2022 11:09                5671
function.imagesy.php                               30-Sep-2022 11:09                5691
function.imagetruecolortopalette.php               30-Sep-2022 11:09                7695
function.imagettfbbox.php                          30-Sep-2022 11:09               22011
function.imagettftext.php                          30-Sep-2022 11:09               20765
function.imagetypes.php                            30-Sep-2022 11:09                5143
function.imagewbmp.php                             30-Sep-2022 11:09               16716
function.imagewebp.php                             30-Sep-2022 11:09                8008
function.imagexbm.php                              30-Sep-2022 11:09               13265
function.imap-8bit.php                             30-Sep-2022 11:09                3361
function.imap-alerts.php                           30-Sep-2022 11:09                3549
function.imap-append.php                           30-Sep-2022 11:09               10814
function.imap-base64.php                           30-Sep-2022 11:09                3716
function.imap-binary.php                           30-Sep-2022 11:09                3215
function.imap-body.php                             30-Sep-2022 11:09                5834
function.imap-bodystruct.php                       30-Sep-2022 11:09                4922
function.imap-check.php                            30-Sep-2022 11:09                6450
function.imap-clearflag-full.php                   30-Sep-2022 11:09                6122
function.imap-close.php                            30-Sep-2022 11:09                4525
function.imap-create.php                           30-Sep-2022 11:09                1770
function.imap-createmailbox.php                    30-Sep-2022 11:09               16957
function.imap-delete.php                           30-Sep-2022 11:09               10639
function.imap-deletemailbox.php                    30-Sep-2022 11:09                5219
function.imap-errors.php                           30-Sep-2022 11:09                3739
function.imap-expunge.php                          30-Sep-2022 11:09                3767
function.imap-fetch-overview.php                   30-Sep-2022 11:09               12540
function.imap-fetchbody.php                        30-Sep-2022 11:09                6412
function.imap-fetchheader.php                      30-Sep-2022 11:09                5974
function.imap-fetchmime.php                        30-Sep-2022 11:09                6622
function.imap-fetchstructure.php                   30-Sep-2022 11:09               10320
function.imap-fetchtext.php                        30-Sep-2022 11:09                1751
function.imap-gc.php                               30-Sep-2022 11:09                5219
function.imap-get-quota.php                        30-Sep-2022 11:09               14227
function.imap-get-quotaroot.php                    30-Sep-2022 11:09               10467
function.imap-getacl.php                           30-Sep-2022 11:09                6378
function.imap-getmailboxes.php                     30-Sep-2022 11:09               13796
function.imap-getsubscribed.php                    30-Sep-2022 11:09                8809
function.imap-header.php                           30-Sep-2022 11:09                1990
function.imap-headerinfo.php                       30-Sep-2022 11:09               12759
function.imap-headers.php                          30-Sep-2022 11:09                3696
function.imap-last-error.php                       30-Sep-2022 11:09                3311
function.imap-list.php                             30-Sep-2022 11:09                9799
function.imap-listmailbox.php                      30-Sep-2022 11:09                1756
function.imap-listscan.php                         30-Sep-2022 11:09                7646
function.imap-listsubscribed.php                   30-Sep-2022 11:09                1777
function.imap-lsub.php                             30-Sep-2022 11:09                6756
function.imap-mail-compose.php                     30-Sep-2022 11:09               15701
function.imap-mail-copy.php                        30-Sep-2022 11:09                6710
function.imap-mail-move.php                        30-Sep-2022 11:09                7336
function.imap-mail.php                             30-Sep-2022 11:09                7251
function.imap-mailboxmsginfo.php                   30-Sep-2022 11:09               10746
function.imap-mime-header-decode.php               30-Sep-2022 11:09                6907
function.imap-msgno.php                            30-Sep-2022 11:09                4261
function.imap-mutf7-to-utf8.php                    30-Sep-2022 11:09                3514
function.imap-num-msg.php                          30-Sep-2022 11:09                4388
function.imap-num-recent.php                       30-Sep-2022 11:09                4215
function.imap-open.php                             30-Sep-2022 11:09               25497
function.imap-ping.php                             30-Sep-2022 11:09                5273
function.imap-qprint.php                           30-Sep-2022 11:09                3341
function.imap-rename.php                           30-Sep-2022 11:09                1773
function.imap-renamemailbox.php                    30-Sep-2022 11:09                5915
function.imap-reopen.php                           30-Sep-2022 11:09                9172
function.imap-rfc822-parse-adrlist.php             30-Sep-2022 11:09                8520
function.imap-rfc822-parse-headers.php             30-Sep-2022 11:09                3872
function.imap-rfc822-write-address.php             30-Sep-2022 11:09                5644
function.imap-savebody.php                         30-Sep-2022 11:09                6569
function.imap-scan.php                             30-Sep-2022 11:09                1738
function.imap-scanmailbox.php                      30-Sep-2022 11:09                1768
function.imap-search.php                           30-Sep-2022 11:09               15054
function.imap-set-quota.php                        30-Sep-2022 11:09                7438
function.imap-setacl.php                           30-Sep-2022 11:09                5923
function.imap-setflag-full.php                     30-Sep-2022 11:09                8530
function.imap-sort.php                             30-Sep-2022 11:09                8358
function.imap-status.php                           30-Sep-2022 11:09               11826
function.imap-subscribe.php                        30-Sep-2022 11:09                4698
function.imap-thread.php                           30-Sep-2022 11:09                8477
function.imap-timeout.php                          30-Sep-2022 11:09                4771
function.imap-uid.php                              30-Sep-2022 11:09                4881
function.imap-undelete.php                         30-Sep-2022 11:09                5329
function.imap-unsubscribe.php                      30-Sep-2022 11:09                4768
function.imap-utf7-decode.php                      30-Sep-2022 11:09                4050
function.imap-utf7-encode.php                      30-Sep-2022 11:09                3571
function.imap-utf8-to-mutf7.php                    30-Sep-2022 11:09                3528
function.imap-utf8.php                             30-Sep-2022 11:09                4638
function.implode.php                               30-Sep-2022 11:09                8455
function.in-array.php                              30-Sep-2022 11:09               13373
function.include-once.php                          30-Sep-2022 11:08                2672
function.include.php                               30-Sep-2022 11:08               25945
function.inet-ntop.php                             30-Sep-2022 11:09                6684
function.inet-pton.php                             30-Sep-2022 11:09                5131
function.inflate-add.php                           30-Sep-2022 11:09                6188
function.inflate-get-read-len.php                  30-Sep-2022 11:09                3616
function.inflate-get-status.php                    30-Sep-2022 11:09                3385
function.inflate-init.php                          30-Sep-2022 11:09                7434
function.ini-alter.php                             30-Sep-2022 11:08                1731
function.ini-get-all.php                           30-Sep-2022 11:08               11142
function.ini-get.php                               30-Sep-2022 11:08               12452
function.ini-restore.php                           30-Sep-2022 11:08                7145
function.ini-set.php                               30-Sep-2022 11:08                7194
function.inotify-add-watch.php                     30-Sep-2022 11:09                4503
function.inotify-init.php                          30-Sep-2022 11:09                9986
function.inotify-queue-len.php                     30-Sep-2022 11:09                4222
function.inotify-read.php                          30-Sep-2022 11:09                4959
function.inotify-rm-watch.php                      30-Sep-2022 11:09                3631
function.intdiv.php                                30-Sep-2022 11:09                7756
function.interface-exists.php                      30-Sep-2022 11:09                5885
function.intl-error-name.php                       30-Sep-2022 11:09                5451
function.intl-get-error-code.php                   30-Sep-2022 11:09                5070
function.intl-get-error-message.php                30-Sep-2022 11:09                5037
function.intl-is-failure.php                       30-Sep-2022 11:09                5900
function.intval.php                                30-Sep-2022 11:09               15641
function.ip2long.php                               30-Sep-2022 11:09               10183
function.iptcembed.php                             30-Sep-2022 11:09               13299
function.iptcparse.php                             30-Sep-2022 11:09                4953
function.is-a.php                                  30-Sep-2022 11:09                7722
function.is-array.php                              30-Sep-2022 11:09                6247
function.is-bool.php                               30-Sep-2022 11:09                6403
function.is-callable.php                           30-Sep-2022 11:09               12376
function.is-countable.php                          30-Sep-2022 11:09                6806
function.is-dir.php                                30-Sep-2022 11:09                7539
function.is-double.php                             30-Sep-2022 11:09                1737
function.is-executable.php                         30-Sep-2022 11:09                7460
function.is-file.php                               30-Sep-2022 11:09                6790
function.is-finite.php                             30-Sep-2022 11:09                3526
function.is-float.php                              30-Sep-2022 11:09                5935
function.is-infinite.php                           30-Sep-2022 11:09                3713
function.is-int.php                                30-Sep-2022 11:09                7459
function.is-integer.php                            30-Sep-2022 11:09                1730
function.is-iterable.php                           30-Sep-2022 11:09                6167
function.is-link.php                               30-Sep-2022 11:09                6400
function.is-long.php                               30-Sep-2022 11:09                1711
function.is-nan.php                                30-Sep-2022 11:09                5050
function.is-null.php                               30-Sep-2022 11:09                6600
function.is-numeric.php                            30-Sep-2022 11:09               14021
function.is-object.php                             30-Sep-2022 11:09                8005
function.is-readable.php                           30-Sep-2022 11:09                7259
function.is-real.php                               30-Sep-2022 11:09                1976
function.is-resource.php                           30-Sep-2022 11:09                5424
function.is-scalar.php                             30-Sep-2022 11:09                8917
function.is-soap-fault.php                         30-Sep-2022 11:09                9089
function.is-string.php                             30-Sep-2022 11:09                7270
function.is-subclass-of.php                        30-Sep-2022 11:09               14688
function.is-tainted.php                            30-Sep-2022 11:09                2469
function.is-uploaded-file.php                      30-Sep-2022 11:09                7660
function.is-writable.php                           30-Sep-2022 11:09                6935
function.is-writeable.php                          30-Sep-2022 11:09                1772
function.isset.php                                 30-Sep-2022 11:09               18444
function.iterator-apply.php                        30-Sep-2022 11:09                7390
function.iterator-count.php                        30-Sep-2022 11:09                8298
function.iterator-to-array.php                     30-Sep-2022 11:09                7065
function.jddayofweek.php                           30-Sep-2022 11:09                4105
function.jdmonthname.php                           30-Sep-2022 11:09                5166
function.jdtofrench.php                            30-Sep-2022 11:09                3660
function.jdtogregorian.php                         30-Sep-2022 11:09                3712
function.jdtojewish.php                            30-Sep-2022 11:09                7926
function.jdtojulian.php                            30-Sep-2022 11:09                3611
function.jdtounix.php                              30-Sep-2022 11:09                4896
function.jewishtojd.php                            30-Sep-2022 11:09                5194
function.join.php                                  30-Sep-2022 11:09                1695
function.jpeg2wbmp.php                             30-Sep-2022 11:09                7044
function.json-decode.php                           30-Sep-2022 11:09               22528
function.json-encode.php                           30-Sep-2022 11:09               33730
function.json-last-error-msg.php                   30-Sep-2022 11:09                3329
function.json-last-error.php                       30-Sep-2022 11:09               16302
function.juliantojd.php                            30-Sep-2022 11:09                5300
function.key-exists.php                            30-Sep-2022 11:09                1772
function.key.php                                   30-Sep-2022 11:09                8176
function.krsort.php                                30-Sep-2022 11:09                8795
function.ksort.php                                 30-Sep-2022 11:09               10806
function.lcfirst.php                               30-Sep-2022 11:09                6245
function.lcg-value.php                             30-Sep-2022 11:09                4173
function.lchgrp.php                                30-Sep-2022 11:09                6648
function.lchown.php                                30-Sep-2022 11:09                6353
function.ldap-8859-to-t61.php                      30-Sep-2022 11:09                3513
function.ldap-add-ext.php                          30-Sep-2022 11:09                5986
function.ldap-add.php                              30-Sep-2022 11:09               11552
function.ldap-bind-ext.php                         30-Sep-2022 11:09                5909
function.ldap-bind.php                             30-Sep-2022 11:09               10874
function.ldap-close.php                            30-Sep-2022 11:09                1717
function.ldap-compare.php                          30-Sep-2022 11:09               11946
function.ldap-connect.php                          30-Sep-2022 11:09               10868
function.ldap-control-paged-result-response.php    30-Sep-2022 11:09                6458
function.ldap-control-paged-result.php             30-Sep-2022 11:09               17345
function.ldap-count-entries.php                    30-Sep-2022 11:09                6371
function.ldap-count-references.php                 30-Sep-2022 11:09                5024
function.ldap-delete-ext.php                       30-Sep-2022 11:09                5474
function.ldap-delete.php                           30-Sep-2022 11:09                5516
function.ldap-dn2ufn.php                           30-Sep-2022 11:09                2854
function.ldap-err2str.php                          30-Sep-2022 11:09                5270
function.ldap-errno.php                            30-Sep-2022 11:09                8703
function.ldap-error.php                            30-Sep-2022 11:09                5375
function.ldap-escape.php                           30-Sep-2022 11:09                6843
function.ldap-exop-passwd.php                      30-Sep-2022 11:09               11730
function.ldap-exop-refresh.php                     30-Sep-2022 11:09                5736
function.ldap-exop-whoami.php                      30-Sep-2022 11:09                4086
function.ldap-exop.php                             30-Sep-2022 11:09               13722
function.ldap-explode-dn.php                       30-Sep-2022 11:09                4054
function.ldap-first-attribute.php                  30-Sep-2022 11:09                6845
function.ldap-first-entry.php                      30-Sep-2022 11:09                6343
function.ldap-first-reference.php                  30-Sep-2022 11:09                2524
function.ldap-free-result.php                      30-Sep-2022 11:09                4620
function.ldap-get-attributes.php                   30-Sep-2022 11:09                9522
function.ldap-get-dn.php                           30-Sep-2022 11:09                4460
function.ldap-get-entries.php                      30-Sep-2022 11:09                6933
function.ldap-get-option.php                       30-Sep-2022 11:09               13280
function.ldap-get-values-len.php                   30-Sep-2022 11:09                6006
function.ldap-get-values.php                       30-Sep-2022 11:09               10081
function.ldap-list.php                             30-Sep-2022 11:09               17333
function.ldap-mod-add.php                          30-Sep-2022 11:09                7567
function.ldap-mod-del.php                          30-Sep-2022 11:09                6706
function.ldap-mod-replace.php                      30-Sep-2022 11:09                7364
function.ldap-mod_add-ext.php                      30-Sep-2022 11:09                5967
function.ldap-mod_del-ext.php                      30-Sep-2022 11:09                5975
function.ldap-mod_replace-ext.php                  30-Sep-2022 11:09                6013
function.ldap-modify-batch.php                     30-Sep-2022 11:09               22102
function.ldap-modify.php                           30-Sep-2022 11:09                2161
function.ldap-next-attribute.php                   30-Sep-2022 11:09                6150
function.ldap-next-entry.php                       30-Sep-2022 11:09                6404
function.ldap-next-reference.php                   30-Sep-2022 11:09                2504
function.ldap-parse-exop.php                       30-Sep-2022 11:09                6101
function.ldap-parse-reference.php                  30-Sep-2022 11:09                2503
function.ldap-parse-result.php                     30-Sep-2022 11:09               10046
function.ldap-read.php                             30-Sep-2022 11:09               14519
function.ldap-rename-ext.php                       30-Sep-2022 11:09                6146
function.ldap-rename.php                           30-Sep-2022 11:09                7510
function.ldap-sasl-bind.php                        30-Sep-2022 11:09                6462
function.ldap-search.php                           30-Sep-2022 11:09               17653
function.ldap-set-option.php                       30-Sep-2022 11:09               17269
function.ldap-set-rebind-proc.php                  30-Sep-2022 11:09                3446
function.ldap-sort.php                             30-Sep-2022 11:09                8188
function.ldap-start-tls.php                        30-Sep-2022 11:09                2119
function.ldap-t61-to-8859.php                      30-Sep-2022 11:09                2201
function.ldap-unbind.php                           30-Sep-2022 11:09                4035
function.levenshtein.php                           30-Sep-2022 11:09               14587
function.libxml-clear-errors.php                   30-Sep-2022 11:09                3116
function.libxml-disable-entity-loader.php          30-Sep-2022 11:09                5515
function.libxml-get-errors.php                     30-Sep-2022 11:09               12416
function.libxml-get-last-error.php                 30-Sep-2022 11:09                3408
function.libxml-set-external-entity-loader.php     30-Sep-2022 11:09               10834
function.libxml-set-streams-context.php            30-Sep-2022 11:09                5604
function.libxml-use-internal-errors.php            30-Sep-2022 11:09                7382
function.link.php                                  30-Sep-2022 11:09                6503
function.linkinfo.php                              30-Sep-2022 11:09                5112
function.list.php                                  30-Sep-2022 11:09               19216
function.localeconv.php                            30-Sep-2022 11:09               11398
function.localtime.php                             30-Sep-2022 11:09               10168
function.log.php                                   30-Sep-2022 11:09                4127
function.log10.php                                 30-Sep-2022 11:09                2763
function.log1p.php                                 30-Sep-2022 11:09                3822
function.long2ip.php                               30-Sep-2022 11:09                4515
function.lstat.php                                 30-Sep-2022 11:09                7371
function.ltrim.php                                 30-Sep-2022 11:09               10342
function.lzf-compress.php                          30-Sep-2022 11:08                2987
function.lzf-decompress.php                        30-Sep-2022 11:08                3128
function.lzf-optimized-for.php                     30-Sep-2022 11:08                2430
function.mail.php                                  30-Sep-2022 11:09               31444
function.mailparse-determine-best-xfer-encoding..> 30-Sep-2022 11:09                4570
function.mailparse-msg-create.php                  30-Sep-2022 11:09                3682
function.mailparse-msg-extract-part-file.php       30-Sep-2022 11:09                5747
function.mailparse-msg-extract-part.php            30-Sep-2022 11:09                4406
function.mailparse-msg-extract-whole-part-file.php 30-Sep-2022 11:09                4329
function.mailparse-msg-free.php                    30-Sep-2022 11:09                3692
function.mailparse-msg-get-part-data.php           30-Sep-2022 11:09                2663
function.mailparse-msg-get-part.php                30-Sep-2022 11:09                2885
function.mailparse-msg-get-structure.php           30-Sep-2022 11:09                2668
function.mailparse-msg-parse-file.php              30-Sep-2022 11:09                4611
function.mailparse-msg-parse.php                   30-Sep-2022 11:09                3733
function.mailparse-rfc822-parse-addresses.php      30-Sep-2022 11:09                6004
function.mailparse-stream-encode.php               30-Sep-2022 11:09                6026
function.mailparse-uudecode-all.php                30-Sep-2022 11:09                7488
function.max.php                                   30-Sep-2022 11:09               15054
function.mb-check-encoding.php                     30-Sep-2022 11:09                5590
function.mb-chr.php                                30-Sep-2022 11:09                7745
function.mb-convert-case.php                       30-Sep-2022 11:09               12655
function.mb-convert-encoding.php                   30-Sep-2022 11:09               12332
function.mb-convert-kana.php                       30-Sep-2022 11:09               10382
function.mb-convert-variables.php                  30-Sep-2022 11:09                7587
function.mb-decode-mimeheader.php                  30-Sep-2022 11:09                3326
function.mb-decode-numericentity.php               30-Sep-2022 11:09               37007
function.mb-detect-encoding.php                    30-Sep-2022 11:09               17763
function.mb-detect-order.php                       30-Sep-2022 11:09               10387
function.mb-encode-mimeheader.php                  30-Sep-2022 11:09               10407
function.mb-encode-numericentity.php               30-Sep-2022 11:09               13936
function.mb-encoding-aliases.php                   30-Sep-2022 11:09                6269
function.mb-ereg-match.php                         30-Sep-2022 11:09                5958
function.mb-ereg-replace-callback.php              30-Sep-2022 11:09               14731
function.mb-ereg-replace.php                       30-Sep-2022 11:09                7941
function.mb-ereg-search-getpos.php                 30-Sep-2022 11:09                4639
function.mb-ereg-search-getregs.php                30-Sep-2022 11:09                5192
function.mb-ereg-search-init.php                   30-Sep-2022 11:09                6634
function.mb-ereg-search-pos.php                    30-Sep-2022 11:09                6606
function.mb-ereg-search-regs.php                   30-Sep-2022 11:09                6465
function.mb-ereg-search-setpos.php                 30-Sep-2022 11:09                5339
function.mb-ereg-search.php                        30-Sep-2022 11:09                6236
function.mb-ereg.php                               30-Sep-2022 11:09                7546
function.mb-eregi-replace.php                      30-Sep-2022 11:09                8032
function.mb-eregi.php                              30-Sep-2022 11:09                7675
function.mb-get-info.php                           30-Sep-2022 11:09                6577
function.mb-http-input.php                         30-Sep-2022 11:09                5583
function.mb-http-output.php                        30-Sep-2022 11:09                5618
function.mb-internal-encoding.php                  30-Sep-2022 11:09                8414
function.mb-language.php                           30-Sep-2022 11:09                7211
function.mb-list-encodings.php                     30-Sep-2022 11:09                5466
function.mb-ord.php                                30-Sep-2022 11:09                7178
function.mb-output-handler.php                     30-Sep-2022 11:09                6025
function.mb-parse-str.php                          30-Sep-2022 11:09                5413
function.mb-preferred-mime-name.php                30-Sep-2022 11:09                4724
function.mb-regex-encoding.php                     30-Sep-2022 11:09                5266
function.mb-regex-set-options.php                  30-Sep-2022 11:09                8546
function.mb-scrub.php                              30-Sep-2022 11:09                3499
function.mb-send-mail.php                          30-Sep-2022 11:09               11654
function.mb-split.php                              30-Sep-2022 11:09                5182
function.mb-str-split.php                          30-Sep-2022 11:09                5867
function.mb-strcut.php                             30-Sep-2022 11:09                8386
function.mb-strimwidth.php                         30-Sep-2022 11:09                8198
function.mb-stripos.php                            30-Sep-2022 11:09                7004
function.mb-stristr.php                            30-Sep-2022 11:09                7051
function.mb-strlen.php                             30-Sep-2022 11:09                5477
function.mb-strpos.php                             30-Sep-2022 11:09                7092
function.mb-strrchr.php                            30-Sep-2022 11:09                6987
function.mb-strrichr.php                           30-Sep-2022 11:09                7077
function.mb-strripos.php                           30-Sep-2022 11:09                6964
function.mb-strrpos.php                            30-Sep-2022 11:09                7391
function.mb-strstr.php                             30-Sep-2022 11:09                6842
function.mb-strtolower.php                         30-Sep-2022 11:09                8235
function.mb-strtoupper.php                         30-Sep-2022 11:09                8248
function.mb-strwidth.php                           30-Sep-2022 11:09                9826
function.mb-substitute-character.php               30-Sep-2022 11:09                7855
function.mb-substr-count.php                       30-Sep-2022 11:09                6320
function.mb-substr.php                             30-Sep-2022 11:09                7011
function.mcrypt-create-iv.php                      30-Sep-2022 11:09                7526
function.mcrypt-decrypt.php                        30-Sep-2022 11:09                6355
function.mcrypt-enc-get-algorithms-name.php        30-Sep-2022 11:09                5609
function.mcrypt-enc-get-block-size.php             30-Sep-2022 11:09                3158
function.mcrypt-enc-get-iv-size.php                30-Sep-2022 11:09                3634
function.mcrypt-enc-get-key-size.php               30-Sep-2022 11:09                3274
function.mcrypt-enc-get-modes-name.php             30-Sep-2022 11:09                5579
function.mcrypt-enc-get-supported-key-sizes.php    30-Sep-2022 11:09                5473
function.mcrypt-enc-is-block-algorithm-mode.php    30-Sep-2022 11:09                3551
function.mcrypt-enc-is-block-algorithm.php         30-Sep-2022 11:09                3376
function.mcrypt-enc-is-block-mode.php              30-Sep-2022 11:09                3450
function.mcrypt-enc-self-test.php                  30-Sep-2022 11:09                3321
function.mcrypt-encrypt.php                        30-Sep-2022 11:09               17251
function.mcrypt-generic-deinit.php                 30-Sep-2022 11:09                4561
function.mcrypt-generic-init.php                   30-Sep-2022 11:09                6243
function.mcrypt-generic.php                        30-Sep-2022 11:09                7409
function.mcrypt-get-block-size.php                 30-Sep-2022 11:09                7042
function.mcrypt-get-cipher-name.php                30-Sep-2022 11:09                5191
function.mcrypt-get-iv-size.php                    30-Sep-2022 11:09                7672
function.mcrypt-get-key-size.php                   30-Sep-2022 11:09                7389
function.mcrypt-list-algorithms.php                30-Sep-2022 11:09                5258
function.mcrypt-list-modes.php                     30-Sep-2022 11:09                5284
function.mcrypt-module-close.php                   30-Sep-2022 11:09                3720
function.mcrypt-module-get-algo-block-size.php     30-Sep-2022 11:09                3738
function.mcrypt-module-get-algo-key-size.php       30-Sep-2022 11:09                3820
function.mcrypt-module-get-supported-key-sizes.php 30-Sep-2022 11:09                5255
function.mcrypt-module-is-block-algorithm-mode.php 30-Sep-2022 11:09                4458
function.mcrypt-module-is-block-algorithm.php      30-Sep-2022 11:09                4058
function.mcrypt-module-is-block-mode.php           30-Sep-2022 11:09                4445
function.mcrypt-module-open.php                    30-Sep-2022 11:09               16477
function.mcrypt-module-self-test.php               30-Sep-2022 11:09                5318
function.md5-file.php                              30-Sep-2022 11:09                5399
function.md5.php                                   30-Sep-2022 11:09                6575
function.mdecrypt-generic.php                      30-Sep-2022 11:09               13190
function.memcache-debug.php                        30-Sep-2022 11:09                3718
function.memory-get-peak-usage.php                 30-Sep-2022 11:08                4029
function.memory-get-usage.php                      30-Sep-2022 11:08                6190
function.memory-reset-peak-usage.php               30-Sep-2022 11:08                5283
function.metaphone.php                             30-Sep-2022 11:09                9181
function.method-exists.php                         30-Sep-2022 11:09                7046
function.mhash-count.php                           30-Sep-2022 11:09                5255
function.mhash-get-block-size.php                  30-Sep-2022 11:09                4834
function.mhash-get-hash-name.php                   30-Sep-2022 11:09                4734
function.mhash-keygen-s2k.php                      30-Sep-2022 11:09                6234
function.mhash.php                                 30-Sep-2022 11:09                5129
function.microtime.php                             30-Sep-2022 11:09                9011
function.mime-content-type.php                     30-Sep-2022 11:09                5234
function.min.php                                   30-Sep-2022 11:09               15090
function.mkdir.php                                 30-Sep-2022 11:09               10799
function.mktime.php                                30-Sep-2022 11:09               21539
function.money-format.php                          30-Sep-2022 11:09               22040
function.mongodb.bson-fromjson.php                 30-Sep-2022 11:09                6256
function.mongodb.bson-fromphp.php                  30-Sep-2022 11:09                6387
function.mongodb.bson-tocanonicalextendedjson.php  30-Sep-2022 11:09               16969
function.mongodb.bson-tojson.php                   30-Sep-2022 11:09               18635
function.mongodb.bson-tophp.php                    30-Sep-2022 11:09               10356
function.mongodb.bson-torelaxedextendedjson.php    30-Sep-2022 11:09               16587
function.mongodb.driver.monitoring.addsubscribe..> 30-Sep-2022 11:09                6018
function.mongodb.driver.monitoring.removesubscr..> 30-Sep-2022 11:09                5701
function.move-uploaded-file.php                    30-Sep-2022 11:09               10170
function.mqseries-back.php                         30-Sep-2022 11:09                7120
function.mqseries-begin.php                        30-Sep-2022 11:09                8377
function.mqseries-close.php                        30-Sep-2022 11:09                6901
function.mqseries-cmit.php                         30-Sep-2022 11:09                6832
function.mqseries-conn.php                         30-Sep-2022 11:09                6358
function.mqseries-connx.php                        30-Sep-2022 11:09               14957
function.mqseries-disc.php                         30-Sep-2022 11:09                5982
function.mqseries-get.php                          30-Sep-2022 11:09               13559
function.mqseries-inq.php                          30-Sep-2022 11:09                9655
function.mqseries-open.php                         30-Sep-2022 11:09                8048
function.mqseries-put.php                          30-Sep-2022 11:09               14644
function.mqseries-put1.php                         30-Sep-2022 11:09                6556
function.mqseries-set.php                          30-Sep-2022 11:09                6116
function.mqseries-strerror.php                     30-Sep-2022 11:09                4503
function.msg-get-queue.php                         30-Sep-2022 11:09                6502
function.msg-queue-exists.php                      30-Sep-2022 11:09                3655
function.msg-receive.php                           30-Sep-2022 11:09               12856
function.msg-remove-queue.php                      30-Sep-2022 11:09                5134
function.msg-send.php                              30-Sep-2022 11:09                9962
function.msg-set-queue.php                         30-Sep-2022 11:09                5834
function.msg-stat-queue.php                        30-Sep-2022 11:09                7509
function.mt-getrandmax.php                         30-Sep-2022 11:09                6310
function.mt-rand.php                               30-Sep-2022 11:09               12408
function.mt-srand.php                              30-Sep-2022 11:09                9341
function.mysql-affected-rows.php                   30-Sep-2022 11:09               14152
function.mysql-client-encoding.php                 30-Sep-2022 11:09                6835
function.mysql-close.php                           30-Sep-2022 11:09                8541
function.mysql-connect.php                         30-Sep-2022 11:09               19608
function.mysql-create-db.php                       30-Sep-2022 11:09                9467
function.mysql-data-seek.php                       30-Sep-2022 11:09               13689
function.mysql-db-name.php                         30-Sep-2022 11:09                8373
function.mysql-db-query.php                        30-Sep-2022 11:09               11204
function.mysql-drop-db.php                         30-Sep-2022 11:09                8696
function.mysql-errno.php                           30-Sep-2022 11:09                9069
function.mysql-error.php                           30-Sep-2022 11:09                9087
function.mysql-escape-string.php                   30-Sep-2022 11:09                7548
function.mysql-fetch-array.php                     30-Sep-2022 11:09               17298
function.mysql-fetch-assoc.php                     30-Sep-2022 11:09               13910
function.mysql-fetch-field.php                     30-Sep-2022 11:09               15041
function.mysql-fetch-lengths.php                   30-Sep-2022 11:09                8361
function.mysql-fetch-object.php                    30-Sep-2022 11:09               13189
function.mysql-fetch-row.php                       30-Sep-2022 11:09                8831
function.mysql-field-flags.php                     30-Sep-2022 11:09                9350
function.mysql-field-len.php                       30-Sep-2022 11:09                7594
function.mysql-field-name.php                      30-Sep-2022 11:09               10027
function.mysql-field-seek.php                      30-Sep-2022 11:09                5464
function.mysql-field-table.php                     30-Sep-2022 11:09                8384
function.mysql-field-type.php                      30-Sep-2022 11:09               12785
function.mysql-free-result.php                     30-Sep-2022 11:09                8995
function.mysql-get-client-info.php                 30-Sep-2022 11:09                5558
function.mysql-get-host-info.php                   30-Sep-2022 11:09                7700
function.mysql-get-proto-info.php                  30-Sep-2022 11:09                7313
function.mysql-get-server-info.php                 30-Sep-2022 11:09                7637
function.mysql-info.php                            30-Sep-2022 11:09                7119
function.mysql-insert-id.php                       30-Sep-2022 11:09                9623
function.mysql-list-dbs.php                        30-Sep-2022 11:09                9788
function.mysql-list-fields.php                     30-Sep-2022 11:09                9823
function.mysql-list-processes.php                  30-Sep-2022 11:09                8219
function.mysql-list-tables.php                     30-Sep-2022 11:09               10693
function.mysql-num-fields.php                      30-Sep-2022 11:09                7362
function.mysql-num-rows.php                        30-Sep-2022 11:09                9029
function.mysql-pconnect.php                        30-Sep-2022 11:09                9347
function.mysql-ping.php                            30-Sep-2022 11:09                9058
function.mysql-query.php                           30-Sep-2022 11:09               16534
function.mysql-real-escape-string.php              30-Sep-2022 11:09               19187
function.mysql-result.php                          30-Sep-2022 11:09               11201
function.mysql-select-db.php                       30-Sep-2022 11:09                8670
function.mysql-set-charset.php                     30-Sep-2022 11:09                6583
function.mysql-stat.php                            30-Sep-2022 11:09               10230
function.mysql-tablename.php                       30-Sep-2022 11:09                8811
function.mysql-thread-id.php                       30-Sep-2022 11:09                7704
function.mysql-unbuffered-query.php                30-Sep-2022 11:09                8039
function.mysql-xdevapi-expression.php              30-Sep-2022 11:09                5159
function.mysql-xdevapi-getsession.php              30-Sep-2022 11:09               15579
function.mysqli-connect.php                        30-Sep-2022 11:09                2506
function.mysqli-escape-string.php                  30-Sep-2022 11:09                1997
function.mysqli-execute.php                        30-Sep-2022 11:09                2663
function.mysqli-get-client-stats.php               30-Sep-2022 11:09                8633
function.mysqli-get-links-stats.php                30-Sep-2022 11:09                3699
function.mysqli-report.php                         30-Sep-2022 11:09                1784
function.mysqli-set-opt.php                        30-Sep-2022 11:09                1893
function.natcasesort.php                           30-Sep-2022 11:09                7963
function.natsort.php                               30-Sep-2022 11:09               11415
function.net-get-interfaces.php                    30-Sep-2022 11:09                5451
function.next.php                                  30-Sep-2022 11:09               10491
function.ngettext.php                              30-Sep-2022 11:09                6323
function.nl-langinfo.php                           30-Sep-2022 11:09               18113
function.nl2br.php                                 30-Sep-2022 11:09                7554
function.number-format.php                         30-Sep-2022 11:09                9497
function.oauth-get-sbs.php                         30-Sep-2022 11:09                3182
function.oauth-urlencode.php                       30-Sep-2022 11:09                2672
function.ob-clean.php                              30-Sep-2022 11:08                4058
function.ob-end-clean.php                          30-Sep-2022 11:08                6094
function.ob-end-flush.php                          30-Sep-2022 11:08                6996
function.ob-flush.php                              30-Sep-2022 11:08                4312
function.ob-get-clean.php                          30-Sep-2022 11:08                5860
function.ob-get-contents.php                       30-Sep-2022 11:08                5074
function.ob-get-flush.php                          30-Sep-2022 11:08                6436
function.ob-get-length.php                         30-Sep-2022 11:08                5028
function.ob-get-level.php                          30-Sep-2022 11:08                3126
function.ob-get-status.php                         30-Sep-2022 11:08                7801
function.ob-gzhandler.php                          30-Sep-2022 11:08                6665
function.ob-iconv-handler.php                      30-Sep-2022 11:09                5734
function.ob-implicit-flush.php                     30-Sep-2022 11:08                4802
function.ob-list-handlers.php                      30-Sep-2022 11:08                6513
function.ob-start.php                              30-Sep-2022 11:08               19315
function.ob-tidyhandler.php                        30-Sep-2022 11:09                4520
function.oci-bind-array-by-name.php                30-Sep-2022 11:09               15117
function.oci-bind-by-name.php                      30-Sep-2022 11:09               90161
function.oci-cancel.php                            30-Sep-2022 11:09                2743
function.oci-client-version.php                    30-Sep-2022 11:09                4397
function.oci-close.php                             30-Sep-2022 11:09               23065
function.oci-commit.php                            30-Sep-2022 11:09               13042
function.oci-connect.php                           30-Sep-2022 11:09               42229
function.oci-define-by-name.php                    30-Sep-2022 11:09               27523
function.oci-error.php                             30-Sep-2022 11:09               12658
function.oci-execute.php                           30-Sep-2022 11:09               24673
function.oci-fetch-all.php                         30-Sep-2022 11:09               30363
function.oci-fetch-array.php                       30-Sep-2022 11:09               75571
function.oci-fetch-assoc.php                       30-Sep-2022 11:09                9893
function.oci-fetch-object.php                      30-Sep-2022 11:09               21717
function.oci-fetch-row.php                         30-Sep-2022 11:09                9781
function.oci-fetch.php                             30-Sep-2022 11:09               15643
function.oci-field-is-null.php                     30-Sep-2022 11:09                9105
function.oci-field-name.php                        30-Sep-2022 11:09               11731
function.oci-field-precision.php                   30-Sep-2022 11:09               10483
function.oci-field-scale.php                       30-Sep-2022 11:09               10526
function.oci-field-size.php                        30-Sep-2022 11:09               12398
function.oci-field-type-raw.php                    30-Sep-2022 11:09                9463
function.oci-field-type.php                        30-Sep-2022 11:09               12662
function.oci-free-descriptor.php                   30-Sep-2022 11:09                3705
function.oci-free-statement.php                    30-Sep-2022 11:09                3084
function.oci-get-implicit-resultset.php            30-Sep-2022 11:09               34040
function.oci-internal-debug.php                    30-Sep-2022 11:09                4254
function.oci-lob-copy.php                          30-Sep-2022 11:09                4962
function.oci-lob-is-equal.php                      30-Sep-2022 11:09                3381
function.oci-new-collection.php                    30-Sep-2022 11:09                5992
function.oci-new-connect.php                       30-Sep-2022 11:09               19520
function.oci-new-cursor.php                        30-Sep-2022 11:09                9295
function.oci-new-descriptor.php                    30-Sep-2022 11:09               22597
function.oci-num-fields.php                        30-Sep-2022 11:09                8292
function.oci-num-rows.php                          30-Sep-2022 11:09                9280
function.oci-parse.php                             30-Sep-2022 11:09               14309
function.oci-password-change.php                   30-Sep-2022 11:09               15928
function.oci-pconnect.php                          30-Sep-2022 11:09               17599
function.oci-register-taf-callback.php             30-Sep-2022 11:09                6242
function.oci-result.php                            30-Sep-2022 11:09               10801
function.oci-rollback.php                          30-Sep-2022 11:09               16755
function.oci-server-version.php                    30-Sep-2022 11:09                5951
function.oci-set-action.php                        30-Sep-2022 11:09                9719
function.oci-set-call-timout.php                   30-Sep-2022 11:09                7116
function.oci-set-client-identifier.php             30-Sep-2022 11:09                9433
function.oci-set-client-info.php                   30-Sep-2022 11:09                9618
function.oci-set-db-operation.php                  30-Sep-2022 11:09                8818
function.oci-set-edition.php                       30-Sep-2022 11:09               11390
function.oci-set-module-name.php                   30-Sep-2022 11:09                9763
function.oci-set-prefetch-lob.php                  30-Sep-2022 11:09               10147
function.oci-set-prefetch.php                      30-Sep-2022 11:09               26663
function.oci-statement-type.php                    30-Sep-2022 11:09                7595
function.oci-unregister-taf-callback.php           30-Sep-2022 11:09                3871
function.ocibindbyname.php                         30-Sep-2022 11:09                2124
function.ocicancel.php                             30-Sep-2022 11:09                2066
function.ocicloselob.php                           30-Sep-2022 11:09                2065
function.ocicollappend.php                         30-Sep-2022 11:09                2130
function.ocicollassign.php                         30-Sep-2022 11:09                2135
function.ocicollassignelem.php                     30-Sep-2022 11:09                2180
function.ocicollgetelem.php                        30-Sep-2022 11:09                2147
function.ocicollmax.php                            30-Sep-2022 11:09                2099
function.ocicollsize.php                           30-Sep-2022 11:09                2102
function.ocicolltrim.php                           30-Sep-2022 11:09                2112
function.ocicolumnisnull.php                       30-Sep-2022 11:09                2136
function.ocicolumnname.php                         30-Sep-2022 11:09                2128
function.ocicolumnprecision.php                    30-Sep-2022 11:09                2171
function.ocicolumnscale.php                        30-Sep-2022 11:09                2135
function.ocicolumnsize.php                         30-Sep-2022 11:09                2116
function.ocicolumntype.php                         30-Sep-2022 11:09                2120
function.ocicolumntyperaw.php                      30-Sep-2022 11:09                2143
function.ocicommit.php                             30-Sep-2022 11:09                2080
function.ocidefinebyname.php                       30-Sep-2022 11:09                2126
function.ocierror.php                              30-Sep-2022 11:09                2057
function.ociexecute.php                            30-Sep-2022 11:09                2061
function.ocifetch.php                              30-Sep-2022 11:09                2051
function.ocifetchinto.php                          30-Sep-2022 11:09                2837
function.ocifetchstatement.php                     30-Sep-2022 11:09                2144
function.ocifreecollection.php                     30-Sep-2022 11:09                2162
function.ocifreecursor.php                         30-Sep-2022 11:09                2134
function.ocifreedesc.php                           30-Sep-2022 11:09                2078
function.ocifreestatement.php                      30-Sep-2022 11:09                2153
function.ociinternaldebug.php                      30-Sep-2022 11:09                2167
function.ociloadlob.php                            30-Sep-2022 11:09                2063
function.ocilogoff.php                             30-Sep-2022 11:09                2050
function.ocilogon.php                              30-Sep-2022 11:09                2065
function.ocinewcollection.php                      30-Sep-2022 11:09                2151
function.ocinewcursor.php                          30-Sep-2022 11:09                2119
function.ocinewdescriptor.php                      30-Sep-2022 11:09                2141
function.ocinlogon.php                             30-Sep-2022 11:09                2090
function.ocinumcols.php                            30-Sep-2022 11:09                2075
function.ociparse.php                              30-Sep-2022 11:09                2045
function.ociplogon.php                             30-Sep-2022 11:09                2060
function.ociresult.php                             30-Sep-2022 11:09                2058
function.ocirollback.php                           30-Sep-2022 11:09                2080
function.ocirowcount.php                           30-Sep-2022 11:09                2082
function.ocisavelob.php                            30-Sep-2022 11:09                2063
function.ocisavelobfile.php                        30-Sep-2022 11:09                2101
function.ociserverversion.php                      30-Sep-2022 11:09                2155
function.ocisetprefetch.php                        30-Sep-2022 11:09                2141
function.ocistatementtype.php                      30-Sep-2022 11:09                2161
function.ociwritelobtofile.php                     30-Sep-2022 11:09                2142
function.ociwritetemporarylob.php                  30-Sep-2022 11:09                2165
function.octdec.php                                30-Sep-2022 11:09                6772
function.odbc-autocommit.php                       30-Sep-2022 11:09                4960
function.odbc-binmode.php                          30-Sep-2022 11:09                7598
function.odbc-close-all.php                        30-Sep-2022 11:09                2879
function.odbc-close.php                            30-Sep-2022 11:09                3157
function.odbc-columnprivileges.php                 30-Sep-2022 11:09                9573
function.odbc-columns.php                          30-Sep-2022 11:09               12322
function.odbc-commit.php                           30-Sep-2022 11:09                2778
function.odbc-connect.php                          30-Sep-2022 11:09                9502
function.odbc-cursor.php                           30-Sep-2022 11:09                2668
function.odbc-data-source.php                      30-Sep-2022 11:09                6170
function.odbc-do.php                               30-Sep-2022 11:09                1700
function.odbc-error.php                            30-Sep-2022 11:09                4600
function.odbc-errormsg.php                         30-Sep-2022 11:09                4676
function.odbc-exec.php                             30-Sep-2022 11:09                4256
function.odbc-execute.php                          30-Sep-2022 11:09                8036
function.odbc-fetch-array.php                      30-Sep-2022 11:09                4599
function.odbc-fetch-into.php                       30-Sep-2022 11:09                5252
function.odbc-fetch-object.php                     30-Sep-2022 11:09                4626
function.odbc-fetch-row.php                        30-Sep-2022 11:09                5233
function.odbc-field-len.php                        30-Sep-2022 11:09                3600
function.odbc-field-name.php                       30-Sep-2022 11:09                3111
function.odbc-field-num.php                        30-Sep-2022 11:09                3156
function.odbc-field-precision.php                  30-Sep-2022 11:09                2339
function.odbc-field-scale.php                      30-Sep-2022 11:09                3152
function.odbc-field-type.php                       30-Sep-2022 11:09                3110
function.odbc-foreignkeys.php                      30-Sep-2022 11:09               10031
function.odbc-free-result.php                      30-Sep-2022 11:09                3719
function.odbc-gettypeinfo.php                      30-Sep-2022 11:09                4828
function.odbc-longreadlen.php                      30-Sep-2022 11:09                4221
function.odbc-next-result.php                      30-Sep-2022 11:09               10124
function.odbc-num-fields.php                       30-Sep-2022 11:09                2761
function.odbc-num-rows.php                         30-Sep-2022 11:09                3642
function.odbc-pconnect.php                         30-Sep-2022 11:09                5091
function.odbc-prepare.php                          30-Sep-2022 11:09                7150
function.odbc-primarykeys.php                      30-Sep-2022 11:09                8505
function.odbc-procedurecolumns.php                 30-Sep-2022 11:09               12579
function.odbc-procedures.php                       30-Sep-2022 11:09               10403
function.odbc-result-all.php                       30-Sep-2022 11:09                4666
function.odbc-result.php                           30-Sep-2022 11:09                6256
function.odbc-rollback.php                         30-Sep-2022 11:09                2799
function.odbc-setoption.php                        30-Sep-2022 11:09                8551
function.odbc-specialcolumns.php                   30-Sep-2022 11:09                8212
function.odbc-statistics.php                       30-Sep-2022 11:09               10275
function.odbc-tableprivileges.php                  30-Sep-2022 11:09                9075
function.odbc-tables.php                           30-Sep-2022 11:09               14314
function.opcache-compile-file.php                  30-Sep-2022 11:08                3998
function.opcache-get-configuration.php             30-Sep-2022 11:08                3580
function.opcache-get-status.php                    30-Sep-2022 11:08                4090
function.opcache-invalidate.php                    30-Sep-2022 11:08                4523
function.opcache-is-script-cached.php              30-Sep-2022 11:08                3556
function.opcache-reset.php                         30-Sep-2022 11:08                3243
function.openal-buffer-create.php                  30-Sep-2022 11:08                3053
function.openal-buffer-data.php                    30-Sep-2022 11:08                4821
function.openal-buffer-destroy.php                 30-Sep-2022 11:08                3203
function.openal-buffer-get.php                     30-Sep-2022 11:08                3842
function.openal-buffer-loadwav.php                 30-Sep-2022 11:08                3815
function.openal-context-create.php                 30-Sep-2022 11:08                3470
function.openal-context-current.php                30-Sep-2022 11:08                3281
function.openal-context-destroy.php                30-Sep-2022 11:08                3255
function.openal-context-process.php                30-Sep-2022 11:08                3745
function.openal-context-suspend.php                30-Sep-2022 11:08                3739
function.openal-device-close.php                   30-Sep-2022 11:08                3262
function.openal-device-open.php                    30-Sep-2022 11:08                3610
function.openal-listener-get.php                   30-Sep-2022 11:08                3529
function.openal-listener-set.php                   30-Sep-2022 11:08                3882
function.openal-source-create.php                  30-Sep-2022 11:08                3315
function.openal-source-destroy.php                 30-Sep-2022 11:08                3239
function.openal-source-get.php                     30-Sep-2022 11:08                5014
function.openal-source-pause.php                   30-Sep-2022 11:08                3663
function.openal-source-play.php                    30-Sep-2022 11:08                3662
function.openal-source-rewind.php                  30-Sep-2022 11:08                3672
function.openal-source-set.php                     30-Sep-2022 11:08                5694
function.openal-source-stop.php                    30-Sep-2022 11:08                3644
function.openal-stream.php                         30-Sep-2022 11:08                4340
function.opendir.php                               30-Sep-2022 11:09                8844
function.openlog.php                               30-Sep-2022 11:09               10255
function.openssl-cipher-iv-length.php              30-Sep-2022 11:09                4762
function.openssl-cipher-key-length.php             30-Sep-2022 11:09                4326
function.openssl-cms-decrypt.php                   30-Sep-2022 11:09                4905
function.openssl-cms-encrypt.php                   30-Sep-2022 11:09                6156
function.openssl-cms-read.php                      30-Sep-2022 11:09                3269
function.openssl-cms-sign.php                      30-Sep-2022 11:09                7775
function.openssl-cms-verify.php                    30-Sep-2022 11:09                6617
function.openssl-csr-export-to-file.php            30-Sep-2022 11:09                8940
function.openssl-csr-export.php                    30-Sep-2022 11:09                8832
function.openssl-csr-get-public-key.php            30-Sep-2022 11:09                9434
function.openssl-csr-get-subject.php               30-Sep-2022 11:09               10322
function.openssl-csr-new.php                       30-Sep-2022 11:09               23730
function.openssl-csr-sign.php                      30-Sep-2022 11:09               14331
function.openssl-decrypt.php                       30-Sep-2022 11:09                8131
function.openssl-dh-compute-key.php                30-Sep-2022 11:09               18169
function.openssl-digest.php                        30-Sep-2022 11:09                4797
function.openssl-encrypt.php                       30-Sep-2022 11:09               19359
function.openssl-error-string.php                  30-Sep-2022 11:09                4257
function.openssl-free-key.php                      30-Sep-2022 11:09                4094
function.openssl-get-cert-locations.php            30-Sep-2022 11:09                4311
function.openssl-get-cipher-methods.php            30-Sep-2022 11:09               14930
function.openssl-get-curve-names.php               30-Sep-2022 11:09                7591
function.openssl-get-md-methods.php                30-Sep-2022 11:09                7407
function.openssl-get-privatekey.php                30-Sep-2022 11:09                1925
function.openssl-get-publickey.php                 30-Sep-2022 11:09                1896
function.openssl-open.php                          30-Sep-2022 11:09               11063
function.openssl-pbkdf2.php                        30-Sep-2022 11:09                7848
function.openssl-pkcs12-export-to-file.php         30-Sep-2022 11:09                7418
function.openssl-pkcs12-export.php                 30-Sep-2022 11:09                7456
function.openssl-pkcs12-read.php                   30-Sep-2022 11:09                5981
function.openssl-pkcs7-decrypt.php                 30-Sep-2022 11:09                7943
function.openssl-pkcs7-encrypt.php                 30-Sep-2022 11:09               11935
function.openssl-pkcs7-read.php                    30-Sep-2022 11:09                7412
function.openssl-pkcs7-sign.php                    30-Sep-2022 11:09               13062
function.openssl-pkcs7-verify.php                  30-Sep-2022 11:09                8213
function.openssl-pkey-derive.php                   30-Sep-2022 11:09                8466
function.openssl-pkey-export-to-file.php           30-Sep-2022 11:09                6500
function.openssl-pkey-export.php                   30-Sep-2022 11:09                6482
function.openssl-pkey-free.php                     30-Sep-2022 11:09                4475
function.openssl-pkey-get-details.php              30-Sep-2022 11:09               10371
function.openssl-pkey-get-private.php              30-Sep-2022 11:09                6258
function.openssl-pkey-get-public.php               30-Sep-2022 11:09                5807
function.openssl-pkey-new.php                      30-Sep-2022 11:09                7617
function.openssl-private-decrypt.php               30-Sep-2022 11:09                6886
function.openssl-private-encrypt.php               30-Sep-2022 11:09                6568
function.openssl-public-decrypt.php                30-Sep-2022 11:09                6659
function.openssl-public-encrypt.php                30-Sep-2022 11:09                6937
function.openssl-random-pseudo-bytes.php           30-Sep-2022 11:09                9917
function.openssl-seal.php                          30-Sep-2022 11:09               14037
function.openssl-sign.php                          30-Sep-2022 11:09               13348
function.openssl-spki-export-challenge.php         30-Sep-2022 11:09                8364
function.openssl-spki-export.php                   30-Sep-2022 11:09                9074
function.openssl-spki-new.php                      30-Sep-2022 11:09                9947
function.openssl-spki-verify.php                   30-Sep-2022 11:09                8743
function.openssl-verify.php                        30-Sep-2022 11:09               14269
function.openssl-x509-check-private-key.php        30-Sep-2022 11:09                6116
function.openssl-x509-checkpurpose.php             30-Sep-2022 11:09                7880
function.openssl-x509-export-to-file.php           30-Sep-2022 11:09                5170
function.openssl-x509-export.php                   30-Sep-2022 11:09                5180
function.openssl-x509-fingerprint.php              30-Sep-2022 11:09                5519
function.openssl-x509-free.php                     30-Sep-2022 11:09                4416
function.openssl-x509-parse.php                    30-Sep-2022 11:09                5108
function.openssl-x509-read.php                     30-Sep-2022 11:09                4879
function.openssl-x509-verify.php                   30-Sep-2022 11:09               13427
function.ord.php                                   30-Sep-2022 11:09                8198
function.output-add-rewrite-var.php                30-Sep-2022 11:08                9273
function.output-reset-rewrite-vars.php             30-Sep-2022 11:08                7196
function.pack.php                                  30-Sep-2022 11:09               15284
function.parse-ini-file.php                        30-Sep-2022 11:09               24200
function.parse-ini-string.php                      30-Sep-2022 11:09                7664
function.parse-str.php                             30-Sep-2022 11:09               11598
function.parse-url.php                             30-Sep-2022 11:09               17717
function.passthru.php                              30-Sep-2022 11:09                6988
function.password-algos.php                        30-Sep-2022 11:09                3691
function.password-get-info.php                     30-Sep-2022 11:09                3755
function.password-hash.php                         30-Sep-2022 11:09               27213
function.password-needs-rehash.php                 30-Sep-2022 11:09                8700
function.password-verify.php                       30-Sep-2022 11:09                6926
function.pathinfo.php                              30-Sep-2022 11:09               13399
function.pclose.php                                30-Sep-2022 11:09                5401
function.pcntl-alarm.php                           30-Sep-2022 11:09                3172
function.pcntl-async-signals.php                   30-Sep-2022 11:09                4503
function.pcntl-errno.php                           30-Sep-2022 11:09                1788
function.pcntl-exec.php                            30-Sep-2022 11:09                3961
function.pcntl-fork.php                            30-Sep-2022 11:09                6201
function.pcntl-get-last-error.php                  30-Sep-2022 11:09                2980
function.pcntl-getpriority.php                     30-Sep-2022 11:09                6151
function.pcntl-rfork.php                           30-Sep-2022 11:09                9136
function.pcntl-setpriority.php                     30-Sep-2022 11:09                5949
function.pcntl-signal-dispatch.php                 30-Sep-2022 11:09                6529
function.pcntl-signal-get-handler.php              30-Sep-2022 11:09                7142
function.pcntl-signal.php                          30-Sep-2022 11:09               14110
function.pcntl-sigprocmask.php                     30-Sep-2022 11:09                6354
function.pcntl-sigtimedwait.php                    30-Sep-2022 11:09                5390
function.pcntl-sigwaitinfo.php                     30-Sep-2022 11:09                8645
function.pcntl-strerror.php                        30-Sep-2022 11:09                3107
function.pcntl-unshare.php                         30-Sep-2022 11:09                5078
function.pcntl-wait.php                            30-Sep-2022 11:09               10043
function.pcntl-waitpid.php                         30-Sep-2022 11:09               11489
function.pcntl-wexitstatus.php                     30-Sep-2022 11:09                4098
function.pcntl-wifexited.php                       30-Sep-2022 11:09                3869
function.pcntl-wifsignaled.php                     30-Sep-2022 11:09                3803
function.pcntl-wifstopped.php                      30-Sep-2022 11:09                3732
function.pcntl-wstopsig.php                        30-Sep-2022 11:09                3996
function.pcntl-wtermsig.php                        30-Sep-2022 11:09                4286
function.pfsockopen.php                            30-Sep-2022 11:09                5780
function.pg-affected-rows.php                      30-Sep-2022 11:09                7733
function.pg-cancel-query.php                       30-Sep-2022 11:09                8476
function.pg-client-encoding.php                    30-Sep-2022 11:09                7911
function.pg-close.php                              30-Sep-2022 11:09                7537
function.pg-connect-poll.php                       30-Sep-2022 11:09                3930
function.pg-connect.php                            30-Sep-2022 11:09               13257
function.pg-connection-busy.php                    30-Sep-2022 11:09                6457
function.pg-connection-reset.php                   30-Sep-2022 11:09                6440
function.pg-connection-status.php                  30-Sep-2022 11:09                6092
function.pg-consume-input.php                      30-Sep-2022 11:09                3824
function.pg-convert.php                            30-Sep-2022 11:09                9707
function.pg-copy-from.php                          30-Sep-2022 11:09                8771
function.pg-copy-to.php                            30-Sep-2022 11:09                7974
function.pg-dbname.php                             30-Sep-2022 11:09                5758
function.pg-delete.php                             30-Sep-2022 11:09               10639
function.pg-end-copy.php                           30-Sep-2022 11:09                8197
function.pg-escape-bytea.php                       30-Sep-2022 11:09                9517
function.pg-escape-identifier.php                  30-Sep-2022 11:09                9158
function.pg-escape-literal.php                     30-Sep-2022 11:09                9713
function.pg-escape-string.php                      30-Sep-2022 11:09                8957
function.pg-execute.php                            30-Sep-2022 11:09               12227
function.pg-fetch-all-columns.php                  30-Sep-2022 11:09                7717
function.pg-fetch-all.php                          30-Sep-2022 11:09               10085
function.pg-fetch-array.php                        30-Sep-2022 11:09               13956
function.pg-fetch-assoc.php                        30-Sep-2022 11:09               10420
function.pg-fetch-object.php                       30-Sep-2022 11:09               12229
function.pg-fetch-result.php                       30-Sep-2022 11:09                9532
function.pg-fetch-row.php                          30-Sep-2022 11:09               10609
function.pg-field-is-null.php                      30-Sep-2022 11:09                9109
function.pg-field-name.php                         30-Sep-2022 11:09                9924
function.pg-field-num.php                          30-Sep-2022 11:09                7343
function.pg-field-prtlen.php                       30-Sep-2022 11:09               11768
function.pg-field-size.php                         30-Sep-2022 11:09               10283
function.pg-field-table.php                        30-Sep-2022 11:09                9494
function.pg-field-type-oid.php                     30-Sep-2022 11:09                8308
function.pg-field-type.php                         30-Sep-2022 11:09                8011
function.pg-flush.php                              30-Sep-2022 11:09                3875
function.pg-free-result.php                        30-Sep-2022 11:09                8141
function.pg-get-notify.php                         30-Sep-2022 11:09                7911
function.pg-get-pid.php                            30-Sep-2022 11:09                5686
function.pg-get-result.php                         30-Sep-2022 11:09                9694
function.pg-host.php                               30-Sep-2022 11:09                7088
function.pg-insert.php                             30-Sep-2022 11:09               11190
function.pg-last-error.php                         30-Sep-2022 11:09                8490
function.pg-last-notice.php                        30-Sep-2022 11:09                8825
function.pg-last-oid.php                           30-Sep-2022 11:09                8826
function.pg-lo-close.php                           30-Sep-2022 11:09                7806
function.pg-lo-create.php                          30-Sep-2022 11:09                9957
function.pg-lo-export.php                          30-Sep-2022 11:09                8993
function.pg-lo-import.php                          30-Sep-2022 11:09                8534
function.pg-lo-open.php                            30-Sep-2022 11:09               10089
function.pg-lo-read-all.php                        30-Sep-2022 11:09                7128
function.pg-lo-read.php                            30-Sep-2022 11:09                7634
function.pg-lo-seek.php                            30-Sep-2022 11:09                8548
function.pg-lo-tell.php                            30-Sep-2022 11:09                8007
function.pg-lo-truncate.php                        30-Sep-2022 11:09                7163
function.pg-lo-unlink.php                          30-Sep-2022 11:09                7731
function.pg-lo-write.php                           30-Sep-2022 11:09                8956
function.pg-meta-data.php                          30-Sep-2022 11:09                7963
function.pg-num-fields.php                         30-Sep-2022 11:09                6680
function.pg-num-rows.php                           30-Sep-2022 11:09                6635
function.pg-options.php                            30-Sep-2022 11:09                6155
function.pg-parameter-status.php                   30-Sep-2022 11:09                9820
function.pg-pconnect.php                           30-Sep-2022 11:09               11795
function.pg-ping.php                               30-Sep-2022 11:09                6735
function.pg-port.php                               30-Sep-2022 11:09                6406
function.pg-prepare.php                            30-Sep-2022 11:09               12587
function.pg-put-line.php                           30-Sep-2022 11:09                9882
function.pg-query-params.php                       30-Sep-2022 11:09               13530
function.pg-query.php                              30-Sep-2022 11:09               14548
function.pg-result-error-field.php                 30-Sep-2022 11:09                9764
function.pg-result-error.php                       30-Sep-2022 11:09                9194
function.pg-result-seek.php                        30-Sep-2022 11:09                8581
function.pg-result-status.php                      30-Sep-2022 11:09                8787
function.pg-select.php                             30-Sep-2022 11:09               11330
function.pg-send-execute.php                       30-Sep-2022 11:09               12136
function.pg-send-prepare.php                       30-Sep-2022 11:09               12599
function.pg-send-query-params.php                  30-Sep-2022 11:09                9507
function.pg-send-query.php                         30-Sep-2022 11:09               11410
function.pg-set-client-encoding.php                30-Sep-2022 11:09               10149
function.pg-set-error-verbosity.php                30-Sep-2022 11:09                9752
function.pg-socket.php                             30-Sep-2022 11:09                4163
function.pg-trace.php                              30-Sep-2022 11:09                9478
function.pg-transaction-status.php                 30-Sep-2022 11:09                7310
function.pg-tty.php                                30-Sep-2022 11:09                6677
function.pg-unescape-bytea.php                     30-Sep-2022 11:09                7646
function.pg-untrace.php                            30-Sep-2022 11:09                7206
function.pg-update.php                             30-Sep-2022 11:09               11657
function.pg-version.php                            30-Sep-2022 11:09                7538
function.php-ini-loaded-file.php                   30-Sep-2022 11:08                5102
function.php-ini-scanned-files.php                 30-Sep-2022 11:08                7434
function.php-sapi-name.php                         30-Sep-2022 11:08                6682
function.php-strip-whitespace.php                  30-Sep-2022 11:09                5443
function.php-uname.php                             30-Sep-2022 11:08               10730
function.phpcredits.php                            30-Sep-2022 11:08                9015
function.phpdbg-break-file.php                     30-Sep-2022 11:08                4041
function.phpdbg-break-function.php                 30-Sep-2022 11:08                3820
function.phpdbg-break-method.php                   30-Sep-2022 11:08                4094
function.phpdbg-break-next.php                     30-Sep-2022 11:08                3549
function.phpdbg-clear.php                          30-Sep-2022 11:08                4044
function.phpdbg-color.php                          30-Sep-2022 11:08                3852
function.phpdbg-end-oplog.php                      30-Sep-2022 11:08                2618
function.phpdbg-exec.php                           30-Sep-2022 11:08                3151
function.phpdbg-get-executable.php                 30-Sep-2022 11:08                2617
function.phpdbg-prompt.php                         30-Sep-2022 11:08                3060
function.phpdbg-start-oplog.php                    30-Sep-2022 11:08                2502
function.phpinfo.php                               30-Sep-2022 11:08               11231
function.phpversion.php                            30-Sep-2022 11:08               12078
function.pi.php                                    30-Sep-2022 11:09                3235
function.png2wbmp.php                              30-Sep-2022 11:09                7004
function.popen.php                                 30-Sep-2022 11:09                9936
function.pos.php                                   30-Sep-2022 11:09                1668
function.posix-access.php                          30-Sep-2022 11:09                6933
function.posix-ctermid.php                         30-Sep-2022 11:09                5051
function.posix-errno.php                           30-Sep-2022 11:09                1804
function.posix-get-last-error.php                  30-Sep-2022 11:09                4952
function.posix-getcwd.php                          30-Sep-2022 11:09                4918
function.posix-getegid.php                         30-Sep-2022 11:09                6056
function.posix-geteuid.php                         30-Sep-2022 11:09                6126
function.posix-getgid.php                          30-Sep-2022 11:09                5442
function.posix-getgrgid.php                        30-Sep-2022 11:09                7364
function.posix-getgrnam.php                        30-Sep-2022 11:09                7272
function.posix-getgroups.php                       30-Sep-2022 11:09                4444
function.posix-getlogin.php                        30-Sep-2022 11:09                3877
function.posix-getpgid.php                         30-Sep-2022 11:09                5122
function.posix-getpgrp.php                         30-Sep-2022 11:09                2750
function.posix-getpid.php                          30-Sep-2022 11:09                3552
function.posix-getppid.php                         30-Sep-2022 11:09                3167
function.posix-getpwnam.php                        30-Sep-2022 11:09                8162
function.posix-getpwuid.php                        30-Sep-2022 11:09                8175
function.posix-getrlimit.php                       30-Sep-2022 11:09                9326
function.posix-getsid.php                          30-Sep-2022 11:09                5182
function.posix-getuid.php                          30-Sep-2022 11:09                3714
function.posix-initgroups.php                      30-Sep-2022 11:09                3419
function.posix-isatty.php                          30-Sep-2022 11:09                4150
function.posix-kill.php                            30-Sep-2022 11:09                3704
function.posix-mkfifo.php                          30-Sep-2022 11:09                3785
function.posix-mknod.php                           30-Sep-2022 11:09                7639
function.posix-setegid.php                         30-Sep-2022 11:09                5961
function.posix-seteuid.php                         30-Sep-2022 11:09                4064
function.posix-setgid.php                          30-Sep-2022 11:09                6168
function.posix-setpgid.php                         30-Sep-2022 11:09                3597
function.posix-setrlimit.php                       30-Sep-2022 11:09                4913
function.posix-setsid.php                          30-Sep-2022 11:09                2826
function.posix-setuid.php                          30-Sep-2022 11:09                6275
function.posix-strerror.php                        30-Sep-2022 11:09                5455
function.posix-times.php                           30-Sep-2022 11:09                5363
function.posix-ttyname.php                         30-Sep-2022 11:09                3782
function.posix-uname.php                           30-Sep-2022 11:09                5508
function.pow.php                                   30-Sep-2022 11:09                7387
function.preg-filter.php                           30-Sep-2022 11:09               10483
function.preg-grep.php                             30-Sep-2022 11:09                6784
function.preg-last-error-msg.php                   30-Sep-2022 11:09                4514
function.preg-last-error.php                       30-Sep-2022 11:09                5309
function.preg-match-all.php                        30-Sep-2022 11:09               29047
function.preg-match.php                            30-Sep-2022 11:09               26897
function.preg-quote.php                            30-Sep-2022 11:09                9989
function.preg-replace-callback-array.php           30-Sep-2022 11:09               11857
function.preg-replace-callback.php                 30-Sep-2022 11:09               20005
function.preg-replace.php                          30-Sep-2022 11:09               28081
function.preg-split.php                            30-Sep-2022 11:09               14699
function.prev.php                                  30-Sep-2022 11:09                9938
function.print-r.php                               30-Sep-2022 11:09                9984
function.print.php                                 30-Sep-2022 11:09               16300
function.printf.php                                30-Sep-2022 11:09               28567
function.proc-close.php                            30-Sep-2022 11:09                4175
function.proc-get-status.php                       30-Sep-2022 11:09                6775
function.proc-nice.php                             30-Sep-2022 11:09                8767
function.proc-open.php                             30-Sep-2022 11:09               26547
function.proc-terminate.php                        30-Sep-2022 11:09                5595
function.property-exists.php                       30-Sep-2022 11:09                9170
function.ps-add-bookmark.php                       30-Sep-2022 11:09                6012
function.ps-add-launchlink.php                     30-Sep-2022 11:09                6161
function.ps-add-locallink.php                      30-Sep-2022 11:09                7034
function.ps-add-note.php                           30-Sep-2022 11:09                7820
function.ps-add-pdflink.php                        30-Sep-2022 11:09                7371
function.ps-add-weblink.php                        30-Sep-2022 11:09                6284
function.ps-arc.php                                30-Sep-2022 11:09                5426
function.ps-arcn.php                               30-Sep-2022 11:09                5429
function.ps-begin-page.php                         30-Sep-2022 11:09                8536
function.ps-begin-pattern.php                      30-Sep-2022 11:09               13886
function.ps-begin-template.php                     30-Sep-2022 11:09               12022
function.ps-circle.php                             30-Sep-2022 11:09                4985
function.ps-clip.php                               30-Sep-2022 11:09                3282
function.ps-close-image.php                        30-Sep-2022 11:09                4314
function.ps-close.php                              30-Sep-2022 11:09                3988
function.ps-closepath-stroke.php                   30-Sep-2022 11:09                3290
function.ps-closepath.php                          30-Sep-2022 11:09                3527
function.ps-continue-text.php                      30-Sep-2022 11:09                4480
function.ps-curveto.php                            30-Sep-2022 11:09                5221
function.ps-delete.php                             30-Sep-2022 11:09                3945
function.ps-end-page.php                           30-Sep-2022 11:09                3678
function.ps-end-pattern.php                        30-Sep-2022 11:09                3398
function.ps-end-template.php                       30-Sep-2022 11:09                3416
function.ps-fill-stroke.php                        30-Sep-2022 11:09                3536
function.ps-fill.php                               30-Sep-2022 11:09                3457
function.ps-findfont.php                           30-Sep-2022 11:09                8564
function.ps-get-buffer.php                         30-Sep-2022 11:09                3733
function.ps-get-parameter.php                      30-Sep-2022 11:09                9259
function.ps-get-value.php                          30-Sep-2022 11:09               10916
function.ps-hyphenate.php                          30-Sep-2022 11:09                8072
function.ps-include-file.php                       30-Sep-2022 11:09                3268
function.ps-lineto.php                             30-Sep-2022 11:09                8666
function.ps-makespotcolor.php                      30-Sep-2022 11:09               11192
function.ps-moveto.php                             30-Sep-2022 11:09                4185
function.ps-new.php                                30-Sep-2022 11:09                3322
function.ps-open-file.php                          30-Sep-2022 11:09                3844
function.ps-open-image-file.php                    30-Sep-2022 11:09                5286
function.ps-open-image.php                         30-Sep-2022 11:09                7520
function.ps-open-memory-image.php                  30-Sep-2022 11:09                2956
function.ps-place-image.php                        30-Sep-2022 11:09                5634
function.ps-rect.php                               30-Sep-2022 11:09                5281
function.ps-restore.php                            30-Sep-2022 11:09                3711
function.ps-rotate.php                             30-Sep-2022 11:09               13320
function.ps-save.php                               30-Sep-2022 11:09                3428
function.ps-scale.php                              30-Sep-2022 11:09                4044
function.ps-set-border-color.php                   30-Sep-2022 11:09                5205
function.ps-set-border-dash.php                    30-Sep-2022 11:09                4808
function.ps-set-border-style.php                   30-Sep-2022 11:09                4889
function.ps-set-info.php                           30-Sep-2022 11:09                6918
function.ps-set-parameter.php                      30-Sep-2022 11:09                4175
function.ps-set-text-pos.php                       30-Sep-2022 11:09               10000
function.ps-set-value.php                          30-Sep-2022 11:09                5220
function.ps-setcolor.php                           30-Sep-2022 11:09                6670
function.ps-setdash.php                            30-Sep-2022 11:09                3766
function.ps-setflat.php                            30-Sep-2022 11:09                3266
function.ps-setfont.php                            30-Sep-2022 11:09                4341
function.ps-setgray.php                            30-Sep-2022 11:09                3498
function.ps-setlinecap.php                         30-Sep-2022 11:09                4106
function.ps-setlinejoin.php                        30-Sep-2022 11:09                4126
function.ps-setlinewidth.php                       30-Sep-2022 11:09                3984
function.ps-setmiterlimit.php                      30-Sep-2022 11:09                4768
function.ps-setoverprintmode.php                   30-Sep-2022 11:09                3288
function.ps-setpolydash.php                        30-Sep-2022 11:09                8340
function.ps-shading-pattern.php                    30-Sep-2022 11:09                4519
function.ps-shading.php                            30-Sep-2022 11:09                7304
function.ps-shfill.php                             30-Sep-2022 11:09                4292
function.ps-show-boxed.php                         30-Sep-2022 11:09               15481
function.ps-show-xy.php                            30-Sep-2022 11:09                4354
function.ps-show-xy2.php                           30-Sep-2022 11:09                3021
function.ps-show.php                               30-Sep-2022 11:09                6720
function.ps-show2.php                              30-Sep-2022 11:09                3339
function.ps-string-geometry.php                    30-Sep-2022 11:09                5207
function.ps-stringwidth.php                        30-Sep-2022 11:09                4610
function.ps-stroke.php                             30-Sep-2022 11:09                3691
function.ps-symbol-name.php                        30-Sep-2022 11:09                4053
function.ps-symbol-width.php                       30-Sep-2022 11:09                4633
function.ps-symbol.php                             30-Sep-2022 11:09                3882
function.ps-translate.php                          30-Sep-2022 11:09               15559
function.pspell-add-to-personal.php                30-Sep-2022 11:09                6820
function.pspell-add-to-session.php                 30-Sep-2022 11:09                4246
function.pspell-check.php                          30-Sep-2022 11:09                5277
function.pspell-clear-session.php                  30-Sep-2022 11:09                6189
function.pspell-config-create.php                  30-Sep-2022 11:09                9260
function.pspell-config-data-dir.php                30-Sep-2022 11:09                3542
function.pspell-config-dict-dir.php                30-Sep-2022 11:09                3533
function.pspell-config-ignore.php                  30-Sep-2022 11:09                6124
function.pspell-config-mode.php                    30-Sep-2022 11:09                6950
function.pspell-config-personal.php                30-Sep-2022 11:09                7168
function.pspell-config-repl.php                    30-Sep-2022 11:09                7435
function.pspell-config-runtogether.php             30-Sep-2022 11:09                6934
function.pspell-config-save-repl.php               30-Sep-2022 11:09                5702
function.pspell-new-config.php                     30-Sep-2022 11:09                6997
function.pspell-new-personal.php                   30-Sep-2022 11:09               12369
function.pspell-new.php                            30-Sep-2022 11:09               10656
function.pspell-save-wordlist.php                  30-Sep-2022 11:09                6418
function.pspell-store-replacement.php              30-Sep-2022 11:09                8247
function.pspell-suggest.php                        30-Sep-2022 11:09                5998
function.putenv.php                                30-Sep-2022 11:08                4356
function.quoted-printable-decode.php               30-Sep-2022 11:09                5608
function.quoted-printable-encode.php               30-Sep-2022 11:09                5515
function.quotemeta.php                             30-Sep-2022 11:09                6579
function.rad2deg.php                               30-Sep-2022 11:09                3749
function.radius-acct-open.php                      30-Sep-2022 11:08                3541
function.radius-add-server.php                     30-Sep-2022 11:08                8355
function.radius-auth-open.php                      30-Sep-2022 11:08                3559
function.radius-close.php                          30-Sep-2022 11:08                2679
function.radius-config.php                         30-Sep-2022 11:08                4364
function.radius-create-request.php                 30-Sep-2022 11:08                5518
function.radius-cvt-addr.php                       30-Sep-2022 11:08                7118
function.radius-cvt-int.php                        30-Sep-2022 11:08                6453
function.radius-cvt-string.php                     30-Sep-2022 11:08                6463
function.radius-demangle-mppe-key.php              30-Sep-2022 11:08                3374
function.radius-demangle.php                       30-Sep-2022 11:08                3106
function.radius-get-attr.php                       30-Sep-2022 11:08                7407
function.radius-get-tagged-attr-data.php           30-Sep-2022 11:08                7192
function.radius-get-tagged-attr-tag.php            30-Sep-2022 11:08                7243
function.radius-get-vendor-attr.php                30-Sep-2022 11:08                9282
function.radius-put-addr.php                       30-Sep-2022 11:08                5419
function.radius-put-attr.php                       30-Sep-2022 11:08                9111
function.radius-put-int.php                        30-Sep-2022 11:08                7769
function.radius-put-string.php                     30-Sep-2022 11:08                8383
function.radius-put-vendor-addr.php                30-Sep-2022 11:08                5486
function.radius-put-vendor-attr.php                30-Sep-2022 11:08                7970
function.radius-put-vendor-int.php                 30-Sep-2022 11:08                6294
function.radius-put-vendor-string.php              30-Sep-2022 11:08                7020
function.radius-request-authenticator.php          30-Sep-2022 11:08                3314
function.radius-salt-encrypt-attr.php              30-Sep-2022 11:08                4572
function.radius-send-request.php                   30-Sep-2022 11:08                4001
function.radius-server-secret.php                  30-Sep-2022 11:08                2751
function.radius-strerror.php                       30-Sep-2022 11:08                2799
function.rand.php                                  30-Sep-2022 11:09               11721
function.random-bytes.php                          30-Sep-2022 11:09                9094
function.random-int.php                            30-Sep-2022 11:09                9339
function.range.php                                 30-Sep-2022 11:09                8931
function.rar-wrapper-cache-stats.php               30-Sep-2022 11:09                2466
function.rawurldecode.php                          30-Sep-2022 11:09                5093
function.rawurlencode.php                          30-Sep-2022 11:09                7032
function.read-exif-data.php                        30-Sep-2022 11:09                2614
function.readdir.php                               30-Sep-2022 11:09               12368
function.readfile.php                              30-Sep-2022 11:09               11016
function.readgzfile.php                            30-Sep-2022 11:09                4993
function.readline-add-history.php                  30-Sep-2022 11:08                2785
function.readline-callback-handler-install.php     30-Sep-2022 11:08               11130
function.readline-callback-handler-remove.php      30-Sep-2022 11:08                4238
function.readline-callback-read-char.php           30-Sep-2022 11:08                4391
function.readline-clear-history.php                30-Sep-2022 11:08                2539
function.readline-completion-function.php          30-Sep-2022 11:08                3225
function.readline-info.php                         30-Sep-2022 11:08                5113
function.readline-list-history.php                 30-Sep-2022 11:08                2395
function.readline-on-new-line.php                  30-Sep-2022 11:08                2974
function.readline-read-history.php                 30-Sep-2022 11:08                3426
function.readline-redisplay.php                    30-Sep-2022 11:08                2354
function.readline-write-history.php                30-Sep-2022 11:08                3406
function.readline.php                              30-Sep-2022 11:08                5556
function.readlink.php                              30-Sep-2022 11:09                5005
function.realpath-cache-get.php                    30-Sep-2022 11:09                4547
function.realpath-cache-size.php                   30-Sep-2022 11:09                3977
function.realpath.php                              30-Sep-2022 11:09                9971
function.recode-file.php                           30-Sep-2022 11:09                6067
function.recode-string.php                         30-Sep-2022 11:09                5545
function.recode.php                                30-Sep-2022 11:09                1769
function.register-shutdown-function.php            30-Sep-2022 11:09               10221
function.register-tick-function.php                30-Sep-2022 11:09                5969
function.rename.php                                30-Sep-2022 11:09                6247
function.require-once.php                          30-Sep-2022 11:08                1967
function.require.php                               30-Sep-2022 11:08                2179
function.reset.php                                 30-Sep-2022 11:09               10482
function.restore-error-handler.php                 30-Sep-2022 11:08                6532
function.restore-exception-handler.php             30-Sep-2022 11:08                7489
function.restore-include-path.php                  30-Sep-2022 11:08                5944
function.return.php                                30-Sep-2022 11:08                5558
function.rewind.php                                30-Sep-2022 11:09                7013
function.rewinddir.php                             30-Sep-2022 11:09                3868
function.rmdir.php                                 30-Sep-2022 11:09                5314
function.round.php                                 30-Sep-2022 11:09               25778
function.rpmaddtag.php                             30-Sep-2022 11:09                3515
function.rpmdbinfo.php                             30-Sep-2022 11:09                5175
function.rpmdbsearch.php                           30-Sep-2022 11:09                6073
function.rpminfo.php                               30-Sep-2022 11:09                5440
function.rpmvercmp.php                             30-Sep-2022 11:09                2743
function.rrd-create.php                            30-Sep-2022 11:09                2861
function.rrd-error.php                             30-Sep-2022 11:09                2197
function.rrd-fetch.php                             30-Sep-2022 11:09                2984
function.rrd-first.php                             30-Sep-2022 11:09                2978
function.rrd-graph.php                             30-Sep-2022 11:09                3443
function.rrd-info.php                              30-Sep-2022 11:09                2537
function.rrd-last.php                              30-Sep-2022 11:09                2572
function.rrd-lastupdate.php                        30-Sep-2022 11:09                2743
function.rrd-restore.php                           30-Sep-2022 11:09                3320
function.rrd-tune.php                              30-Sep-2022 11:09                3165
function.rrd-update.php                            30-Sep-2022 11:09                3263
function.rrd-version.php                           30-Sep-2022 11:09                2270
function.rrd-xport.php                             30-Sep-2022 11:09                2869
function.rrdc-disconnect.php                       30-Sep-2022 11:09                2944
function.rsort.php                                 30-Sep-2022 11:09                9280
function.rtrim.php                                 30-Sep-2022 11:09               10382
function.runkit7-constant-add.php                  30-Sep-2022 11:08                4699
function.runkit7-constant-redefine.php             30-Sep-2022 11:08                4591
function.runkit7-constant-remove.php               30-Sep-2022 11:08                3821
function.runkit7-function-add.php                  30-Sep-2022 11:08                9601
function.runkit7-function-copy.php                 30-Sep-2022 11:08                5725
function.runkit7-function-redefine.php             30-Sep-2022 11:08               10167
function.runkit7-function-remove.php               30-Sep-2022 11:08                4352
function.runkit7-function-rename.php               30-Sep-2022 11:08                4591
function.runkit7-import.php                        30-Sep-2022 11:08                4062
function.runkit7-method-add.php                    30-Sep-2022 11:08               11644
function.runkit7-method-copy.php                   30-Sep-2022 11:08                7642
function.runkit7-method-redefine.php               30-Sep-2022 11:08               12211
function.runkit7-method-remove.php                 30-Sep-2022 11:08                7033
function.runkit7-method-rename.php                 30-Sep-2022 11:08                7151
function.runkit7-object-id.php                     30-Sep-2022 11:08                4331
function.runkit7-superglobals.php                  30-Sep-2022 11:08                2891
function.runkit7-zval-inspect.php                  30-Sep-2022 11:08                5431
function.sapi-windows-cp-conv.php                  30-Sep-2022 11:09                4936
function.sapi-windows-cp-get.php                   30-Sep-2022 11:09                3877
function.sapi-windows-cp-is-utf8.php               30-Sep-2022 11:09                2926
function.sapi-windows-cp-set.php                   30-Sep-2022 11:09                3176
function.sapi-windows-generate-ctrl-event.php      30-Sep-2022 11:09                8336
function.sapi-windows-set-ctrl-handler.php         30-Sep-2022 11:09                8169
function.sapi-windows-vt100-support.php            30-Sep-2022 11:09               11880
function.scandir.php                               30-Sep-2022 11:09                9851
function.scoutapm-get-calls.php                    30-Sep-2022 11:09                4756
function.scoutapm-list-instrumented-functions.php  30-Sep-2022 11:09                4057
function.seaslog-get-author.php                    30-Sep-2022 11:09                3240
function.seaslog-get-version.php                   30-Sep-2022 11:09                3231
function.sem-acquire.php                           30-Sep-2022 11:09                5386
function.sem-get.php                               30-Sep-2022 11:09                7924
function.sem-release.php                           30-Sep-2022 11:09                4567
function.sem-remove.php                            30-Sep-2022 11:09                4463
function.serialize.php                             30-Sep-2022 11:09               13507
function.session-abort.php                         30-Sep-2022 11:09                4537
function.session-cache-expire.php                  30-Sep-2022 11:09                8355
function.session-cache-limiter.php                 30-Sep-2022 11:09               10312
function.session-commit.php                        30-Sep-2022 11:09                1871
function.session-create-id.php                     30-Sep-2022 11:09               13291
function.session-decode.php                        30-Sep-2022 11:09                4229
function.session-destroy.php                       30-Sep-2022 11:09               11847
function.session-encode.php                        30-Sep-2022 11:09                4440
function.session-gc.php                            30-Sep-2022 11:09               10091
function.session-get-cookie-params.php             30-Sep-2022 11:09                5986
function.session-id.php                            30-Sep-2022 11:09                7062
function.session-module-name.php                   30-Sep-2022 11:09                4671
function.session-name.php                          30-Sep-2022 11:09                8784
function.session-regenerate-id.php                 30-Sep-2022 11:09               21549
function.session-register-shutdown.php             30-Sep-2022 11:09                2975
function.session-reset.php                         30-Sep-2022 11:09                4724
function.session-save-path.php                     30-Sep-2022 11:09                5141
function.session-set-cookie-params.php             30-Sep-2022 11:09               11432
function.session-set-save-handler.php              30-Sep-2022 11:09               27192
function.session-start.php                         30-Sep-2022 11:09               17281
function.session-status.php                        30-Sep-2022 11:09                3385
function.session-unset.php                         30-Sep-2022 11:09                4914
function.session-write-close.php                   30-Sep-2022 11:09                4740
function.set-error-handler.php                     30-Sep-2022 11:08               32270
function.set-exception-handler.php                 30-Sep-2022 11:08                7780
function.set-file-buffer.php                       30-Sep-2022 11:09                1825
function.set-include-path.php                      30-Sep-2022 11:08                6847
function.set-time-limit.php                        30-Sep-2022 11:08                5367
function.setcookie.php                             30-Sep-2022 11:09               31834
function.setlocale.php                             30-Sep-2022 11:09               17895
function.setrawcookie.php                          30-Sep-2022 11:09                6026
function.settype.php                               30-Sep-2022 11:09                6832
function.sha1-file.php                             30-Sep-2022 11:09                6006
function.sha1.php                                  30-Sep-2022 11:09                6513
function.shell-exec.php                            30-Sep-2022 11:09                6310
function.shm-attach.php                            30-Sep-2022 11:09                6625
function.shm-detach.php                            30-Sep-2022 11:09                4893
function.shm-get-var.php                           30-Sep-2022 11:09                4764
function.shm-has-var.php                           30-Sep-2022 11:09                4586
function.shm-put-var.php                           30-Sep-2022 11:09                5935
function.shm-remove-var.php                        30-Sep-2022 11:09                4394
function.shm-remove.php                            30-Sep-2022 11:09                4154
function.shmop-close.php                           30-Sep-2022 11:09                5506
function.shmop-delete.php                          30-Sep-2022 11:09                4514
function.shmop-open.php                            30-Sep-2022 11:09               10554
function.shmop-read.php                            30-Sep-2022 11:09                5967
function.shmop-size.php                            30-Sep-2022 11:09                4713
function.shmop-write.php                           30-Sep-2022 11:09                6176
function.show-source.php                           30-Sep-2022 11:09                1768
function.shuffle.php                               30-Sep-2022 11:09                6477
function.similar-text.php                          30-Sep-2022 11:09                8271
function.simplexml-import-dom.php                  30-Sep-2022 11:09                6994
function.simplexml-load-file.php                   30-Sep-2022 11:09               11252
function.simplexml-load-string.php                 30-Sep-2022 11:09               10737
function.sin.php                                   30-Sep-2022 11:09                4924
function.sinh.php                                  30-Sep-2022 11:09                3370
function.sizeof.php                                30-Sep-2022 11:09                1688
function.sleep.php                                 30-Sep-2022 11:09                8263
function.snmp-get-quick-print.php                  30-Sep-2022 11:09                3901
function.snmp-get-valueretrieval.php               30-Sep-2022 11:09                4621
function.snmp-read-mib.php                         30-Sep-2022 11:09                5293
function.snmp-set-enum-print.php                   30-Sep-2022 11:09                5105
function.snmp-set-oid-numeric-print.php            30-Sep-2022 11:09                2400
function.snmp-set-oid-output-format.php            30-Sep-2022 11:09                6929
function.snmp-set-quick-print.php                  30-Sep-2022 11:09                7380
function.snmp-set-valueretrieval.php               30-Sep-2022 11:09                9713
function.snmp2-get.php                             30-Sep-2022 11:09                5873
function.snmp2-getnext.php                         30-Sep-2022 11:09                6464
function.snmp2-real-walk.php                       30-Sep-2022 11:09                6747
function.snmp2-set.php                             30-Sep-2022 11:09               11872
function.snmp2-walk.php                            30-Sep-2022 11:09                7201
function.snmp3-get.php                             30-Sep-2022 11:09                9005
function.snmp3-getnext.php                         30-Sep-2022 11:09                9459
function.snmp3-real-walk.php                       30-Sep-2022 11:09                9959
function.snmp3-set.php                             30-Sep-2022 11:09               14696
function.snmp3-walk.php                            30-Sep-2022 11:09               10508
function.snmpget.php                               30-Sep-2022 11:09                5872
function.snmpgetnext.php                           30-Sep-2022 11:09                6332
function.snmprealwalk.php                          30-Sep-2022 11:09                6758
function.snmpset.php                               30-Sep-2022 11:09               11920
function.snmpwalk.php                              30-Sep-2022 11:09                7235
function.snmpwalkoid.php                           30-Sep-2022 11:09                8177
function.socket-accept.php                         30-Sep-2022 11:09                8153
function.socket-addrinfo-bind.php                  30-Sep-2022 11:09                5924
function.socket-addrinfo-connect.php               30-Sep-2022 11:09                5706
function.socket-addrinfo-explain.php               30-Sep-2022 11:09                4781
function.socket-addrinfo-lookup.php                30-Sep-2022 11:09                6362
function.socket-bind.php                           30-Sep-2022 11:09               12457
function.socket-clear-error.php                    30-Sep-2022 11:09                5146
function.socket-close.php                          30-Sep-2022 11:09                5035
function.socket-cmsg-space.php                     30-Sep-2022 11:09                3844
function.socket-connect.php                        30-Sep-2022 11:09                8328
function.socket-create-listen.php                  30-Sep-2022 11:09                8240
function.socket-create-pair.php                    30-Sep-2022 11:09               22671
function.socket-create.php                         30-Sep-2022 11:09               15793
function.socket-export-stream.php                  30-Sep-2022 11:09                3652
function.socket-get-option.php                     30-Sep-2022 11:09               29710
function.socket-get-status.php                     30-Sep-2022 11:09                1844
function.socket-getopt.php                         30-Sep-2022 11:09                1823
function.socket-getpeername.php                    30-Sep-2022 11:09                9131
function.socket-getsockname.php                    30-Sep-2022 11:09                8307
function.socket-import-stream.php                  30-Sep-2022 11:09                5395
function.socket-last-error.php                     30-Sep-2022 11:09                8058
function.socket-listen.php                         30-Sep-2022 11:09                8316
function.socket-read.php                           30-Sep-2022 11:09                8814
function.socket-recv.php                           30-Sep-2022 11:09               18844
function.socket-recvfrom.php                       30-Sep-2022 11:09               15301
function.socket-recvmsg.php                        30-Sep-2022 11:09                4537
function.socket-select.php                         30-Sep-2022 11:09               18528
function.socket-send.php                           30-Sep-2022 11:09                7314
function.socket-sendmsg.php                        30-Sep-2022 11:09                4701
function.socket-sendto.php                         30-Sep-2022 11:09               10670
function.socket-set-block.php                      30-Sep-2022 11:09                6823
function.socket-set-blocking.php                   30-Sep-2022 11:09                1862
function.socket-set-nonblock.php                   30-Sep-2022 11:09                7425
function.socket-set-option.php                     30-Sep-2022 11:09               12488
function.socket-set-timeout.php                    30-Sep-2022 11:09                1831
function.socket-setopt.php                         30-Sep-2022 11:09                1817
function.socket-shutdown.php                       30-Sep-2022 11:09                5371
function.socket-strerror.php                       30-Sep-2022 11:09                8127
function.socket-write.php                          30-Sep-2022 11:09                8254
function.socket-wsaprotocol-info-export.php        30-Sep-2022 11:09                5488
function.socket-wsaprotocol-info-import.php        30-Sep-2022 11:09                4663
function.socket-wsaprotocol-info-release.php       30-Sep-2022 11:09                3730
function.sodium-add.php                            30-Sep-2022 11:09                3575
function.sodium-base642bin.php                     30-Sep-2022 11:09                4976
function.sodium-bin2base64.php                     30-Sep-2022 11:09                4485
function.sodium-bin2hex.php                        30-Sep-2022 11:09                3063
function.sodium-compare.php                        30-Sep-2022 11:09                3325
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-Sep-2022 11:09                4912
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-Sep-2022 11:09                4733
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-Sep-2022 11:09                2941
function.sodium-crypto-aead-aes256gcm-keygen.php   30-Sep-2022 11:09                2906
function.sodium-crypto-aead-chacha20poly1305-de..> 30-Sep-2022 11:09                4771
function.sodium-crypto-aead-chacha20poly1305-en..> 30-Sep-2022 11:09                4538
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:09                5148
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:09                4807
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:09                3413
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-Sep-2022 11:09                3034
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:09                5335
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:09                5077
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:09                3074
function.sodium-crypto-auth-keygen.php             30-Sep-2022 11:09                2718
function.sodium-crypto-auth-verify.php             30-Sep-2022 11:09                4036
function.sodium-crypto-auth.php                    30-Sep-2022 11:09                3620
function.sodium-crypto-box-keypair-from-secretk..> 30-Sep-2022 11:09                3523
function.sodium-crypto-box-keypair.php             30-Sep-2022 11:09                3291
function.sodium-crypto-box-open.php                30-Sep-2022 11:09                4273
function.sodium-crypto-box-publickey-from-secre..> 30-Sep-2022 11:09                3547
function.sodium-crypto-box-publickey.php           30-Sep-2022 11:09                3008
function.sodium-crypto-box-seal-open.php           30-Sep-2022 11:09                6486
function.sodium-crypto-box-seal.php                30-Sep-2022 11:09                8177
function.sodium-crypto-box-secretkey.php           30-Sep-2022 11:09                2991
function.sodium-crypto-box-seed-keypair.php        30-Sep-2022 11:09                3288
function.sodium-crypto-box.php                     30-Sep-2022 11:09                4775
function.sodium-crypto-core-ristretto255-add.php   30-Sep-2022 11:09                6366
function.sodium-crypto-core-ristretto255-from-h..> 30-Sep-2022 11:09                5951
function.sodium-crypto-core-ristretto255-is-val..> 30-Sep-2022 11:09                6037
function.sodium-crypto-core-ristretto255-random..> 30-Sep-2022 11:09                6000
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:09                6710
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:09                3774
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:09                5781
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:09                4055
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:09                5753
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:09                6193
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:09                3773
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:09                6717
function.sodium-crypto-core-ristretto255-sub.php   30-Sep-2022 11:09                6391
function.sodium-crypto-generichash-final.php       30-Sep-2022 11:09                7008
function.sodium-crypto-generichash-init.php        30-Sep-2022 11:09                7031
function.sodium-crypto-generichash-keygen.php      30-Sep-2022 11:09                2527
function.sodium-crypto-generichash-update.php      30-Sep-2022 11:09                6885
function.sodium-crypto-generichash.php             30-Sep-2022 11:09                3821
function.sodium-crypto-kdf-derive-from-key.php     30-Sep-2022 11:09                4012
function.sodium-crypto-kdf-keygen.php              30-Sep-2022 11:09                2696
function.sodium-crypto-kx-client-session-keys.php  30-Sep-2022 11:09                3503
function.sodium-crypto-kx-keypair.php              30-Sep-2022 11:09                5575
function.sodium-crypto-kx-publickey.php            30-Sep-2022 11:09                2810
function.sodium-crypto-kx-secretkey.php            30-Sep-2022 11:09                2826
function.sodium-crypto-kx-seed-keypair.php         30-Sep-2022 11:09                2772
function.sodium-crypto-kx-server-session-keys.php  30-Sep-2022 11:09                3574
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:09                3377
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:09                3491
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:09                6703
function.sodium-crypto-pwhash-str-needs-rehash.php 30-Sep-2022 11:09                4013
function.sodium-crypto-pwhash-str-verify.php       30-Sep-2022 11:09                5084
function.sodium-crypto-pwhash-str.php              30-Sep-2022 11:09                9465
function.sodium-crypto-pwhash.php                  30-Sep-2022 11:09               11513
function.sodium-crypto-scalarmult-base.php         30-Sep-2022 11:09                2065
function.sodium-crypto-scalarmult-ristretto255-..> 30-Sep-2022 11:09                3756
function.sodium-crypto-scalarmult-ristretto255.php 30-Sep-2022 11:09                4119
function.sodium-crypto-scalarmult.php              30-Sep-2022 11:09                3262
function.sodium-crypto-secretbox-keygen.php        30-Sep-2022 11:09                6768
function.sodium-crypto-secretbox-open.php          30-Sep-2022 11:09                9572
function.sodium-crypto-secretbox.php               30-Sep-2022 11:09                9464
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:09               12155
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:09               11271
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:09                2774
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:09                6593
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:09                6597
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:09                3073
function.sodium-crypto-shorthash-keygen.php        30-Sep-2022 11:09                2887
function.sodium-crypto-shorthash.php               30-Sep-2022 11:09                3339
function.sodium-crypto-sign-detached.php           30-Sep-2022 11:09                3280
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-Sep-2022 11:09                3057
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-Sep-2022 11:09                3125
function.sodium-crypto-sign-keypair-from-secret..> 30-Sep-2022 11:09                3250
function.sodium-crypto-sign-keypair.php            30-Sep-2022 11:09                2569
function.sodium-crypto-sign-open.php               30-Sep-2022 11:09                3416
function.sodium-crypto-sign-publickey-from-secr..> 30-Sep-2022 11:09                2831
function.sodium-crypto-sign-publickey.php          30-Sep-2022 11:09                2844
function.sodium-crypto-sign-secretkey.php          30-Sep-2022 11:09                2826
function.sodium-crypto-sign-seed-keypair.php       30-Sep-2022 11:09                3321
function.sodium-crypto-sign-verify-detached.php    30-Sep-2022 11:09                3575
function.sodium-crypto-sign.php                    30-Sep-2022 11:09                3417
function.sodium-crypto-stream-keygen.php           30-Sep-2022 11:09                2689
function.sodium-crypto-stream-xchacha20-keygen.php 30-Sep-2022 11:09                2978
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-Sep-2022 11:09                9745
function.sodium-crypto-stream-xchacha20-xor.php    30-Sep-2022 11:09                5115
function.sodium-crypto-stream-xchacha20.php        30-Sep-2022 11:09                3873
function.sodium-crypto-stream-xor.php              30-Sep-2022 11:09                3668
function.sodium-crypto-stream.php                  30-Sep-2022 11:09                3670
function.sodium-hex2bin.php                        30-Sep-2022 11:09                3603
function.sodium-increment.php                      30-Sep-2022 11:09                2710
function.sodium-memcmp.php                         30-Sep-2022 11:09                3797
function.sodium-memzero.php                        30-Sep-2022 11:09                2573
function.sodium-pad.php                            30-Sep-2022 11:09                2814
function.sodium-unpad.php                          30-Sep-2022 11:09                2758
function.solr-get-version.php                      30-Sep-2022 11:09                4227
function.sort.php                                  30-Sep-2022 11:09               13184
function.soundex.php                               30-Sep-2022 11:09                8288
function.spl-autoload-call.php                     30-Sep-2022 11:09                2838
function.spl-autoload-extensions.php               30-Sep-2022 11:09                5576
function.spl-autoload-functions.php                30-Sep-2022 11:09                2772
function.spl-autoload-register.php                 30-Sep-2022 11:09               11820
function.spl-autoload-unregister.php               30-Sep-2022 11:09                3435
function.spl-autoload.php                          30-Sep-2022 11:09                4890
function.spl-classes.php                           30-Sep-2022 11:09                3965
function.spl-object-hash.php                       30-Sep-2022 11:09                5327
function.spl-object-id.php                         30-Sep-2022 11:09                4709
function.sprintf.php                               30-Sep-2022 11:09               30047
function.sqlsrv-begin-transaction.php              30-Sep-2022 11:09               12994
function.sqlsrv-cancel.php                         30-Sep-2022 11:09               11554
function.sqlsrv-client-info.php                    30-Sep-2022 11:09                7354
function.sqlsrv-close.php                          30-Sep-2022 11:09                6027
function.sqlsrv-commit.php                         30-Sep-2022 11:09               12866
function.sqlsrv-configure.php                      30-Sep-2022 11:09                5102
function.sqlsrv-connect.php                        30-Sep-2022 11:09               14599
function.sqlsrv-errors.php                         30-Sep-2022 11:09               12392
function.sqlsrv-execute.php                        30-Sep-2022 11:09               12052
function.sqlsrv-fetch-array.php                    30-Sep-2022 11:09               16882
function.sqlsrv-fetch-object.php                   30-Sep-2022 11:09               14823
function.sqlsrv-fetch.php                          30-Sep-2022 11:09               12461
function.sqlsrv-field-metadata.php                 30-Sep-2022 11:09               10002
function.sqlsrv-free-stmt.php                      30-Sep-2022 11:09                8731
function.sqlsrv-get-config.php                     30-Sep-2022 11:09                3639
function.sqlsrv-get-field.php                      30-Sep-2022 11:09               11909
function.sqlsrv-has-rows.php                       30-Sep-2022 11:09                6819
function.sqlsrv-next-result.php                    30-Sep-2022 11:09               10614
function.sqlsrv-num-fields.php                     30-Sep-2022 11:09                9146
function.sqlsrv-num-rows.php                       30-Sep-2022 11:09                9121
function.sqlsrv-prepare.php                        30-Sep-2022 11:09               17397
function.sqlsrv-query.php                          30-Sep-2022 11:09               13360
function.sqlsrv-rollback.php                       30-Sep-2022 11:09               12008
function.sqlsrv-rows-affected.php                  30-Sep-2022 11:09                8941
function.sqlsrv-send-stream-data.php               30-Sep-2022 11:09                9595
function.sqlsrv-server-info.php                    30-Sep-2022 11:09                6666
function.sqrt.php                                  30-Sep-2022 11:09                4642
function.srand.php                                 30-Sep-2022 11:09                7472
function.sscanf.php                                30-Sep-2022 11:09               13720
function.ssdeep-fuzzy-compare.php                  30-Sep-2022 11:09                3451
function.ssdeep-fuzzy-hash-filename.php            30-Sep-2022 11:09                3096
function.ssdeep-fuzzy-hash.php                     30-Sep-2022 11:09                2935
function.ssh2-auth-agent.php                       30-Sep-2022 11:09                4971
function.ssh2-auth-hostbased-file.php              30-Sep-2022 11:09                8318
function.ssh2-auth-none.php                        30-Sep-2022 11:09                5264
function.ssh2-auth-password.php                    30-Sep-2022 11:09                5253
function.ssh2-auth-pubkey-file.php                 30-Sep-2022 11:09                7988
function.ssh2-connect.php                          30-Sep-2022 11:09               18271
function.ssh2-disconnect.php                       30-Sep-2022 11:09                3195
function.ssh2-exec.php                             30-Sep-2022 11:09                7698
function.ssh2-fetch-stream.php                     30-Sep-2022 11:09                5815
function.ssh2-fingerprint.php                      30-Sep-2022 11:09                5626
function.ssh2-forward-accept.php                   30-Sep-2022 11:09                3209
function.ssh2-forward-listen.php                   30-Sep-2022 11:09                4597
function.ssh2-methods-negotiated.php               30-Sep-2022 11:09                8499
function.ssh2-poll.php                             30-Sep-2022 11:09                4134
function.ssh2-publickey-add.php                    30-Sep-2022 11:09                9083
function.ssh2-publickey-init.php                   30-Sep-2022 11:09                5315
function.ssh2-publickey-list.php                   30-Sep-2022 11:09                9990
function.ssh2-publickey-remove.php                 30-Sep-2022 11:09                5093
function.ssh2-scp-recv.php                         30-Sep-2022 11:09                5536
function.ssh2-scp-send.php                         30-Sep-2022 11:09                6176
function.ssh2-send-eof.php                         30-Sep-2022 11:09                3797
function.ssh2-sftp-chmod.php                       30-Sep-2022 11:09                6221
function.ssh2-sftp-lstat.php                       30-Sep-2022 11:09                7739
function.ssh2-sftp-mkdir.php                       30-Sep-2022 11:09                6912
function.ssh2-sftp-readlink.php                    30-Sep-2022 11:09                5699
function.ssh2-sftp-realpath.php                    30-Sep-2022 11:09                5904
function.ssh2-sftp-rename.php                      30-Sep-2022 11:09                5587
function.ssh2-sftp-rmdir.php                       30-Sep-2022 11:09                5667
function.ssh2-sftp-stat.php                        30-Sep-2022 11:09                7533
function.ssh2-sftp-symlink.php                     30-Sep-2022 11:09                5939
function.ssh2-sftp-unlink.php                      30-Sep-2022 11:09                5063
function.ssh2-sftp.php                             30-Sep-2022 11:09                5704
function.ssh2-shell.php                            30-Sep-2022 11:09                8241
function.ssh2-tunnel.php                           30-Sep-2022 11:09                5527
function.stat.php                                  30-Sep-2022 11:09               20329
function.stats-absolute-deviation.php              30-Sep-2022 11:09                2874
function.stats-cdf-beta.php                        30-Sep-2022 11:09                5527
function.stats-cdf-binomial.php                    30-Sep-2022 11:09                5565
function.stats-cdf-cauchy.php                      30-Sep-2022 11:09                5467
function.stats-cdf-chisquare.php                   30-Sep-2022 11:09                4827
function.stats-cdf-exponential.php                 30-Sep-2022 11:09                4947
function.stats-cdf-f.php                           30-Sep-2022 11:09                5385
function.stats-cdf-gamma.php                       30-Sep-2022 11:09                5439
function.stats-cdf-laplace.php                     30-Sep-2022 11:09                5452
function.stats-cdf-logistic.php                    30-Sep-2022 11:09                5512
function.stats-cdf-negative-binomial.php           30-Sep-2022 11:09                5758
function.stats-cdf-noncentral-chisquare.php        30-Sep-2022 11:09                5732
function.stats-cdf-noncentral-f.php                30-Sep-2022 11:09                6276
function.stats-cdf-noncentral-t.php                30-Sep-2022 11:09                5693
function.stats-cdf-normal.php                      30-Sep-2022 11:09                5534
function.stats-cdf-poisson.php                     30-Sep-2022 11:09                4834
function.stats-cdf-t.php                           30-Sep-2022 11:09                4770
function.stats-cdf-uniform.php                     30-Sep-2022 11:09                5482
function.stats-cdf-weibull.php                     30-Sep-2022 11:09                5487
function.stats-covariance.php                      30-Sep-2022 11:09                2969
function.stats-dens-beta.php                       30-Sep-2022 11:09                3505
function.stats-dens-cauchy.php                     30-Sep-2022 11:09                3556
function.stats-dens-chisquare.php                  30-Sep-2022 11:09                3176
function.stats-dens-exponential.php                30-Sep-2022 11:09                3250
function.stats-dens-f.php                          30-Sep-2022 11:09                3389
function.stats-dens-gamma.php                      30-Sep-2022 11:09                3532
function.stats-dens-laplace.php                    30-Sep-2022 11:09                3523
function.stats-dens-logistic.php                   30-Sep-2022 11:09                3573
function.stats-dens-normal.php                     30-Sep-2022 11:09                3675
function.stats-dens-pmf-binomial.php               30-Sep-2022 11:09                3610
function.stats-dens-pmf-hypergeometric.php         30-Sep-2022 11:09                4226
function.stats-dens-pmf-negative-binomial.php      30-Sep-2022 11:09                3720
function.stats-dens-pmf-poisson.php                30-Sep-2022 11:09                3254
function.stats-dens-t.php                          30-Sep-2022 11:09                3122
function.stats-dens-uniform.php                    30-Sep-2022 11:09                3520
function.stats-dens-weibull.php                    30-Sep-2022 11:09                3544
function.stats-harmonic-mean.php                   30-Sep-2022 11:09                2885
function.stats-kurtosis.php                        30-Sep-2022 11:09                2743
function.stats-rand-gen-beta.php                   30-Sep-2022 11:09                3035
function.stats-rand-gen-chisquare.php              30-Sep-2022 11:09                2822
function.stats-rand-gen-exponential.php            30-Sep-2022 11:09                2856
function.stats-rand-gen-f.php                      30-Sep-2022 11:09                3224
function.stats-rand-gen-funiform.php               30-Sep-2022 11:09                3191
function.stats-rand-gen-gamma.php                  30-Sep-2022 11:09                3201
function.stats-rand-gen-ibinomial-negative.php     30-Sep-2022 11:09                3424
function.stats-rand-gen-ibinomial.php              30-Sep-2022 11:09                3236
function.stats-rand-gen-int.php                    30-Sep-2022 11:09                2389
function.stats-rand-gen-ipoisson.php               30-Sep-2022 11:09                2759
function.stats-rand-gen-iuniform.php               30-Sep-2022 11:09                3167
function.stats-rand-gen-noncentral-chisquare.php   30-Sep-2022 11:09                3317
function.stats-rand-gen-noncentral-f.php           30-Sep-2022 11:09                3680
function.stats-rand-gen-noncentral-t.php           30-Sep-2022 11:09                3290
function.stats-rand-gen-normal.php                 30-Sep-2022 11:09                3208
function.stats-rand-gen-t.php                      30-Sep-2022 11:09                2658
function.stats-rand-get-seeds.php                  30-Sep-2022 11:09                2467
function.stats-rand-phrase-to-seeds.php            30-Sep-2022 11:09                2784
function.stats-rand-ranf.php                       30-Sep-2022 11:09                2481
function.stats-rand-setall.php                     30-Sep-2022 11:09                3268
function.stats-skew.php                            30-Sep-2022 11:09                2687
function.stats-standard-deviation.php              30-Sep-2022 11:09                3943
function.stats-stat-binomial-coef.php              30-Sep-2022 11:09                3051
function.stats-stat-correlation.php                30-Sep-2022 11:09                3211
function.stats-stat-factorial.php                  30-Sep-2022 11:09                2542
function.stats-stat-independent-t.php              30-Sep-2022 11:09                3557
function.stats-stat-innerproduct.php               30-Sep-2022 11:09                3174
function.stats-stat-paired-t.php                   30-Sep-2022 11:09                3166
function.stats-stat-percentile.php                 30-Sep-2022 11:09                2942
function.stats-stat-powersum.php                   30-Sep-2022 11:09                2972
function.stats-variance.php                        30-Sep-2022 11:09                3405
function.stomp-connect-error.php                   30-Sep-2022 11:09                3982
function.stomp-version.php                         30-Sep-2022 11:09                3296
function.str-contains.php                          30-Sep-2022 11:09                9687
function.str-ends-with.php                         30-Sep-2022 11:09                9564
function.str-getcsv.php                            30-Sep-2022 11:09                8822
function.str-ireplace.php                          30-Sep-2022 11:09               10103
function.str-pad.php                               30-Sep-2022 11:09                8493
function.str-repeat.php                            30-Sep-2022 11:09                5015
function.str-replace.php                           30-Sep-2022 11:09               19763
function.str-rot13.php                             30-Sep-2022 11:09                4028
function.str-shuffle.php                           30-Sep-2022 11:09                6261
function.str-split.php                             30-Sep-2022 11:09                9302
function.str-starts-with.php                       30-Sep-2022 11:09                9640
function.str-word-count.php                        30-Sep-2022 11:09               10276
function.strcasecmp.php                            30-Sep-2022 11:09                6368
function.strchr.php                                30-Sep-2022 11:09                1709
function.strcmp.php                                30-Sep-2022 11:09                6064
function.strcoll.php                               30-Sep-2022 11:09                5876
function.strcspn.php                               30-Sep-2022 11:09               12840
function.stream-bucket-append.php                  30-Sep-2022 11:09                2368
function.stream-bucket-make-writeable.php          30-Sep-2022 11:09                4585
function.stream-bucket-new.php                     30-Sep-2022 11:09                2334
function.stream-bucket-prepend.php                 30-Sep-2022 11:09                7053
function.stream-context-create.php                 30-Sep-2022 11:09                8323
function.stream-context-get-default.php            30-Sep-2022 11:09               10050
function.stream-context-get-options.php            30-Sep-2022 11:09                4845
function.stream-context-get-params.php             30-Sep-2022 11:09                5863
function.stream-context-set-default.php            30-Sep-2022 11:09                7164
function.stream-context-set-option.php             30-Sep-2022 11:09                5694
function.stream-context-set-params.php             30-Sep-2022 11:09                5070
function.stream-copy-to-stream.php                 30-Sep-2022 11:09                8086
function.stream-filter-append.php                  30-Sep-2022 11:09               12752
function.stream-filter-prepend.php                 30-Sep-2022 11:09                9431
function.stream-filter-register.php                30-Sep-2022 11:09               21627
function.stream-filter-remove.php                  30-Sep-2022 11:09                7201
function.stream-get-contents.php                   30-Sep-2022 11:09                9252
function.stream-get-filters.php                    30-Sep-2022 11:09                4574
function.stream-get-line.php                       30-Sep-2022 11:09                5687
function.stream-get-meta-data.php                  30-Sep-2022 11:09               16642
function.stream-get-transports.php                 30-Sep-2022 11:09                4538
function.stream-get-wrappers.php                   30-Sep-2022 11:09                5467
function.stream-is-local.php                       30-Sep-2022 11:09                4339
function.stream-isatty.php                         30-Sep-2022 11:09                4413
function.stream-notification-callback.php          30-Sep-2022 11:09               26999
function.stream-register-wrapper.php               30-Sep-2022 11:09                1973
function.stream-resolve-include-path.php           30-Sep-2022 11:09                4701
function.stream-select.php                         30-Sep-2022 11:09               19997
function.stream-set-blocking.php                   30-Sep-2022 11:09                5483
function.stream-set-chunk-size.php                 30-Sep-2022 11:09                3555
function.stream-set-read-buffer.php                30-Sep-2022 11:09                4235
function.stream-set-timeout.php                    30-Sep-2022 11:09                9124
function.stream-set-write-buffer.php               30-Sep-2022 11:09                6702
function.stream-socket-accept.php                  30-Sep-2022 11:09                8422
function.stream-socket-client.php                  30-Sep-2022 11:09               20568
function.stream-socket-enable-crypto.php           30-Sep-2022 11:09               12232
function.stream-socket-get-name.php                30-Sep-2022 11:09                4058
function.stream-socket-pair.php                    30-Sep-2022 11:09               10058
function.stream-socket-recvfrom.php                30-Sep-2022 11:09               12148
function.stream-socket-sendto.php                  30-Sep-2022 11:09                8271
function.stream-socket-server.php                  30-Sep-2022 11:09               17440
function.stream-socket-shutdown.php                30-Sep-2022 11:09                6949
function.stream-supports-lock.php                  30-Sep-2022 11:09                3379
function.stream-wrapper-register.php               30-Sep-2022 11:09               10151
function.stream-wrapper-restore.php                30-Sep-2022 11:09                3030
function.stream-wrapper-unregister.php             30-Sep-2022 11:09                3291
function.strftime.php                              30-Sep-2022 11:09               71454
function.strip-tags.php                            30-Sep-2022 11:09               10849
function.stripcslashes.php                         30-Sep-2022 11:09                4423
function.stripos.php                               30-Sep-2022 11:09               13472
function.stripslashes.php                          30-Sep-2022 11:09                8457
function.stristr.php                               30-Sep-2022 11:09               11122
function.strlen.php                                30-Sep-2022 11:09                5945
function.strnatcasecmp.php                         30-Sep-2022 11:09                7926
function.strnatcmp.php                             30-Sep-2022 11:09                9431
function.strncasecmp.php                           30-Sep-2022 11:09                7040
function.strncmp.php                               30-Sep-2022 11:09                6992
function.strpbrk.php                               30-Sep-2022 11:09                5840
function.strpos.php                                30-Sep-2022 11:09               16220
function.strptime.php                              30-Sep-2022 11:09               13535
function.strrchr.php                               30-Sep-2022 11:09                8118
function.strrev.php                                30-Sep-2022 11:09                3380
function.strripos.php                              30-Sep-2022 11:09               11844
function.strrpos.php                               30-Sep-2022 11:09               13275
function.strspn.php                                30-Sep-2022 11:09               11972
function.strstr.php                                30-Sep-2022 11:09                9386
function.strtok.php                                30-Sep-2022 11:09               14301
function.strtolower.php                            30-Sep-2022 11:09                5783
function.strtotime.php                             30-Sep-2022 11:09               15412
function.strtoupper.php                            30-Sep-2022 11:09                5787
function.strtr.php                                 30-Sep-2022 11:09               13484
function.strval.php                                30-Sep-2022 11:09                7228
function.substr-compare.php                        30-Sep-2022 11:09               11226
function.substr-count.php                          30-Sep-2022 11:09               10733
function.substr-replace.php                        30-Sep-2022 11:09               17822
function.substr.php                                30-Sep-2022 11:09               25604
function.svn-add.php                               30-Sep-2022 11:09                7280
function.svn-auth-get-parameter.php                30-Sep-2022 11:09                4501
function.svn-auth-set-parameter.php                30-Sep-2022 11:09                6280
function.svn-blame.php                             30-Sep-2022 11:09                5268
function.svn-cat.php                               30-Sep-2022 11:09                5463
function.svn-checkout.php                          30-Sep-2022 11:09                8442
function.svn-cleanup.php                           30-Sep-2022 11:09                6048
function.svn-client-version.php                    30-Sep-2022 11:09                3863
function.svn-commit.php                            30-Sep-2022 11:09                9294
function.svn-delete.php                            30-Sep-2022 11:09                5237
function.svn-diff.php                              30-Sep-2022 11:09               15567
function.svn-export.php                            30-Sep-2022 11:09                5455
function.svn-fs-abort-txn.php                      30-Sep-2022 11:09                3504
function.svn-fs-apply-text.php                     30-Sep-2022 11:09                3072
function.svn-fs-begin-txn2.php                     30-Sep-2022 11:09                2937
function.svn-fs-change-node-prop.php               30-Sep-2022 11:09                3584
function.svn-fs-check-path.php                     30-Sep-2022 11:09                3077
function.svn-fs-contents-changed.php               30-Sep-2022 11:09                3571
function.svn-fs-copy.php                           30-Sep-2022 11:09                4320
function.svn-fs-delete.php                         30-Sep-2022 11:09                3730
function.svn-fs-dir-entries.php                    30-Sep-2022 11:09                3204
function.svn-fs-file-contents.php                  30-Sep-2022 11:09                3149
function.svn-fs-file-length.php                    30-Sep-2022 11:09                3024
function.svn-fs-is-dir.php                         30-Sep-2022 11:09                3838
function.svn-fs-is-file.php                        30-Sep-2022 11:09                3817
function.svn-fs-make-dir.php                       30-Sep-2022 11:09                3769
function.svn-fs-make-file.php                      30-Sep-2022 11:09                3771
function.svn-fs-node-created-rev.php               30-Sep-2022 11:09                3127
function.svn-fs-node-prop.php                      30-Sep-2022 11:09                3093
function.svn-fs-props-changed.php                  30-Sep-2022 11:09                3535
function.svn-fs-revision-prop.php                  30-Sep-2022 11:09                3115
function.svn-fs-revision-root.php                  30-Sep-2022 11:09                3141
function.svn-fs-txn-root.php                       30-Sep-2022 11:09                2866
function.svn-fs-youngest-rev.php                   30-Sep-2022 11:09                2934
function.svn-import.php                            30-Sep-2022 11:09                6953
function.svn-log.php                               30-Sep-2022 11:09               10467
function.svn-ls.php                                30-Sep-2022 11:09                8524
function.svn-mkdir.php                             30-Sep-2022 11:09                3381
function.svn-repos-create.php                      30-Sep-2022 11:09                3186
function.svn-repos-fs-begin-txn-for-commit.php     30-Sep-2022 11:09                3409
function.svn-repos-fs-commit-txn.php               30-Sep-2022 11:09                2994
function.svn-repos-fs.php                          30-Sep-2022 11:09                2906
function.svn-repos-hotcopy.php                     30-Sep-2022 11:09                3235
function.svn-repos-open.php                        30-Sep-2022 11:09                2859
function.svn-repos-recover.php                     30-Sep-2022 11:09                2953
function.svn-revert.php                            30-Sep-2022 11:09                3730
function.svn-status.php                            30-Sep-2022 11:09               17803
function.svn-update.php                            30-Sep-2022 11:09                6997
function.swoole-async-dns-lookup.php               30-Sep-2022 11:09                3784
function.swoole-async-read.php                     30-Sep-2022 11:09                4374
function.swoole-async-readfile.php                 30-Sep-2022 11:09                3776
function.swoole-async-set.php                      30-Sep-2022 11:09                2486
function.swoole-async-write.php                    30-Sep-2022 11:09                3685
function.swoole-async-writefile.php                30-Sep-2022 11:09                3684
function.swoole-clear-error.php                    30-Sep-2022 11:09                2482
function.swoole-client-select.php                  30-Sep-2022 11:09                3286
function.swoole-cpu-num.php                        30-Sep-2022 11:09                2157
function.swoole-errno.php                          30-Sep-2022 11:09                2151
function.swoole-error-log.php                      30-Sep-2022 11:09                3272
function.swoole-event-add.php                      30-Sep-2022 11:09                3395
function.swoole-event-defer.php                    30-Sep-2022 11:09                2656
function.swoole-event-del.php                      30-Sep-2022 11:09                2533
function.swoole-event-exit.php                     30-Sep-2022 11:09                2256
function.swoole-event-set.php                      30-Sep-2022 11:09                3369
function.swoole-event-wait.php                     30-Sep-2022 11:09                2196
function.swoole-event-write.php                    30-Sep-2022 11:09                2753
function.swoole-get-local-ip.php                   30-Sep-2022 11:09                2267
function.swoole-last-error.php                     30-Sep-2022 11:09                2196
function.swoole-load-module.php                    30-Sep-2022 11:09                2365
function.swoole-select.php                         30-Sep-2022 11:09                3270
function.swoole-set-process-name.php               30-Sep-2022 11:09                2555
function.swoole-strerror.php                       30-Sep-2022 11:09                2493
function.swoole-timer-after.php                    30-Sep-2022 11:09                2993
function.swoole-timer-exists.php                   30-Sep-2022 11:09                2387
function.swoole-timer-tick.php                     30-Sep-2022 11:09                2935
function.swoole-version.php                        30-Sep-2022 11:09                2142
function.symlink.php                               30-Sep-2022 11:09                5796
function.sys-get-temp-dir.php                      30-Sep-2022 11:08                4600
function.sys-getloadavg.php                        30-Sep-2022 11:09                4537
function.syslog.php                                30-Sep-2022 11:09               10345
function.system.php                                30-Sep-2022 11:09                9109
function.taint.php                                 30-Sep-2022 11:09                2746
function.tan.php                                   30-Sep-2022 11:09                4528
function.tanh.php                                  30-Sep-2022 11:09                3394
function.tcpwrap-check.php                         30-Sep-2022 11:09                5974
function.tempnam.php                               30-Sep-2022 11:09                7983
function.textdomain.php                            30-Sep-2022 11:09                3509
function.tidy-access-count.php                     30-Sep-2022 11:09                7157
function.tidy-config-count.php                     30-Sep-2022 11:09                4612
function.tidy-error-count.php                      30-Sep-2022 11:09                5730
function.tidy-get-output.php                       30-Sep-2022 11:09                4475
function.tidy-warning-count.php                    30-Sep-2022 11:09                5329
function.time-nanosleep.php                        30-Sep-2022 11:09                9926
function.time-sleep-until.php                      30-Sep-2022 11:09                6452
function.time.php                                  30-Sep-2022 11:09                5330
function.timezone-abbreviations-list.php           30-Sep-2022 11:09                1956
function.timezone-identifiers-list.php             30-Sep-2022 11:09                1972
function.timezone-location-get.php                 30-Sep-2022 11:09                1928
function.timezone-name-from-abbr.php               30-Sep-2022 11:09                6780
function.timezone-name-get.php                     30-Sep-2022 11:09                1872
function.timezone-offset-get.php                   30-Sep-2022 11:09                1870
function.timezone-open.php                         30-Sep-2022 11:09                1858
function.timezone-transitions-get.php              30-Sep-2022 11:09                1931
function.timezone-version-get.php                  30-Sep-2022 11:09                5018
function.tmpfile.php                               30-Sep-2022 11:09                6224
function.token-get-all.php                         30-Sep-2022 11:09               13569
function.token-name.php                            30-Sep-2022 11:09                4599
function.touch.php                                 30-Sep-2022 11:09                8838
function.trader-acos.php                           30-Sep-2022 11:09                2668
function.trader-ad.php                             30-Sep-2022 11:09                3451
function.trader-add.php                            30-Sep-2022 11:09                2935
function.trader-adosc.php                          30-Sep-2022 11:09                4327
function.trader-adx.php                            30-Sep-2022 11:09                3514
function.trader-adxr.php                           30-Sep-2022 11:09                3535
function.trader-apo.php                            30-Sep-2022 11:09                3829
function.trader-aroon.php                          30-Sep-2022 11:09                3080
function.trader-aroonosc.php                       30-Sep-2022 11:09                3129
function.trader-asin.php                           30-Sep-2022 11:09                2663
function.trader-atan.php                           30-Sep-2022 11:09                2661
function.trader-atr.php                            30-Sep-2022 11:09                3497
function.trader-avgprice.php                       30-Sep-2022 11:09                3461
function.trader-bbands.php                         30-Sep-2022 11:09                4520
function.trader-beta.php                           30-Sep-2022 11:09                3052
function.trader-bop.php                            30-Sep-2022 11:09                3403
function.trader-cci.php                            30-Sep-2022 11:09                3493
function.trader-cdl2crows.php                      30-Sep-2022 11:09                3483
function.trader-cdl3blackcrows.php                 30-Sep-2022 11:09                3550
function.trader-cdl3inside.php                     30-Sep-2022 11:09                3576
function.trader-cdl3linestrike.php                 30-Sep-2022 11:09                3545
function.trader-cdl3outside.php                    30-Sep-2022 11:09                3590
function.trader-cdl3starsinsouth.php               30-Sep-2022 11:09                3586
function.trader-cdl3whitesoldiers.php              30-Sep-2022 11:09                3629
function.trader-cdlabandonedbaby.php               30-Sep-2022 11:09                3992
function.trader-cdladvanceblock.php                30-Sep-2022 11:09                3581
function.trader-cdlbelthold.php                    30-Sep-2022 11:09                3530
function.trader-cdlbreakaway.php                   30-Sep-2022 11:09                3528
function.trader-cdlclosingmarubozu.php             30-Sep-2022 11:09                3615
function.trader-cdlconcealbabyswall.php            30-Sep-2022 11:09                3635
function.trader-cdlcounterattack.php               30-Sep-2022 11:09                3592
function.trader-cdldarkcloudcover.php              30-Sep-2022 11:09                4002
function.trader-cdldoji.php                        30-Sep-2022 11:09                3474
function.trader-cdldojistar.php                    30-Sep-2022 11:09                3517
function.trader-cdldragonflydoji.php               30-Sep-2022 11:09                3571
function.trader-cdlengulfing.php                   30-Sep-2022 11:09                3561
function.trader-cdleveningdojistar.php             30-Sep-2022 11:09                4011
function.trader-cdleveningstar.php                 30-Sep-2022 11:09                3984
function.trader-cdlgapsidesidewhite.php            30-Sep-2022 11:09                3668
function.trader-cdlgravestonedoji.php              30-Sep-2022 11:09                3593
function.trader-cdlhammer.php                      30-Sep-2022 11:09                3500
function.trader-cdlhangingman.php                  30-Sep-2022 11:09                3524
function.trader-cdlharami.php                      30-Sep-2022 11:09                3511
function.trader-cdlharamicross.php                 30-Sep-2022 11:09                3570
function.trader-cdlhighwave.php                    30-Sep-2022 11:09                3563
function.trader-cdlhikkake.php                     30-Sep-2022 11:09                3536
function.trader-cdlhikkakemod.php                  30-Sep-2022 11:09                3601
function.trader-cdlhomingpigeon.php                30-Sep-2022 11:09                3621
function.trader-cdlidentical3crows.php             30-Sep-2022 11:09                3648
function.trader-cdlinneck.php                      30-Sep-2022 11:09                3562
function.trader-cdlinvertedhammer.php              30-Sep-2022 11:09                3627
function.trader-cdlkicking.php                     30-Sep-2022 11:09                3577
function.trader-cdlkickingbylength.php             30-Sep-2022 11:09                3685
function.trader-cdlladderbottom.php                30-Sep-2022 11:09                3629
function.trader-cdllongleggeddoji.php              30-Sep-2022 11:09                3635
function.trader-cdllongline.php                    30-Sep-2022 11:09                3571
function.trader-cdlmarubozu.php                    30-Sep-2022 11:09                3516
function.trader-cdlmatchinglow.php                 30-Sep-2022 11:09                3615
function.trader-cdlmathold.php                     30-Sep-2022 11:09                3936
function.trader-cdlmorningdojistar.php             30-Sep-2022 11:09                4007
function.trader-cdlmorningstar.php                 30-Sep-2022 11:09                3964
function.trader-cdlonneck.php                      30-Sep-2022 11:09                3527
function.trader-cdlpiercing.php                    30-Sep-2022 11:09                3555
function.trader-cdlrickshawman.php                 30-Sep-2022 11:09                3571
function.trader-cdlrisefall3methods.php            30-Sep-2022 11:09                3666
function.trader-cdlseparatinglines.php             30-Sep-2022 11:09                3608
function.trader-cdlshootingstar.php                30-Sep-2022 11:09                3579
function.trader-cdlshortline.php                   30-Sep-2022 11:09                3596
function.trader-cdlspinningtop.php                 30-Sep-2022 11:09                3550
function.trader-cdlstalledpattern.php              30-Sep-2022 11:09                3590
function.trader-cdlsticksandwich.php               30-Sep-2022 11:09                3585
function.trader-cdltakuri.php                      30-Sep-2022 11:09                3581
function.trader-cdltasukigap.php                   30-Sep-2022 11:09                3527
function.trader-cdlthrusting.php                   30-Sep-2022 11:09                3556
function.trader-cdltristar.php                     30-Sep-2022 11:09                3548
function.trader-cdlunique3river.php                30-Sep-2022 11:09                3629
function.trader-cdlupsidegap2crows.php             30-Sep-2022 11:09                3672
function.trader-cdlxsidegap3methods.php            30-Sep-2022 11:09                3613
function.trader-ceil.php                           30-Sep-2022 11:09                2706
function.trader-cmo.php                            30-Sep-2022 11:09                2804
function.trader-correl.php                         30-Sep-2022 11:09                3135
function.trader-cos.php                            30-Sep-2022 11:09                2633
function.trader-cosh.php                           30-Sep-2022 11:09                2701
function.trader-dema.php                           30-Sep-2022 11:09                2828
function.trader-div.php                            30-Sep-2022 11:09                2975
function.trader-dx.php                             30-Sep-2022 11:09                3483
function.trader-ema.php                            30-Sep-2022 11:09                2803
function.trader-errno.php                          30-Sep-2022 11:09                2311
function.trader-exp.php                            30-Sep-2022 11:09                2717
function.trader-floor.php                          30-Sep-2022 11:09                2685
function.trader-get-compat.php                     30-Sep-2022 11:09                2592
function.trader-get-unstable-period.php            30-Sep-2022 11:09                2937
function.trader-ht-dcperiod.php                    30-Sep-2022 11:09                2608
function.trader-ht-dcphase.php                     30-Sep-2022 11:09                2576
function.trader-ht-phasor.php                      30-Sep-2022 11:09                2531
function.trader-ht-sine.php                        30-Sep-2022 11:09                2510
function.trader-ht-trendline.php                   30-Sep-2022 11:09                2592
function.trader-ht-trendmode.php                   30-Sep-2022 11:09                2576
function.trader-kama.php                           30-Sep-2022 11:09                2858
function.trader-linearreg-angle.php                30-Sep-2022 11:09                2939
function.trader-linearreg-intercept.php            30-Sep-2022 11:09                2993
function.trader-linearreg-slope.php                30-Sep-2022 11:09                2953
function.trader-linearreg.php                      30-Sep-2022 11:09                2850
function.trader-ln.php                             30-Sep-2022 11:09                2645
function.trader-log10.php                          30-Sep-2022 11:09                2661
function.trader-ma.php                             30-Sep-2022 11:09                3202
function.trader-macd.php                           30-Sep-2022 11:09                3843
function.trader-macdext.php                        30-Sep-2022 11:09                5436
function.trader-macdfix.php                        30-Sep-2022 11:09                2957
function.trader-mama.php                           30-Sep-2022 11:09                3307
function.trader-mavp.php                           30-Sep-2022 11:09                4233
function.trader-max.php                            30-Sep-2022 11:09                2819
function.trader-maxindex.php                       30-Sep-2022 11:09                2882
function.trader-medprice.php                       30-Sep-2022 11:09                2758
function.trader-mfi.php                            30-Sep-2022 11:09                3826
function.trader-midpoint.php                       30-Sep-2022 11:09                2842
function.trader-midprice.php                       30-Sep-2022 11:09                3127
function.trader-min.php                            30-Sep-2022 11:09                2827
function.trader-minindex.php                       30-Sep-2022 11:09                2884
function.trader-minmax.php                         30-Sep-2022 11:09                2895
function.trader-minmaxindex.php                    30-Sep-2022 11:09                2950
function.trader-minus-di.php                       30-Sep-2022 11:09                3567
function.trader-minus-dm.php                       30-Sep-2022 11:09                3138
function.trader-mom.php                            30-Sep-2022 11:09                2761
function.trader-mult.php                           30-Sep-2022 11:09                2992
function.trader-natr.php                           30-Sep-2022 11:09                3528
function.trader-obv.php                            30-Sep-2022 11:09                2744
function.trader-plus-di.php                        30-Sep-2022 11:09                3537
function.trader-plus-dm.php                        30-Sep-2022 11:09                3124
function.trader-ppo.php                            30-Sep-2022 11:09                3831
function.trader-roc.php                            30-Sep-2022 11:09                2820
function.trader-rocp.php                           30-Sep-2022 11:09                2886
function.trader-rocr.php                           30-Sep-2022 11:09                2845
function.trader-rocr100.php                        30-Sep-2022 11:09                2886
function.trader-rsi.php                            30-Sep-2022 11:09                2783
function.trader-sar.php                            30-Sep-2022 11:09                3846
function.trader-sarext.php                         30-Sep-2022 11:09                7661
function.trader-set-compat.php                     30-Sep-2022 11:09                2844
function.trader-set-unstable-period.php            30-Sep-2022 11:09                3592
function.trader-sin.php                            30-Sep-2022 11:09                2663
function.trader-sinh.php                           30-Sep-2022 11:09                2701
function.trader-sma.php                            30-Sep-2022 11:09                2787
function.trader-sqrt.php                           30-Sep-2022 11:09                2672
function.trader-stddev.php                         30-Sep-2022 11:09                3067
function.trader-stoch.php                          30-Sep-2022 11:09                5454
function.trader-stochf.php                         30-Sep-2022 11:09                4569
function.trader-stochrsi.php                       30-Sep-2022 11:09                4327
function.trader-sub.php                            30-Sep-2022 11:09                2961
function.trader-sum.php                            30-Sep-2022 11:09                2755
function.trader-t3.php                             30-Sep-2022 11:09                3158
function.trader-tan.php                            30-Sep-2022 11:09                2629
function.trader-tanh.php                           30-Sep-2022 11:09                2658
function.trader-tema.php                           30-Sep-2022 11:09                2834
function.trader-trange.php                         30-Sep-2022 11:09                3042
function.trader-trima.php                          30-Sep-2022 11:09                2819
function.trader-trix.php                           30-Sep-2022 11:09                2839
function.trader-tsf.php                            30-Sep-2022 11:09                2789
function.trader-typprice.php                       30-Sep-2022 11:09                3054
function.trader-ultosc.php                         30-Sep-2022 11:09                4458
function.trader-var.php                            30-Sep-2022 11:09                3020
function.trader-wclprice.php                       30-Sep-2022 11:09                3073
function.trader-willr.php                          30-Sep-2022 11:09                3521
function.trader-wma.php                            30-Sep-2022 11:09                2848
function.trait-exists.php                          30-Sep-2022 11:09                2917
function.trigger-error.php                         30-Sep-2022 11:08                7155
function.trim.php                                  30-Sep-2022 11:09               14818
function.uasort.php                                30-Sep-2022 11:09               11006
function.ucfirst.php                               30-Sep-2022 11:09                6235
function.ucwords.php                               30-Sep-2022 11:09               10883
function.ui-draw-text-font-fontfamilies.php        30-Sep-2022 11:09                2510
function.ui-quit.php                               30-Sep-2022 11:09                2123
function.ui-run.php                                30-Sep-2022 11:09                2515
function.uksort.php                                30-Sep-2022 11:09               10103
function.umask.php                                 30-Sep-2022 11:09                6342
function.uniqid.php                                30-Sep-2022 11:09                9203
function.unixtojd.php                              30-Sep-2022 11:09                4202
function.unlink.php                                30-Sep-2022 11:09                6443
function.unpack.php                                30-Sep-2022 11:09               12256
function.unregister-tick-function.php              30-Sep-2022 11:09                3528
function.unserialize.php                           30-Sep-2022 11:09               19087
function.unset.php                                 30-Sep-2022 11:09               17342
function.untaint.php                               30-Sep-2022 11:09                2459
function.uopz-add-function.php                     30-Sep-2022 11:08                7196
function.uopz-allow-exit.php                       30-Sep-2022 11:08                5074
function.uopz-backup.php                           30-Sep-2022 11:08                4712
function.uopz-compose.php                          30-Sep-2022 11:08                7357
function.uopz-copy.php                             30-Sep-2022 11:08                5405
function.uopz-del-function.php                     30-Sep-2022 11:08                6651
function.uopz-delete.php                           30-Sep-2022 11:08                6177
function.uopz-extend.php                           30-Sep-2022 11:08                5187
function.uopz-flags.php                            30-Sep-2022 11:08               11508
function.uopz-function.php                         30-Sep-2022 11:08                7484
function.uopz-get-exit-status.php                  30-Sep-2022 11:08                4667
function.uopz-get-hook.php                         30-Sep-2022 11:08                5699
function.uopz-get-mock.php                         30-Sep-2022 11:08                5534
function.uopz-get-property.php                     30-Sep-2022 11:08                6687
function.uopz-get-return.php                       30-Sep-2022 11:08                4691
function.uopz-get-static.php                       30-Sep-2022 11:08                5377
function.uopz-implement.php                        30-Sep-2022 11:08                5091
function.uopz-overload.php                         30-Sep-2022 11:08                4166
function.uopz-redefine.php                         30-Sep-2022 11:08                5236
function.uopz-rename.php                           30-Sep-2022 11:08                7025
function.uopz-restore.php                          30-Sep-2022 11:08                5048
function.uopz-set-hook.php                         30-Sep-2022 11:08                5870
function.uopz-set-mock.php                         30-Sep-2022 11:08               13469
function.uopz-set-property.php                     30-Sep-2022 11:08                8163
function.uopz-set-return.php                       30-Sep-2022 11:08               10142
function.uopz-set-static.php                       30-Sep-2022 11:08                5987
function.uopz-undefine.php                         30-Sep-2022 11:08                4626
function.uopz-unset-hook.php                       30-Sep-2022 11:08                5681
function.uopz-unset-mock.php                       30-Sep-2022 11:08                5921
function.uopz-unset-return.php                     30-Sep-2022 11:08                4940
function.urldecode.php                             30-Sep-2022 11:09                7043
function.urlencode.php                             30-Sep-2022 11:09                9621
function.use-soap-error-handler.php                30-Sep-2022 11:09                4308
function.user-error.php                            30-Sep-2022 11:08                1750
function.usleep.php                                30-Sep-2022 11:09                6735
function.usort.php                                 30-Sep-2022 11:09               29679
function.utf8-decode.php                           30-Sep-2022 11:09               10270
function.utf8-encode.php                           30-Sep-2022 11:09                8734
function.var-dump.php                              30-Sep-2022 11:09                8040
function.var-export.php                            30-Sep-2022 11:09               19044
function.var-representation.php                    30-Sep-2022 11:09               15191
function.variant-abs.php                           30-Sep-2022 11:09                4978
function.variant-add.php                           30-Sep-2022 11:09                6583
function.variant-and.php                           30-Sep-2022 11:09                7075
function.variant-cast.php                          30-Sep-2022 11:09                3745
function.variant-cat.php                           30-Sep-2022 11:09                5554
function.variant-cmp.php                           30-Sep-2022 11:09                8340
function.variant-date-from-timestamp.php           30-Sep-2022 11:09                3942
function.variant-date-to-timestamp.php             30-Sep-2022 11:09                4044
function.variant-div.php                           30-Sep-2022 11:09                7408
function.variant-eqv.php                           30-Sep-2022 11:09                5452
function.variant-fix.php                           30-Sep-2022 11:09                6744
function.variant-get-type.php                      30-Sep-2022 11:09                3814
function.variant-idiv.php                          30-Sep-2022 11:09                6860
function.variant-imp.php                           30-Sep-2022 11:09                6583
function.variant-int.php                           30-Sep-2022 11:09                6066
function.variant-mod.php                           30-Sep-2022 11:09                5624
function.variant-mul.php                           30-Sep-2022 11:09                6790
function.variant-neg.php                           30-Sep-2022 11:09                4576
function.variant-not.php                           30-Sep-2022 11:09                4821
function.variant-or.php                            30-Sep-2022 11:09                7325
function.variant-pow.php                           30-Sep-2022 11:09                5486
function.variant-round.php                         30-Sep-2022 11:09                5078
function.variant-set-type.php                      30-Sep-2022 11:09                3910
function.variant-set.php                           30-Sep-2022 11:09                3144
function.variant-sub.php                           30-Sep-2022 11:09                6430
function.variant-xor.php                           30-Sep-2022 11:09                6589
function.version-compare.php                       30-Sep-2022 11:08               12883
function.vfprintf.php                              30-Sep-2022 11:09               19580
function.virtual.php                               30-Sep-2022 11:09                6716
function.vprintf.php                               30-Sep-2022 11:09               18975
function.vsprintf.php                              30-Sep-2022 11:09               19421
function.wddx-add-vars.php                         30-Sep-2022 11:09                4122
function.wddx-deserialize.php                      30-Sep-2022 11:09                4188
function.wddx-packet-end.php                       30-Sep-2022 11:09                2926
function.wddx-packet-start.php                     30-Sep-2022 11:09                3283
function.wddx-serialize-value.php                  30-Sep-2022 11:09                3450
function.wddx-serialize-vars.php                   30-Sep-2022 11:09                6527
function.win32-continue-service.php                30-Sep-2022 11:09                7532
function.win32-create-service.php                  30-Sep-2022 11:09               37675
function.win32-delete-service.php                  30-Sep-2022 11:09                7879
function.win32-get-last-control-message.php        30-Sep-2022 11:09                8210
function.win32-pause-service.php                   30-Sep-2022 11:09                7470
function.win32-query-service-status.php            30-Sep-2022 11:09                9851
function.win32-send-custom-control.php             30-Sep-2022 11:09                8003
function.win32-set-service-exit-code.php           30-Sep-2022 11:09                6595
function.win32-set-service-exit-mode.php           30-Sep-2022 11:09                6485
function.win32-set-service-status.php              30-Sep-2022 11:09                9542
function.win32-start-service-ctrl-dispatcher.php   30-Sep-2022 11:09               12846
function.win32-start-service.php                   30-Sep-2022 11:09                7561
function.win32-stop-service.php                    30-Sep-2022 11:09                7466
function.wincache-fcache-fileinfo.php              30-Sep-2022 11:08               10692
function.wincache-fcache-meminfo.php               30-Sep-2022 11:08                8358
function.wincache-lock.php                         30-Sep-2022 11:08               10291
function.wincache-ocache-fileinfo.php              30-Sep-2022 11:08               11609
function.wincache-ocache-meminfo.php               30-Sep-2022 11:08                8537
function.wincache-refresh-if-changed.php           30-Sep-2022 11:08                9314
function.wincache-rplist-fileinfo.php              30-Sep-2022 11:08                8703
function.wincache-rplist-meminfo.php               30-Sep-2022 11:08                8612
function.wincache-scache-info.php                  30-Sep-2022 11:08               11127
function.wincache-scache-meminfo.php               30-Sep-2022 11:08                7760
function.wincache-ucache-add.php                   30-Sep-2022 11:08               15935
function.wincache-ucache-cas.php                   30-Sep-2022 11:08                6778
function.wincache-ucache-clear.php                 30-Sep-2022 11:08                8416
function.wincache-ucache-dec.php                   30-Sep-2022 11:08                6935
function.wincache-ucache-delete.php                30-Sep-2022 11:08               12842
function.wincache-ucache-exists.php                30-Sep-2022 11:08                6992
function.wincache-ucache-get.php                   30-Sep-2022 11:08               12309
function.wincache-ucache-inc.php                   30-Sep-2022 11:08                6930
function.wincache-ucache-info.php                  30-Sep-2022 11:08               13193
function.wincache-ucache-meminfo.php               30-Sep-2022 11:08                8182
function.wincache-ucache-set.php                   30-Sep-2022 11:08               16079
function.wincache-unlock.php                       30-Sep-2022 11:08                9309
function.wordwrap.php                              30-Sep-2022 11:09                9992
function.xattr-get.php                             30-Sep-2022 11:09                6773
function.xattr-list.php                            30-Sep-2022 11:09                7358
function.xattr-remove.php                          30-Sep-2022 11:09                6956
function.xattr-set.php                             30-Sep-2022 11:09                8716
function.xattr-supported.php                       30-Sep-2022 11:09                5693
function.xdiff-file-bdiff-size.php                 30-Sep-2022 11:09                5356
function.xdiff-file-bdiff.php                      30-Sep-2022 11:09                6318
function.xdiff-file-bpatch.php                     30-Sep-2022 11:09                7023
function.xdiff-file-diff-binary.php                30-Sep-2022 11:09                6826
function.xdiff-file-diff.php                       30-Sep-2022 11:09                7853
function.xdiff-file-merge3.php                     30-Sep-2022 11:09                7220
function.xdiff-file-patch-binary.php               30-Sep-2022 11:09                7063
function.xdiff-file-patch.php                      30-Sep-2022 11:09                9579
function.xdiff-file-rabdiff.php                    30-Sep-2022 11:09                7035
function.xdiff-string-bdiff-size.php               30-Sep-2022 11:09                5769
function.xdiff-string-bdiff.php                    30-Sep-2022 11:09                4196
function.xdiff-string-bpatch.php                   30-Sep-2022 11:09                4131
function.xdiff-string-diff-binary.php              30-Sep-2022 11:09                4816
function.xdiff-string-diff.php                     30-Sep-2022 11:09                8139
function.xdiff-string-merge3.php                   30-Sep-2022 11:09                5080
function.xdiff-string-patch-binary.php             30-Sep-2022 11:09                4717
function.xdiff-string-patch.php                    30-Sep-2022 11:09                8854
function.xdiff-string-rabdiff.php                  30-Sep-2022 11:09                4945
function.xhprof-disable.php                        30-Sep-2022 11:08                4139
function.xhprof-enable.php                         30-Sep-2022 11:08                8318
function.xhprof-sample-disable.php                 30-Sep-2022 11:08                4929
function.xhprof-sample-enable.php                  30-Sep-2022 11:08                4018
function.xml-error-string.php                      30-Sep-2022 11:09                3524
function.xml-get-current-byte-index.php            30-Sep-2022 11:09                5199
function.xml-get-current-column-number.php         30-Sep-2022 11:09                4880
function.xml-get-current-line-number.php           30-Sep-2022 11:09                4630
function.xml-get-error-code.php                    30-Sep-2022 11:09                4185
function.xml-parse-into-struct.php                 30-Sep-2022 11:09               22547
function.xml-parse.php                             30-Sep-2022 11:09                9108
function.xml-parser-create-ns.php                  30-Sep-2022 11:09                6268
function.xml-parser-create.php                     30-Sep-2022 11:09                5534
function.xml-parser-free.php                       30-Sep-2022 11:09                4411
function.xml-parser-get-option.php                 30-Sep-2022 11:09                5086
function.xml-parser-set-option.php                 30-Sep-2022 11:09                6784
function.xml-set-character-data-handler.php        30-Sep-2022 11:09                6664
function.xml-set-default-handler.php               30-Sep-2022 11:09                6426
function.xml-set-element-handler.php               30-Sep-2022 11:09                9909
function.xml-set-end-namespace-decl-handler.php    30-Sep-2022 11:09                8103
function.xml-set-external-entity-ref-handler.php   30-Sep-2022 11:09                9581
function.xml-set-notation-decl-handler.php         30-Sep-2022 11:09                8579
function.xml-set-object.php                        30-Sep-2022 11:09               11141
function.xml-set-processing-instruction-handler..> 30-Sep-2022 11:09                7815
function.xml-set-start-namespace-decl-handler.php  30-Sep-2022 11:09                8200
function.xml-set-unparsed-entity-decl-handler.php  30-Sep-2022 11:09                9305
function.xmlrpc-decode-request.php                 30-Sep-2022 11:09                3003
function.xmlrpc-decode.php                         30-Sep-2022 11:09                4586
function.xmlrpc-encode-request.php                 30-Sep-2022 11:09                9417
function.xmlrpc-encode.php                         30-Sep-2022 11:09                2697
function.xmlrpc-get-type.php                       30-Sep-2022 11:09                6923
function.xmlrpc-is-fault.php                       30-Sep-2022 11:09                4166
function.xmlrpc-parse-method-descriptions.php      30-Sep-2022 11:09                2798
function.xmlrpc-server-add-introspection-data.php  30-Sep-2022 11:09                2942
function.xmlrpc-server-call-method.php             30-Sep-2022 11:09                3333
function.xmlrpc-server-create.php                  30-Sep-2022 11:09                2557
function.xmlrpc-server-destroy.php                 30-Sep-2022 11:09                2724
function.xmlrpc-server-register-introspection-c..> 30-Sep-2022 11:09                3034
function.xmlrpc-server-register-method.php         30-Sep-2022 11:09                3063
function.xmlrpc-set-type.php                       30-Sep-2022 11:09                5893
function.yaml-emit-file.php                        30-Sep-2022 11:09                6652
function.yaml-emit.php                             30-Sep-2022 11:09               13806
function.yaml-parse-file.php                       30-Sep-2022 11:09                6875
function.yaml-parse-url.php                        30-Sep-2022 11:09                7559
function.yaml-parse.php                            30-Sep-2022 11:09               11155
function.yaz-addinfo.php                           30-Sep-2022 11:09                3870
function.yaz-ccl-conf.php                          30-Sep-2022 11:09                6396
function.yaz-ccl-parse.php                         30-Sep-2022 11:09                7332
function.yaz-close.php                             30-Sep-2022 11:09                3688
function.yaz-connect.php                           30-Sep-2022 11:09               11411
function.yaz-database.php                          30-Sep-2022 11:09                3596
function.yaz-element.php                           30-Sep-2022 11:09                4059
function.yaz-errno.php                             30-Sep-2022 11:09                4127
function.yaz-error.php                             30-Sep-2022 11:09                3779
function.yaz-es-result.php                         30-Sep-2022 11:09                3494
function.yaz-es.php                                30-Sep-2022 11:09                7735
function.yaz-get-option.php                        30-Sep-2022 11:09                3538
function.yaz-hits.php                              30-Sep-2022 11:09                5715
function.yaz-itemorder.php                         30-Sep-2022 11:09                7316
function.yaz-present.php                           30-Sep-2022 11:09                3121
function.yaz-range.php                             30-Sep-2022 11:09                3752
function.yaz-record.php                            30-Sep-2022 11:09               17090
function.yaz-scan-result.php                       30-Sep-2022 11:09                4374
function.yaz-scan.php                              30-Sep-2022 11:09               10631
function.yaz-schema.php                            30-Sep-2022 11:09                3737
function.yaz-search.php                            30-Sep-2022 11:09               10545
function.yaz-set-option.php                        30-Sep-2022 11:09                7833
function.yaz-sort.php                              30-Sep-2022 11:09                6625
function.yaz-syntax.php                            30-Sep-2022 11:09                3743
function.yaz-wait.php                              30-Sep-2022 11:09                4772
function.zend-thread-id.php                        30-Sep-2022 11:08                4332
function.zend-version.php                          30-Sep-2022 11:08                4307
function.zip-close.php                             30-Sep-2022 11:09                4220
function.zip-entry-close.php                       30-Sep-2022 11:09                4425
function.zip-entry-compressedsize.php              30-Sep-2022 11:09                4720
function.zip-entry-compressionmethod.php           30-Sep-2022 11:09                4742
function.zip-entry-filesize.php                    30-Sep-2022 11:09                4658
function.zip-entry-name.php                        30-Sep-2022 11:09                4494
function.zip-entry-open.php                        30-Sep-2022 11:09                6439
function.zip-entry-read.php                        30-Sep-2022 11:09                5594
function.zip-open.php                              30-Sep-2022 11:09                4612
function.zip-read.php                              30-Sep-2022 11:09                5026
function.zlib-decode.php                           30-Sep-2022 11:09                3587
function.zlib-encode.php                           30-Sep-2022 11:09                5387
function.zlib-get-coding-type.php                  30-Sep-2022 11:09                2974
function.zookeeper-dispatch.php                    30-Sep-2022 11:09                9656
functional.parallel.php                            30-Sep-2022 11:09                3190
functions.anonymous.php                            30-Sep-2022 11:08               29640
functions.arguments.php                            30-Sep-2022 11:08               54587
functions.arrow.php                                30-Sep-2022 11:08               12644
functions.first_class_callable_syntax.php          30-Sep-2022 11:08               13407
functions.internal.php                             30-Sep-2022 11:08               10540
functions.returning-values.php                     30-Sep-2022 11:08                7594
functions.user-defined.php                         30-Sep-2022 11:08               12318
functions.variable-functions.php                   30-Sep-2022 11:08               14030
gearman.configuration.php                          30-Sep-2022 11:09                1379
gearman.constants.php                              30-Sep-2022 11:09               21828
gearman.examples-reverse-bg.php                    30-Sep-2022 11:09               12616
gearman.examples-reverse-task.php                  30-Sep-2022 11:09               19899
gearman.examples-reverse.php                       30-Sep-2022 11:09               15196
gearman.examples.php                               30-Sep-2022 11:09                1743
gearman.installation.php                           30-Sep-2022 11:09                1807
gearman.requirements.php                           30-Sep-2022 11:09                1564
gearman.resources.php                              30-Sep-2022 11:09                1355
gearman.setup.php                                  30-Sep-2022 11:09                1671
gearmanclient.addoptions.php                       30-Sep-2022 11:09                3090
gearmanclient.addserver.php                        30-Sep-2022 11:09                5545
gearmanclient.addservers.php                       30-Sep-2022 11:09                5109
gearmanclient.addtask.php                          30-Sep-2022 11:09               16846
gearmanclient.addtaskbackground.php                30-Sep-2022 11:09               24604
gearmanclient.addtaskhigh.php                      30-Sep-2022 11:09               12983
gearmanclient.addtaskhighbackground.php            30-Sep-2022 11:09                6967
gearmanclient.addtasklow.php                       30-Sep-2022 11:09               12930
gearmanclient.addtasklowbackground.php             30-Sep-2022 11:09                6958
gearmanclient.addtaskstatus.php                    30-Sep-2022 11:09               11371
gearmanclient.clearcallbacks.php                   30-Sep-2022 11:09                5304
gearmanclient.clone.php                            30-Sep-2022 11:09                2735
gearmanclient.construct.php                        30-Sep-2022 11:09                3047
gearmanclient.context.php                          30-Sep-2022 11:09                3081
gearmanclient.data.php                             30-Sep-2022 11:09                3420
gearmanclient.do.php                               30-Sep-2022 11:09               26286
gearmanclient.dobackground.php                     30-Sep-2022 11:09               11181
gearmanclient.dohigh.php                           30-Sep-2022 11:09                5720
gearmanclient.dohighbackground.php                 30-Sep-2022 11:09                5565
gearmanclient.dojobhandle.php                      30-Sep-2022 11:09                3304
gearmanclient.dolow.php                            30-Sep-2022 11:09                5895
gearmanclient.dolowbackground.php                  30-Sep-2022 11:09                5519
gearmanclient.donormal.php                         30-Sep-2022 11:09               27065
gearmanclient.dostatus.php                         30-Sep-2022 11:09               10038
gearmanclient.echo.php                             30-Sep-2022 11:09                3090
gearmanclient.error.php                            30-Sep-2022 11:09                2805
gearmanclient.geterrno.php                         30-Sep-2022 11:09                2801
gearmanclient.jobstatus.php                        30-Sep-2022 11:09                9845
gearmanclient.ping.php                             30-Sep-2022 11:09                3170
gearmanclient.removeoptions.php                    30-Sep-2022 11:09                2672
gearmanclient.returncode.php                       30-Sep-2022 11:09                2389
gearmanclient.runtasks.php                         30-Sep-2022 11:09                3951
gearmanclient.setclientcallback.php                30-Sep-2022 11:09                6578
gearmanclient.setcompletecallback.php              30-Sep-2022 11:09                6426
gearmanclient.setcontext.php                       30-Sep-2022 11:09                3383
gearmanclient.setcreatedcallback.php               30-Sep-2022 11:09                5798
gearmanclient.setdata.php                          30-Sep-2022 11:09                3586
gearmanclient.setdatacallback.php                  30-Sep-2022 11:09                5734
gearmanclient.setexceptioncallback.php             30-Sep-2022 11:09                5699
gearmanclient.setfailcallback.php                  30-Sep-2022 11:09                5723
gearmanclient.setoptions.php                       30-Sep-2022 11:09                2669
gearmanclient.setstatuscallback.php                30-Sep-2022 11:09                5814
gearmanclient.settimeout.php                       30-Sep-2022 11:09                2758
gearmanclient.setwarningcallback.php               30-Sep-2022 11:09                5793
gearmanclient.setworkloadcallback.php              30-Sep-2022 11:09                6300
gearmanclient.timeout.php                          30-Sep-2022 11:09                3040
gearmanclient.wait.php                             30-Sep-2022 11:09                2945
gearmanjob.complete.php                            30-Sep-2022 11:09                3864
gearmanjob.construct.php                           30-Sep-2022 11:09                2458
gearmanjob.data.php                                30-Sep-2022 11:09                3703
gearmanjob.exception.php                           30-Sep-2022 11:09                3936
gearmanjob.fail.php                                30-Sep-2022 11:09                4155
gearmanjob.functionname.php                        30-Sep-2022 11:09                2874
gearmanjob.handle.php                              30-Sep-2022 11:09                2737
gearmanjob.returncode.php                          30-Sep-2022 11:09                2808
gearmanjob.sendcomplete.php                        30-Sep-2022 11:09                3527
gearmanjob.senddata.php                            30-Sep-2022 11:09                3427
gearmanjob.sendexception.php                       30-Sep-2022 11:09                3649
gearmanjob.sendfail.php                            30-Sep-2022 11:09                3822
gearmanjob.sendstatus.php                          30-Sep-2022 11:09                4171
gearmanjob.sendwarning.php                         30-Sep-2022 11:09                3687
gearmanjob.setreturn.php                           30-Sep-2022 11:09                2686
gearmanjob.status.php                              30-Sep-2022 11:09                4512
gearmanjob.unique.php                              30-Sep-2022 11:09                3078
gearmanjob.warning.php                             30-Sep-2022 11:09                4015
gearmanjob.workload.php                            30-Sep-2022 11:09                3149
gearmanjob.workloadsize.php                        30-Sep-2022 11:09                2827
gearmantask.construct.php                          30-Sep-2022 11:09                2549
gearmantask.create.php                             30-Sep-2022 11:09                2922
gearmantask.data.php                               30-Sep-2022 11:09                2885
gearmantask.datasize.php                           30-Sep-2022 11:09                2865
gearmantask.function.php                           30-Sep-2022 11:09                2825
gearmantask.functionname.php                       30-Sep-2022 11:09                2438
gearmantask.isknown.php                            30-Sep-2022 11:09                2464
gearmantask.isrunning.php                          30-Sep-2022 11:09                2480
gearmantask.jobhandle.php                          30-Sep-2022 11:09                2882
gearmantask.recvdata.php                           30-Sep-2022 11:09                3744
gearmantask.returncode.php                         30-Sep-2022 11:09                2808
gearmantask.senddata.php                           30-Sep-2022 11:09                3562
gearmantask.sendworkload.php                       30-Sep-2022 11:09                3574
gearmantask.taskdenominator.php                    30-Sep-2022 11:09                3106
gearmantask.tasknumerator.php                      30-Sep-2022 11:09                3078
gearmantask.unique.php                             30-Sep-2022 11:09                3509
gearmantask.uuid.php                               30-Sep-2022 11:09                3853
gearmanworker.addfunction.php                      30-Sep-2022 11:09                8852
gearmanworker.addoptions.php                       30-Sep-2022 11:09                3547
gearmanworker.addserver.php                        30-Sep-2022 11:09                5253
gearmanworker.addservers.php                       30-Sep-2022 11:09                4855
gearmanworker.clone.php                            30-Sep-2022 11:09                2402
gearmanworker.construct.php                        30-Sep-2022 11:09                3042
gearmanworker.echo.php                             30-Sep-2022 11:09                3300
gearmanworker.error.php                            30-Sep-2022 11:09                2790
gearmanworker.geterrno.php                         30-Sep-2022 11:09                2818
gearmanworker.options.php                          30-Sep-2022 11:09                2816
gearmanworker.register.php                         30-Sep-2022 11:09                4222
gearmanworker.removeoptions.php                    30-Sep-2022 11:09                3596
gearmanworker.returncode.php                       30-Sep-2022 11:09                3054
gearmanworker.setid.php                            30-Sep-2022 11:09                4315
gearmanworker.setoptions.php                       30-Sep-2022 11:09                3801
gearmanworker.settimeout.php                       30-Sep-2022 11:09                8970
gearmanworker.timeout.php                          30-Sep-2022 11:09                3153
gearmanworker.unregister.php                       30-Sep-2022 11:09                3686
gearmanworker.unregisterall.php                    30-Sep-2022 11:09                3431
gearmanworker.wait.php                             30-Sep-2022 11:09                9132
gearmanworker.work.php                             30-Sep-2022 11:09                5945
gender-gender.connect.php                          30-Sep-2022 11:09                2672
gender-gender.construct.php                        30-Sep-2022 11:09                2580
gender-gender.country.php                          30-Sep-2022 11:09                3966
gender-gender.get.php                              30-Sep-2022 11:09                2800
gender-gender.isnick.php                           30-Sep-2022 11:09                3396
gender-gender.similarnames.php                     30-Sep-2022 11:09                3001
gender.example.admin.php                           30-Sep-2022 11:09                9695
gender.examples.php                                30-Sep-2022 11:09                1403
gender.installation.php                            30-Sep-2022 11:09                2236
gender.setup.php                                   30-Sep-2022 11:09                1401
generator.current.php                              30-Sep-2022 11:08                2267
generator.getreturn.php                            30-Sep-2022 11:08                4211
generator.key.php                                  30-Sep-2022 11:08                4256
generator.next.php                                 30-Sep-2022 11:08                2556
generator.rewind.php                               30-Sep-2022 11:08                2328
generator.send.php                                 30-Sep-2022 11:08                6337
generator.throw.php                                30-Sep-2022 11:08                5740
generator.valid.php                                30-Sep-2022 11:08                2248
generator.wakeup.php                               30-Sep-2022 11:08                2376
geoip.configuration.php                            30-Sep-2022 11:09                2731
geoip.constants.php                                30-Sep-2022 11:09                4859
geoip.installation.php                             30-Sep-2022 11:09                1968
geoip.requirements.php                             30-Sep-2022 11:09                2032
geoip.resources.php                                30-Sep-2022 11:09                1311
geoip.setup.php                                    30-Sep-2022 11:09                1633
gettext.configuration.php                          30-Sep-2022 11:09                1379
gettext.constants.php                              30-Sep-2022 11:09                1249
gettext.installation.php                           30-Sep-2022 11:09                1516
gettext.requirements.php                           30-Sep-2022 11:09                1526
gettext.resources.php                              30-Sep-2022 11:09                1325
gettext.setup.php                                  30-Sep-2022 11:09                1676
getting-started.php                                30-Sep-2022 11:08                2082
globiterator.construct.php                         30-Sep-2022 11:09                8633
globiterator.count.php                             30-Sep-2022 11:09                4899
gmagick.addimage.php                               30-Sep-2022 11:09                3163
gmagick.addnoiseimage.php                          30-Sep-2022 11:09                3048
gmagick.annotateimage.php                          30-Sep-2022 11:09                4545
gmagick.blurimage.php                              30-Sep-2022 11:09                3326
gmagick.borderimage.php                            30-Sep-2022 11:09                3883
gmagick.charcoalimage.php                          30-Sep-2022 11:09                3381
gmagick.chopimage.php                              30-Sep-2022 11:09                4028
gmagick.clear.php                                  30-Sep-2022 11:09                2778
gmagick.commentimage.php                           30-Sep-2022 11:09                2960
gmagick.compositeimage.php                         30-Sep-2022 11:09                4232
gmagick.configuration.php                          30-Sep-2022 11:09                1405
gmagick.constants.php                              30-Sep-2022 11:09               70950
gmagick.construct.php                              30-Sep-2022 11:09                2694
gmagick.cropimage.php                              30-Sep-2022 11:09                4008
gmagick.cropthumbnailimage.php                     30-Sep-2022 11:09                3541
gmagick.current.php                                30-Sep-2022 11:09                2803
gmagick.cyclecolormapimage.php                     30-Sep-2022 11:09                3283
gmagick.deconstructimages.php                      30-Sep-2022 11:09                3153
gmagick.despeckleimage.php                         30-Sep-2022 11:09                3785
gmagick.destroy.php                                30-Sep-2022 11:09                2822
gmagick.drawimage.php                              30-Sep-2022 11:09                3195
gmagick.edgeimage.php                              30-Sep-2022 11:09                3109
gmagick.embossimage.php                            30-Sep-2022 11:09                3785
gmagick.enhanceimage.php                           30-Sep-2022 11:09                2817
gmagick.equalizeimage.php                          30-Sep-2022 11:09                2754
gmagick.examples.php                               30-Sep-2022 11:09                3973
gmagick.flipimage.php                              30-Sep-2022 11:09                3244
gmagick.flopimage.php                              30-Sep-2022 11:09                3223
gmagick.frameimage.php                             30-Sep-2022 11:09                4798
gmagick.gammaimage.php                             30-Sep-2022 11:09                3570
gmagick.getcopyright.php                           30-Sep-2022 11:09                2688
gmagick.getfilename.php                            30-Sep-2022 11:09                2731
gmagick.getimagebackgroundcolor.php                30-Sep-2022 11:09                2861
gmagick.getimageblueprimary.php                    30-Sep-2022 11:09                3227
gmagick.getimagebordercolor.php                    30-Sep-2022 11:09                2909
gmagick.getimagechanneldepth.php                   30-Sep-2022 11:09                2898
gmagick.getimagecolors.php                         30-Sep-2022 11:09                2741
gmagick.getimagecolorspace.php                     30-Sep-2022 11:09                2720
gmagick.getimagecompose.php                        30-Sep-2022 11:09                2792
gmagick.getimagedelay.php                          30-Sep-2022 11:09                2666
gmagick.getimagedepth.php                          30-Sep-2022 11:09                2596
gmagick.getimagedispose.php                        30-Sep-2022 11:09                2733
gmagick.getimageextrema.php                        30-Sep-2022 11:09                2934
gmagick.getimagefilename.php                       30-Sep-2022 11:09                2821
gmagick.getimageformat.php                         30-Sep-2022 11:09                2819
gmagick.getimagegamma.php                          30-Sep-2022 11:09                2680
gmagick.getimagegreenprimary.php                   30-Sep-2022 11:09                2873
gmagick.getimageheight.php                         30-Sep-2022 11:09                2670
gmagick.getimagehistogram.php                      30-Sep-2022 11:09                3166
gmagick.getimageindex.php                          30-Sep-2022 11:09                2858
gmagick.getimageinterlacescheme.php                30-Sep-2022 11:09                2853
gmagick.getimageiterations.php                     30-Sep-2022 11:09                2730
gmagick.getimagematte.php                          30-Sep-2022 11:09                2991
gmagick.getimagemattecolor.php                     30-Sep-2022 11:09                2950
gmagick.getimageprofile.php                        30-Sep-2022 11:09                2839
gmagick.getimageredprimary.php                     30-Sep-2022 11:09                2877
gmagick.getimagerenderingintent.php                30-Sep-2022 11:09                2833
gmagick.getimageresolution.php                     30-Sep-2022 11:09                2772
gmagick.getimagescene.php                          30-Sep-2022 11:09                2621
gmagick.getimagesignature.php                      30-Sep-2022 11:09                2746
gmagick.getimagetype.php                           30-Sep-2022 11:09                2677
gmagick.getimageunits.php                          30-Sep-2022 11:09                2387
gmagick.getimagewhitepoint.php                     30-Sep-2022 11:09                2924
gmagick.getimagewidth.php                          30-Sep-2022 11:09                2648
gmagick.getpackagename.php                         30-Sep-2022 11:09                2657
gmagick.getquantumdepth.php                        30-Sep-2022 11:09                2994
gmagick.getreleasedate.php                         30-Sep-2022 11:09                2722
gmagick.getsamplingfactors.php                     30-Sep-2022 11:09                2926
gmagick.getsize.php                                30-Sep-2022 11:09                2968
gmagick.getversion.php                             30-Sep-2022 11:09                2638
gmagick.hasnextimage.php                           30-Sep-2022 11:09                2980
gmagick.haspreviousimage.php                       30-Sep-2022 11:09                3051
gmagick.implodeimage.php                           30-Sep-2022 11:09                3156
gmagick.installation.php                           30-Sep-2022 11:09                2195
gmagick.labelimage.php                             30-Sep-2022 11:09                2900
gmagick.levelimage.php                             30-Sep-2022 11:09                5422
gmagick.magnifyimage.php                           30-Sep-2022 11:09                2865
gmagick.mapimage.php                               30-Sep-2022 11:09                3535
gmagick.medianfilterimage.php                      30-Sep-2022 11:09                3266
gmagick.minifyimage.php                            30-Sep-2022 11:09                2909
gmagick.modulateimage.php                          30-Sep-2022 11:09                4236
gmagick.motionblurimage.php                        30-Sep-2022 11:09                4303
gmagick.newimage.php                               30-Sep-2022 11:09                4086
gmagick.nextimage.php                              30-Sep-2022 11:09                2903
gmagick.normalizeimage.php                         30-Sep-2022 11:09                3267
gmagick.oilpaintimage.php                          30-Sep-2022 11:09                3385
gmagick.previousimage.php                          30-Sep-2022 11:09                2977
gmagick.profileimage.php                           30-Sep-2022 11:09                3890
gmagick.quantizeimage.php                          30-Sep-2022 11:09                6545
gmagick.quantizeimages.php                         30-Sep-2022 11:09                6599
gmagick.queryfontmetrics.php                       30-Sep-2022 11:09                3090
gmagick.queryfonts.php                             30-Sep-2022 11:09                2943
gmagick.queryformats.php                           30-Sep-2022 11:09                3166
gmagick.radialblurimage.php                        30-Sep-2022 11:09                3403
gmagick.raiseimage.php                             30-Sep-2022 11:09                4637
gmagick.read.php                                   30-Sep-2022 11:09                2871
gmagick.readimage.php                              30-Sep-2022 11:09                2922
gmagick.readimageblob.php                          30-Sep-2022 11:09                3360
gmagick.readimagefile.php                          30-Sep-2022 11:09                3335
gmagick.reducenoiseimage.php                       30-Sep-2022 11:09                3539
gmagick.removeimage.php                            30-Sep-2022 11:09                2765
gmagick.removeimageprofile.php                     30-Sep-2022 11:09                3020
gmagick.requirements.php                           30-Sep-2022 11:09                1845
gmagick.resampleimage.php                          30-Sep-2022 11:09                4254
gmagick.resizeimage.php                            30-Sep-2022 11:09                4483
gmagick.rollimage.php                              30-Sep-2022 11:09                3193
gmagick.rotateimage.php                            30-Sep-2022 11:09                3568
gmagick.scaleimage.php                             30-Sep-2022 11:09                3742
gmagick.separateimagechannel.php                   30-Sep-2022 11:09                3449
gmagick.setcompressionquality.php                  30-Sep-2022 11:09                4444
gmagick.setfilename.php                            30-Sep-2022 11:09                3125
gmagick.setimagebackgroundcolor.php                30-Sep-2022 11:09                3229
gmagick.setimageblueprimary.php                    30-Sep-2022 11:09                3532
gmagick.setimagebordercolor.php                    30-Sep-2022 11:09                3177
gmagick.setimagechanneldepth.php                   30-Sep-2022 11:09                3625
gmagick.setimagecolorspace.php                     30-Sep-2022 11:09                3333
gmagick.setimagecompose.php                        30-Sep-2022 11:09                3050
gmagick.setimagedelay.php                          30-Sep-2022 11:09                3055
gmagick.setimagedepth.php                          30-Sep-2022 11:09                3056
gmagick.setimagedispose.php                        30-Sep-2022 11:09                3096
gmagick.setimagefilename.php                       30-Sep-2022 11:09                3203
gmagick.setimageformat.php                         30-Sep-2022 11:09                3140
gmagick.setimagegamma.php                          30-Sep-2022 11:09                3027
gmagick.setimagegreenprimary.php                   30-Sep-2022 11:09                3512
gmagick.setimageindex.php                          30-Sep-2022 11:09                3209
gmagick.setimageinterlacescheme.php                30-Sep-2022 11:09                3424
gmagick.setimageiterations.php                     30-Sep-2022 11:09                3140
gmagick.setimageprofile.php                        30-Sep-2022 11:09                3614
gmagick.setimageredprimary.php                     30-Sep-2022 11:09                3430
gmagick.setimagerenderingintent.php                30-Sep-2022 11:09                3390
gmagick.setimageresolution.php                     30-Sep-2022 11:09                3342
gmagick.setimagescene.php                          30-Sep-2022 11:09                3028
gmagick.setimagetype.php                           30-Sep-2022 11:09                3157
gmagick.setimageunits.php                          30-Sep-2022 11:09                3233
gmagick.setimagewhitepoint.php                     30-Sep-2022 11:09                3446
gmagick.setsamplingfactors.php                     30-Sep-2022 11:09                3284
gmagick.setsize.php                                30-Sep-2022 11:09                3517
gmagick.setup.php                                  30-Sep-2022 11:09                1590
gmagick.shearimage.php                             30-Sep-2022 11:09                4450
gmagick.solarizeimage.php                          30-Sep-2022 11:09                3427
gmagick.spreadimage.php                            30-Sep-2022 11:09                3219
gmagick.stripimage.php                             30-Sep-2022 11:09                2801
gmagick.swirlimage.php                             30-Sep-2022 11:09                3365
gmagick.thumbnailimage.php                         30-Sep-2022 11:09                4172
gmagick.trimimage.php                              30-Sep-2022 11:09                3481
gmagick.write.php                                  30-Sep-2022 11:09                1737
gmagick.writeimage.php                             30-Sep-2022 11:09                3515
gmagickdraw.annotate.php                           30-Sep-2022 11:09                3207
gmagickdraw.arc.php                                30-Sep-2022 11:09                4417
gmagickdraw.bezier.php                             30-Sep-2022 11:09                2660
gmagickdraw.ellipse.php                            30-Sep-2022 11:09                4114
gmagickdraw.getfillcolor.php                       30-Sep-2022 11:09                2652
gmagickdraw.getfillopacity.php                     30-Sep-2022 11:09                2713
gmagickdraw.getfont.php                            30-Sep-2022 11:09                2637
gmagickdraw.getfontsize.php                        30-Sep-2022 11:09                2545
gmagickdraw.getfontstyle.php                       30-Sep-2022 11:09                2656
gmagickdraw.getfontweight.php                      30-Sep-2022 11:09                2575
gmagickdraw.getstrokecolor.php                     30-Sep-2022 11:09                2687
gmagickdraw.getstrokeopacity.php                   30-Sep-2022 11:09                2591
gmagickdraw.getstrokewidth.php                     30-Sep-2022 11:09                2648
gmagickdraw.gettextdecoration.php                  30-Sep-2022 11:09                2540
gmagickdraw.gettextencoding.php                    30-Sep-2022 11:09                2783
gmagickdraw.line.php                               30-Sep-2022 11:09                3605
gmagickdraw.point.php                              30-Sep-2022 11:09                2901
gmagickdraw.polygon.php                            30-Sep-2022 11:09                2842
gmagickdraw.polyline.php                           30-Sep-2022 11:09                2857
gmagickdraw.rectangle.php                          30-Sep-2022 11:09                3688
gmagickdraw.rotate.php                             30-Sep-2022 11:09                2785
gmagickdraw.roundrectangle.php                     30-Sep-2022 11:09                4488
gmagickdraw.scale.php                              30-Sep-2022 11:09                3216
gmagickdraw.setfillcolor.php                       30-Sep-2022 11:09                3294
gmagickdraw.setfillopacity.php                     30-Sep-2022 11:09                2994
gmagickdraw.setfont.php                            30-Sep-2022 11:09                2809
gmagickdraw.setfontsize.php                        30-Sep-2022 11:09                2832
gmagickdraw.setfontstyle.php                       30-Sep-2022 11:09                2984
gmagickdraw.setfontweight.php                      30-Sep-2022 11:09                2833
gmagickdraw.setstrokecolor.php                     30-Sep-2022 11:09                3192
gmagickdraw.setstrokeopacity.php                   30-Sep-2022 11:09                2915
gmagickdraw.setstrokewidth.php                     30-Sep-2022 11:09                2910
gmagickdraw.settextdecoration.php                  30-Sep-2022 11:09                2971
gmagickdraw.settextencoding.php                    30-Sep-2022 11:09                3499
gmagickpixel.construct.php                         30-Sep-2022 11:09                2625
gmagickpixel.getcolor.php                          30-Sep-2022 11:09                4078
gmagickpixel.getcolorcount.php                     30-Sep-2022 11:09                2828
gmagickpixel.getcolorvalue.php                     30-Sep-2022 11:09                3189
gmagickpixel.setcolor.php                          30-Sep-2022 11:09                3070
gmagickpixel.setcolorvalue.php                     30-Sep-2022 11:09                3679
gmp.configuration.php                              30-Sep-2022 11:09                1377
gmp.constants.php                                  30-Sep-2022 11:09                3431
gmp.examples.php                                   30-Sep-2022 11:09                3396
gmp.installation.php                               30-Sep-2022 11:09                1463
gmp.requirements.php                               30-Sep-2022 11:09                1885
gmp.serialize.php                                  30-Sep-2022 11:09                2440
gmp.setup.php                                      30-Sep-2022 11:09                1552
gmp.unserialize.php                                30-Sep-2022 11:09                2753
gnupg.configuration.php                            30-Sep-2022 11:09                1363
gnupg.constants.php                                30-Sep-2022 11:09                6425
gnupg.examples-clearsign.php                       30-Sep-2022 11:09                7454
gnupg.examples.php                                 30-Sep-2022 11:09                1471
gnupg.installation.php                             30-Sep-2022 11:09                1788
gnupg.requirements.php                             30-Sep-2022 11:09                1335
gnupg.resources.php                                30-Sep-2022 11:09                1311
gnupg.setup.php                                    30-Sep-2022 11:09                1650
hash.configuration.php                             30-Sep-2022 11:09                1358
hash.constants.php                                 30-Sep-2022 11:09                1906
hash.installation.php                              30-Sep-2022 11:09                1844
hash.requirements.php                              30-Sep-2022 11:09                1339
hash.resources.php                                 30-Sep-2022 11:09                1434
hash.setup.php                                     30-Sep-2022 11:09                1632
hashcontext.construct.php                          30-Sep-2022 11:09                2005
hashcontext.serialize.php                          30-Sep-2022 11:09                2586
hashcontext.unserialize.php                        30-Sep-2022 11:09                2884
history.php                                        30-Sep-2022 11:09                2413
history.php.books.php                              30-Sep-2022 11:09                3574
history.php.php                                    30-Sep-2022 11:09               16342
history.php.publications.php                       30-Sep-2022 11:09                2190
history.php.related.php                            30-Sep-2022 11:09                8749
hrtime-performancecounter.getfrequency.php         30-Sep-2022 11:09                2873
hrtime-performancecounter.getticks.php             30-Sep-2022 11:09                2656
hrtime-performancecounter.gettickssince.php        30-Sep-2022 11:09                2943
hrtime-stopwatch.getelapsedticks.php               30-Sep-2022 11:09                2651
hrtime-stopwatch.getelapsedtime.php                30-Sep-2022 11:09                2970
hrtime-stopwatch.getlastelapsedticks.php           30-Sep-2022 11:09                2692
hrtime-stopwatch.getlastelapsedtime.php            30-Sep-2022 11:09                3003
hrtime-stopwatch.isrunning.php                     30-Sep-2022 11:09                2587
hrtime-stopwatch.start.php                         30-Sep-2022 11:09                2582
hrtime-stopwatch.stop.php                          30-Sep-2022 11:09                2364
hrtime.example.basic.php                           30-Sep-2022 11:09                6249
hrtime.examples.php                                30-Sep-2022 11:09                1403
hrtime.installation.php                            30-Sep-2022 11:09                2236
hrtime.setup.php                                   30-Sep-2022 11:09                1398
ibase.configuration.php                            30-Sep-2022 11:09                8088
ibase.constants.php                                30-Sep-2022 11:09               20066
ibase.installation.php                             30-Sep-2022 11:09                4193
ibase.requirements.php                             30-Sep-2022 11:09                1258
ibase.resources.php                                30-Sep-2022 11:09                1311
ibase.setup.php                                    30-Sep-2022 11:09                1670
ibm-db2.configuration.php                          30-Sep-2022 11:09               10995
ibm-db2.constants.php                              30-Sep-2022 11:09                8698
ibm-db2.installation.php                           30-Sep-2022 11:09                4479
ibm-db2.requirements.php                           30-Sep-2022 11:09                3873
ibm-db2.resources.php                              30-Sep-2022 11:09                1441
ibm-db2.setup.php                                  30-Sep-2022 11:09                1681
iconv.configuration.php                            30-Sep-2022 11:09                5439
iconv.constants.php                                30-Sep-2022 11:09                3476
iconv.installation.php                             30-Sep-2022 11:09                1838
iconv.requirements.php                             30-Sep-2022 11:09                1622
iconv.resources.php                                30-Sep-2022 11:09                1311
iconv.setup.php                                    30-Sep-2022 11:09                1656
igbinary.configuration.php                         30-Sep-2022 11:09                3801
igbinary.installation.php                          30-Sep-2022 11:09                2256
igbinary.requirements.php                          30-Sep-2022 11:09                1279
igbinary.setup.php                                 30-Sep-2022 11:09                1597
image.configuration.php                            30-Sep-2022 11:09                3838
image.constants.php                                30-Sep-2022 11:09               45135
image.examples-png.php                             30-Sep-2022 11:09                5358
image.examples-watermark.php                       30-Sep-2022 11:09                7045
image.examples.merged-watermark.php                30-Sep-2022 11:09               10033
image.examples.php                                 30-Sep-2022 11:09                1774
image.installation.php                             30-Sep-2022 11:09                7252
image.requirements.php                             30-Sep-2022 11:09                4709
image.resources.php                                30-Sep-2022 11:09                2241
image.setup.php                                    30-Sep-2022 11:09                1653
imagick.adaptiveblurimage.php                      30-Sep-2022 11:09                7762
imagick.adaptiveresizeimage.php                    30-Sep-2022 11:09               10412
imagick.adaptivesharpenimage.php                   30-Sep-2022 11:09                7033
imagick.adaptivethresholdimage.php                 30-Sep-2022 11:09                6639
imagick.addimage.php                               30-Sep-2022 11:09                3133
imagick.addnoiseimage.php                          30-Sep-2022 11:09                5864
imagick.affinetransformimage.php                   30-Sep-2022 11:09                7186
imagick.animateimages.php                          30-Sep-2022 11:09                3314
imagick.annotateimage.php                          30-Sep-2022 11:09                9652
imagick.appendimages.php                           30-Sep-2022 11:09                7366
imagick.autolevelimage.php                         30-Sep-2022 11:09                4699
imagick.averageimages.php                          30-Sep-2022 11:09                3008
imagick.blackthresholdimage.php                    30-Sep-2022 11:09                5853
imagick.blueshiftimage.php                         30-Sep-2022 11:09                4635
imagick.blurimage.php                              30-Sep-2022 11:09                6186
imagick.borderimage.php                            30-Sep-2022 11:09                6324
imagick.brightnesscontrastimage.php                30-Sep-2022 11:09                5757
imagick.charcoalimage.php                          30-Sep-2022 11:09                5102
imagick.chopimage.php                              30-Sep-2022 11:09                7400
imagick.clampimage.php                             30-Sep-2022 11:09                2630
imagick.clear.php                                  30-Sep-2022 11:09                2317
imagick.clipimage.php                              30-Sep-2022 11:09                2638
imagick.clipimagepath.php                          30-Sep-2022 11:09                3366
imagick.clippathimage.php                          30-Sep-2022 11:09                3937
imagick.clone.php                                  30-Sep-2022 11:09                4568
imagick.clutimage.php                              30-Sep-2022 11:09                6595
imagick.coalesceimages.php                         30-Sep-2022 11:09                3385
imagick.colorfloodfillimage.php                    30-Sep-2022 11:09                6100
imagick.colorizeimage.php                          30-Sep-2022 11:09                7504
imagick.colormatriximage.php                       30-Sep-2022 11:09                9092
imagick.combineimages.php                          30-Sep-2022 11:09                3890
imagick.commentimage.php                           30-Sep-2022 11:09                5412
imagick.compareimagechannels.php                   30-Sep-2022 11:09                4280
imagick.compareimagelayers.php                     30-Sep-2022 11:09                6270
imagick.compareimages.php                          30-Sep-2022 11:09                6109
imagick.compositeimage.php                         30-Sep-2022 11:09                8763
imagick.configuration.php                          30-Sep-2022 11:09                4778
imagick.constants.php                              30-Sep-2022 11:09              116650
imagick.construct.php                              30-Sep-2022 11:09                2868
imagick.contrastimage.php                          30-Sep-2022 11:09                5501
imagick.contraststretchimage.php                   30-Sep-2022 11:09                4102
imagick.convolveimage.php                          30-Sep-2022 11:09                6432
imagick.count.php                                  30-Sep-2022 11:09                2924
imagick.cropimage.php                              30-Sep-2022 11:09                6287
imagick.cropthumbnailimage.php                     30-Sep-2022 11:09                3474
imagick.current.php                                30-Sep-2022 11:09                2744
imagick.cyclecolormapimage.php                     30-Sep-2022 11:09                3184
imagick.decipherimage.php                          30-Sep-2022 11:09                3420
imagick.deconstructimages.php                      30-Sep-2022 11:09                3012
imagick.deleteimageartifact.php                    30-Sep-2022 11:09                4034
imagick.deleteimageproperty.php                    30-Sep-2022 11:09                2587
imagick.deskewimage.php                            30-Sep-2022 11:09               12102
imagick.despeckleimage.php                         30-Sep-2022 11:09                4525
imagick.destroy.php                                30-Sep-2022 11:09                2464
imagick.displayimage.php                           30-Sep-2022 11:09                2811
imagick.displayimages.php                          30-Sep-2022 11:09                2940
imagick.distortimage.php                           30-Sep-2022 11:09               14344
imagick.drawimage.php                              30-Sep-2022 11:09                2754
imagick.edgeimage.php                              30-Sep-2022 11:09                4933
imagick.embossimage.php                            30-Sep-2022 11:09                5788
imagick.encipherimage.php                          30-Sep-2022 11:09                3396
imagick.enhanceimage.php                           30-Sep-2022 11:09                4520
imagick.equalizeimage.php                          30-Sep-2022 11:09                4461
imagick.evaluateimage.php                          30-Sep-2022 11:09                6603
imagick.examples-1.php                             30-Sep-2022 11:09               35518
imagick.examples.php                               30-Sep-2022 11:09                1445
imagick.exportimagepixels.php                      30-Sep-2022 11:09                8413
imagick.extentimage.php                            30-Sep-2022 11:09                5922
imagick.filter.php                                 30-Sep-2022 11:09                8269
imagick.flattenimages.php                          30-Sep-2022 11:09                3134
imagick.flipimage.php                              30-Sep-2022 11:09                4918
imagick.floodfillpaintimage.php                    30-Sep-2022 11:09               12866
imagick.flopimage.php                              30-Sep-2022 11:09                4952
imagick.forwardfouriertransformimage.php           30-Sep-2022 11:09               13498
imagick.frameimage.php                             30-Sep-2022 11:09                9136
imagick.functionimage.php                          30-Sep-2022 11:09               14555
imagick.fximage.php                                30-Sep-2022 11:09                6754
imagick.gammaimage.php                             30-Sep-2022 11:09                6374
imagick.gaussianblurimage.php                      30-Sep-2022 11:09                6813
imagick.getcolorspace.php                          30-Sep-2022 11:09                2628
imagick.getcompression.php                         30-Sep-2022 11:09                2330
imagick.getcompressionquality.php                  30-Sep-2022 11:09                2431
imagick.getcopyright.php                           30-Sep-2022 11:09                2439
imagick.getfilename.php                            30-Sep-2022 11:09                2622
imagick.getfont.php                                30-Sep-2022 11:09                3388
imagick.getformat.php                              30-Sep-2022 11:09                2493
imagick.getgravity.php                             30-Sep-2022 11:09                2632
imagick.gethomeurl.php                             30-Sep-2022 11:09                2363
imagick.getimage.php                               30-Sep-2022 11:09                2706
imagick.getimagealphachannel.php                   30-Sep-2022 11:09                3613
imagick.getimageartifact.php                       30-Sep-2022 11:09                3852
imagick.getimageattribute.php                      30-Sep-2022 11:09                2893
imagick.getimagebackgroundcolor.php                30-Sep-2022 11:09                2802
imagick.getimageblob.php                           30-Sep-2022 11:09                3055
imagick.getimageblueprimary.php                    30-Sep-2022 11:09                3118
imagick.getimagebordercolor.php                    30-Sep-2022 11:09                2775
imagick.getimagechanneldepth.php                   30-Sep-2022 11:09                3378
imagick.getimagechanneldistortion.php              30-Sep-2022 11:09                4405
imagick.getimagechanneldistortions.php             30-Sep-2022 11:09                4875
imagick.getimagechannelextrema.php                 30-Sep-2022 11:09                4082
imagick.getimagechannelkurtosis.php                30-Sep-2022 11:09                3898
imagick.getimagechannelmean.php                    30-Sep-2022 11:09                3591
imagick.getimagechannelrange.php                   30-Sep-2022 11:09                3796
imagick.getimagechannelstatistics.php              30-Sep-2022 11:09                2763
imagick.getimageclipmask.php                       30-Sep-2022 11:09                3400
imagick.getimagecolormapcolor.php                  30-Sep-2022 11:09                3061
imagick.getimagecolors.php                         30-Sep-2022 11:09                2529
imagick.getimagecolorspace.php                     30-Sep-2022 11:09                2590
imagick.getimagecompose.php                        30-Sep-2022 11:09                2493
imagick.getimagecompression.php                    30-Sep-2022 11:09                2460
imagick.getimagecompressionquality.php             30-Sep-2022 11:09                2566
imagick.getimagedelay.php                          30-Sep-2022 11:09                2586
imagick.getimagedepth.php                          30-Sep-2022 11:09                2295
imagick.getimagedispose.php                        30-Sep-2022 11:09                2681
imagick.getimagedistortion.php                     30-Sep-2022 11:09                3566
imagick.getimageextrema.php                        30-Sep-2022 11:09                3138
imagick.getimagefilename.php                       30-Sep-2022 11:09                2753
imagick.getimageformat.php                         30-Sep-2022 11:09                2785
imagick.getimagegamma.php                          30-Sep-2022 11:09                2608
imagick.getimagegeometry.php                       30-Sep-2022 11:09                4413
imagick.getimagegravity.php                        30-Sep-2022 11:09                3025
imagick.getimagegreenprimary.php                   30-Sep-2022 11:09                2984
imagick.getimageheight.php                         30-Sep-2022 11:09                2601
imagick.getimagehistogram.php                      30-Sep-2022 11:09               20151
imagick.getimageindex.php                          30-Sep-2022 11:09                3296
imagick.getimageinterlacescheme.php                30-Sep-2022 11:09                2723
imagick.getimageinterpolatemethod.php              30-Sep-2022 11:09                2939
imagick.getimageiterations.php                     30-Sep-2022 11:09                2681
imagick.getimagelength.php                         30-Sep-2022 11:09                3647
imagick.getimagematte.php                          30-Sep-2022 11:09                3049
imagick.getimagemattecolor.php                     30-Sep-2022 11:09                3111
imagick.getimagemimetype.php                       30-Sep-2022 11:09                2313
imagick.getimageorientation.php                    30-Sep-2022 11:09                2853
imagick.getimagepage.php                           30-Sep-2022 11:09                2881
imagick.getimagepixelcolor.php                     30-Sep-2022 11:09                3236
imagick.getimageprofile.php                        30-Sep-2022 11:09                2924
imagick.getimageprofiles.php                       30-Sep-2022 11:09                3707
imagick.getimageproperties.php                     30-Sep-2022 11:09                6092
imagick.getimageproperty.php                       30-Sep-2022 11:09                5317
imagick.getimageredprimary.php                     30-Sep-2022 11:09                3015
imagick.getimageregion.php                         30-Sep-2022 11:09                4079
imagick.getimagerenderingintent.php                30-Sep-2022 11:09                2835
imagick.getimageresolution.php                     30-Sep-2022 11:09                2676
imagick.getimagesblob.php                          30-Sep-2022 11:09                3022
imagick.getimagescene.php                          30-Sep-2022 11:09                2550
imagick.getimagesignature.php                      30-Sep-2022 11:09                2636
imagick.getimagesize.php                           30-Sep-2022 11:09                2930
imagick.getimagetickspersecond.php                 30-Sep-2022 11:09                2799
imagick.getimagetotalinkdensity.php                30-Sep-2022 11:09                2676
imagick.getimagetype.php                           30-Sep-2022 11:09                4205
imagick.getimageunits.php                          30-Sep-2022 11:09                2702
imagick.getimagevirtualpixelmethod.php             30-Sep-2022 11:09                2853
imagick.getimagewhitepoint.php                     30-Sep-2022 11:09                2862
imagick.getimagewidth.php                          30-Sep-2022 11:09                2588
imagick.getinterlacescheme.php                     30-Sep-2022 11:09                2707
imagick.getiteratorindex.php                       30-Sep-2022 11:09                6685
imagick.getnumberimages.php                        30-Sep-2022 11:09                2710
imagick.getoption.php                              30-Sep-2022 11:09                2886
imagick.getpackagename.php                         30-Sep-2022 11:09                2596
imagick.getpage.php                                30-Sep-2022 11:09                2742
imagick.getpixeliterator.php                       30-Sep-2022 11:09                7234
imagick.getpixelregioniterator.php                 30-Sep-2022 11:09                7149
imagick.getpointsize.php                           30-Sep-2022 11:09                2937
imagick.getquantum.php                             30-Sep-2022 11:09                2318
imagick.getquantumdepth.php                        30-Sep-2022 11:09                2691
imagick.getquantumrange.php                        30-Sep-2022 11:09                2966
imagick.getregistry.php                            30-Sep-2022 11:09                2516
imagick.getreleasedate.php                         30-Sep-2022 11:09                2639
imagick.getresource.php                            30-Sep-2022 11:09                3119
imagick.getresourcelimit.php                       30-Sep-2022 11:09                3538
imagick.getsamplingfactors.php                     30-Sep-2022 11:09                2823
imagick.getsize.php                                30-Sep-2022 11:09                6378
imagick.getsizeoffset.php                          30-Sep-2022 11:09                2762
imagick.getversion.php                             30-Sep-2022 11:09                2600
imagick.haldclutimage.php                          30-Sep-2022 11:09                6618
imagick.hasnextimage.php                           30-Sep-2022 11:09                2717
imagick.haspreviousimage.php                       30-Sep-2022 11:09                2816
imagick.identifyformat.php                         30-Sep-2022 11:09                5052
imagick.identifyimage.php                          30-Sep-2022 11:09                4243
imagick.implodeimage.php                           30-Sep-2022 11:09                4891
imagick.importimagepixels.php                      30-Sep-2022 11:09               12861
imagick.installation.php                           30-Sep-2022 11:09                3689
imagick.inversefouriertransformimage.php           30-Sep-2022 11:09                4002
imagick.labelimage.php                             30-Sep-2022 11:09                2579
imagick.levelimage.php                             30-Sep-2022 11:09                8644
imagick.linearstretchimage.php                     30-Sep-2022 11:09                5904
imagick.liquidrescaleimage.php                     30-Sep-2022 11:09                4708
imagick.listregistry.php                           30-Sep-2022 11:09                2431
imagick.magnifyimage.php                           30-Sep-2022 11:09                4534
imagick.mapimage.php                               30-Sep-2022 11:09                3341
imagick.mattefloodfillimage.php                    30-Sep-2022 11:09                6253
imagick.medianfilterimage.php                      30-Sep-2022 11:09                5512
imagick.mergeimagelayers.php                       30-Sep-2022 11:09                7174
imagick.minifyimage.php                            30-Sep-2022 11:09                2515
imagick.modulateimage.php                          30-Sep-2022 11:09                5883
imagick.montageimage.php                           30-Sep-2022 11:09                5010
imagick.morphimages.php                            30-Sep-2022 11:09                3105
imagick.morphology.php                             30-Sep-2022 11:09               70768
imagick.mosaicimages.php                           30-Sep-2022 11:09                3143
imagick.motionblurimage.php                        30-Sep-2022 11:09                7443
imagick.negateimage.php                            30-Sep-2022 11:09                6127
imagick.newimage.php                               30-Sep-2022 11:09                6699
imagick.newpseudoimage.php                         30-Sep-2022 11:09                6080
imagick.nextimage.php                              30-Sep-2022 11:09                2400
imagick.normalizeimage.php                         30-Sep-2022 11:09                6971
imagick.oilpaintimage.php                          30-Sep-2022 11:09                4876
imagick.opaquepaintimage.php                       30-Sep-2022 11:09                5428
imagick.optimizeimagelayers.php                    30-Sep-2022 11:09                6235
imagick.orderedposterizeimage.php                  30-Sep-2022 11:09                7516
imagick.paintfloodfillimage.php                    30-Sep-2022 11:09                6260
imagick.paintopaqueimage.php                       30-Sep-2022 11:09                6157
imagick.painttransparentimage.php                  30-Sep-2022 11:09                5139
imagick.pingimage.php                              30-Sep-2022 11:09                2824
imagick.pingimageblob.php                          30-Sep-2022 11:09                6749
imagick.pingimagefile.php                          30-Sep-2022 11:09                6549
imagick.polaroidimage.php                          30-Sep-2022 11:09                4945
imagick.posterizeimage.php                         30-Sep-2022 11:09                5842
imagick.previewimages.php                          30-Sep-2022 11:09                3444
imagick.previousimage.php                          30-Sep-2022 11:09                2456
imagick.profileimage.php                           30-Sep-2022 11:09                3313
imagick.quantizeimage.php                          30-Sep-2022 11:09                6696
imagick.quantizeimages.php                         30-Sep-2022 11:09                3819
imagick.queryfontmetrics.php                       30-Sep-2022 11:09                6165
imagick.queryfonts.php                             30-Sep-2022 11:09                5249
imagick.queryformats.php                           30-Sep-2022 11:09                8484
imagick.radialblurimage.php                        30-Sep-2022 11:09                5840
imagick.raiseimage.php                             30-Sep-2022 11:09                6627
imagick.randomthresholdimage.php                   30-Sep-2022 11:09                7133
imagick.readimage.php                              30-Sep-2022 11:09                2515
imagick.readimageblob.php                          30-Sep-2022 11:09                5694
imagick.readimagefile.php                          30-Sep-2022 11:09                3167
imagick.readimages.php                             30-Sep-2022 11:09                2619
imagick.recolorimage.php                           30-Sep-2022 11:09                7200
imagick.reducenoiseimage.php                       30-Sep-2022 11:09                5626
imagick.remapimage.php                             30-Sep-2022 11:09                3656
imagick.removeimage.php                            30-Sep-2022 11:09                2624
imagick.removeimageprofile.php                     30-Sep-2022 11:09                2916
imagick.render.php                                 30-Sep-2022 11:09                2348
imagick.requirements.php                           30-Sep-2022 11:09                1776
imagick.resampleimage.php                          30-Sep-2022 11:09                5668
imagick.resetimagepage.php                         30-Sep-2022 11:09                2879
imagick.resizeimage.php                            30-Sep-2022 11:09               12993
imagick.resources.php                              30-Sep-2022 11:09                1325
imagick.rollimage.php                              30-Sep-2022 11:09                4963
imagick.rotateimage.php                            30-Sep-2022 11:09                6257
imagick.rotationalblurimage.php                    30-Sep-2022 11:09                6065
imagick.roundcorners.php                           30-Sep-2022 11:09                6980
imagick.sampleimage.php                            30-Sep-2022 11:09                3071
imagick.scaleimage.php                             30-Sep-2022 11:09                7509
imagick.segmentimage.php                           30-Sep-2022 11:09                7011
imagick.selectiveblurimage.php                     30-Sep-2022 11:09                6845
imagick.separateimagechannel.php                   30-Sep-2022 11:09                5829
imagick.sepiatoneimage.php                         30-Sep-2022 11:09                5259
imagick.setbackgroundcolor.php                     30-Sep-2022 11:09                3531
imagick.setcolorspace.php                          30-Sep-2022 11:09                3155
imagick.setcompression.php                         30-Sep-2022 11:09                2775
imagick.setcompressionquality.php                  30-Sep-2022 11:09                7698
imagick.setfilename.php                            30-Sep-2022 11:09                2671
imagick.setfirstiterator.php                       30-Sep-2022 11:09                2450
imagick.setfont.php                                30-Sep-2022 11:09                6269
imagick.setformat.php                              30-Sep-2022 11:09                2501
imagick.setgravity.php                             30-Sep-2022 11:09                2889
imagick.setimage.php                               30-Sep-2022 11:09                5056
imagick.setimagealphachannel.php                   30-Sep-2022 11:09                3917
imagick.setimageartifact.php                       30-Sep-2022 11:09                7907
imagick.setimageattribute.php                      30-Sep-2022 11:09                3412
imagick.setimagebackgroundcolor.php                30-Sep-2022 11:09                3810
imagick.setimagebias.php                           30-Sep-2022 11:09                7503
imagick.setimagebiasquantum.php                    30-Sep-2022 11:09                3074
imagick.setimageblueprimary.php                    30-Sep-2022 11:09                3198
imagick.setimagebordercolor.php                    30-Sep-2022 11:09                3773
imagick.setimagechanneldepth.php                   30-Sep-2022 11:09                3201
imagick.setimageclipmask.php                       30-Sep-2022 11:09                9776
imagick.setimagecolormapcolor.php                  30-Sep-2022 11:09                3268
imagick.setimagecolorspace.php                     30-Sep-2022 11:09                3480
imagick.setimagecompose.php                        30-Sep-2022 11:09                3076
imagick.setimagecompression.php                    30-Sep-2022 11:09                2916
imagick.setimagecompressionquality.php             30-Sep-2022 11:09                5147
imagick.setimagedelay.php                          30-Sep-2022 11:09                7089
imagick.setimagedepth.php                          30-Sep-2022 11:09                2804
imagick.setimagedispose.php                        30-Sep-2022 11:09                2854
imagick.setimageextent.php                         30-Sep-2022 11:09                3091
imagick.setimagefilename.php                       30-Sep-2022 11:09                2938
imagick.setimageformat.php                         30-Sep-2022 11:09                2854
imagick.setimagegamma.php                          30-Sep-2022 11:09                2800
imagick.setimagegravity.php                        30-Sep-2022 11:09                3183
imagick.setimagegreenprimary.php                   30-Sep-2022 11:09                3193
imagick.setimageindex.php                          30-Sep-2022 11:09                3570
imagick.setimageinterlacescheme.php                30-Sep-2022 11:09                2952
imagick.setimageinterpolatemethod.php              30-Sep-2022 11:09                2920
imagick.setimageiterations.php                     30-Sep-2022 11:09                5297
imagick.setimagematte.php                          30-Sep-2022 11:09                2856
imagick.setimagemattecolor.php                     30-Sep-2022 11:09                4108
imagick.setimageopacity.php                        30-Sep-2022 11:09                5695
imagick.setimageorientation.php                    30-Sep-2022 11:09                4935
imagick.setimagepage.php                           30-Sep-2022 11:09                3612
imagick.setimageprofile.php                        30-Sep-2022 11:09                3392
imagick.setimageproperty.php                       30-Sep-2022 11:09                5378
imagick.setimageredprimary.php                     30-Sep-2022 11:09                3189
imagick.setimagerenderingintent.php                30-Sep-2022 11:09                2998
imagick.setimageresolution.php                     30-Sep-2022 11:09                5165
imagick.setimagescene.php                          30-Sep-2022 11:09                2820
imagick.setimagetickspersecond.php                 30-Sep-2022 11:09                9337
imagick.setimagetype.php                           30-Sep-2022 11:09                2560
imagick.setimageunits.php                          30-Sep-2022 11:09                2662
imagick.setimagevirtualpixelmethod.php             30-Sep-2022 11:09                2726
imagick.setimagewhitepoint.php                     30-Sep-2022 11:09                3153
imagick.setinterlacescheme.php                     30-Sep-2022 11:09                2642
imagick.setiteratorindex.php                       30-Sep-2022 11:09                6730
imagick.setlastiterator.php                        30-Sep-2022 11:09                2470
imagick.setoption.php                              30-Sep-2022 11:09               13100
imagick.setpage.php                                30-Sep-2022 11:09                3295
imagick.setpointsize.php                           30-Sep-2022 11:09                5738
imagick.setprogressmonitor.php                     30-Sep-2022 11:09               13669
imagick.setregistry.php                            30-Sep-2022 11:09                3036
imagick.setresolution.php                          30-Sep-2022 11:09                3960
imagick.setresourcelimit.php                       30-Sep-2022 11:09                3784
imagick.setsamplingfactors.php                     30-Sep-2022 11:09                7321
imagick.setsize.php                                30-Sep-2022 11:09                2898
imagick.setsizeoffset.php                          30-Sep-2022 11:09                3467
imagick.settype.php                                30-Sep-2022 11:09                2520
imagick.setup.php                                  30-Sep-2022 11:09                1676
imagick.shadeimage.php                             30-Sep-2022 11:09                6070
imagick.shadowimage.php                            30-Sep-2022 11:09                5425
imagick.sharpenimage.php                           30-Sep-2022 11:09                5884
imagick.shaveimage.php                             30-Sep-2022 11:09                4951
imagick.shearimage.php                             30-Sep-2022 11:09                7037
imagick.sigmoidalcontrastimage.php                 30-Sep-2022 11:09                8949
imagick.sketchimage.php                            30-Sep-2022 11:09                6324
imagick.smushimages.php                            30-Sep-2022 11:09                6097
imagick.solarizeimage.php                          30-Sep-2022 11:09                5179
imagick.sparsecolorimage.php                       30-Sep-2022 11:09               31964
imagick.spliceimage.php                            30-Sep-2022 11:09                5831
imagick.spreadimage.php                            30-Sep-2022 11:09                4931
imagick.statisticimage.php                         30-Sep-2022 11:09                6891
imagick.steganoimage.php                           30-Sep-2022 11:09                3246
imagick.stereoimage.php                            30-Sep-2022 11:09                3004
imagick.stripimage.php                             30-Sep-2022 11:09                2631
imagick.subimagematch.php                          30-Sep-2022 11:09                8339
imagick.swirlimage.php                             30-Sep-2022 11:09                5061
imagick.textureimage.php                           30-Sep-2022 11:09                6800
imagick.thresholdimage.php                         30-Sep-2022 11:09                5510
imagick.thumbnailimage.php                         30-Sep-2022 11:09                8166
imagick.tintimage.php                              30-Sep-2022 11:09                8603
imagick.tostring.php                               30-Sep-2022 11:09                3523
imagick.transformimage.php                         30-Sep-2022 11:09                6712
imagick.transformimagecolorspace.php               30-Sep-2022 11:09                6412
imagick.transparentpaintimage.php                  30-Sep-2022 11:09                7967
imagick.transposeimage.php                         30-Sep-2022 11:09                5023
imagick.transverseimage.php                        30-Sep-2022 11:09                5007
imagick.trimimage.php                              30-Sep-2022 11:09                6574
imagick.uniqueimagecolors.php                      30-Sep-2022 11:09                5954
imagick.unsharpmaskimage.php                       30-Sep-2022 11:09                6929
imagick.valid.php                                  30-Sep-2022 11:09                2354
imagick.vignetteimage.php                          30-Sep-2022 11:09                6853
imagick.waveimage.php                              30-Sep-2022 11:09                6841
imagick.whitethresholdimage.php                    30-Sep-2022 11:09                5664
imagick.writeimage.php                             30-Sep-2022 11:09                3303
imagick.writeimagefile.php                         30-Sep-2022 11:09                4084
imagick.writeimages.php                            30-Sep-2022 11:09                2882
imagick.writeimagesfile.php                        30-Sep-2022 11:09                4287
imagickdraw.affine.php                             30-Sep-2022 11:09               19388
imagickdraw.annotation.php                         30-Sep-2022 11:09                3448
imagickdraw.arc.php                                30-Sep-2022 11:09               10667
imagickdraw.bezier.php                             30-Sep-2022 11:09               20069
imagickdraw.circle.php                             30-Sep-2022 11:09                9650
imagickdraw.clear.php                              30-Sep-2022 11:09                2552
imagickdraw.clone.php                              30-Sep-2022 11:09                2671
imagickdraw.color.php                              30-Sep-2022 11:09                3668
imagickdraw.comment.php                            30-Sep-2022 11:09                2953
imagickdraw.composite.php                          30-Sep-2022 11:09               13002
imagickdraw.construct.php                          30-Sep-2022 11:09                2465
imagickdraw.destroy.php                            30-Sep-2022 11:09                2538
imagickdraw.ellipse.php                            30-Sep-2022 11:09               12805
imagickdraw.getclippath.php                        30-Sep-2022 11:09                2660
imagickdraw.getcliprule.php                        30-Sep-2022 11:09                2726
imagickdraw.getclipunits.php                       30-Sep-2022 11:09                2591
imagickdraw.getfillcolor.php                       30-Sep-2022 11:09                2644
imagickdraw.getfillopacity.php                     30-Sep-2022 11:09                2647
imagickdraw.getfillrule.php                        30-Sep-2022 11:09                2597
imagickdraw.getfont.php                            30-Sep-2022 11:09                2534
imagickdraw.getfontfamily.php                      30-Sep-2022 11:09                2607
imagickdraw.getfontsize.php                        30-Sep-2022 11:09                2617
imagickdraw.getfontstretch.php                     30-Sep-2022 11:09                2388
imagickdraw.getfontstyle.php                       30-Sep-2022 11:09                2784
imagickdraw.getfontweight.php                      30-Sep-2022 11:09                2614
imagickdraw.getgravity.php                         30-Sep-2022 11:09                2766
imagickdraw.getstrokeantialias.php                 30-Sep-2022 11:09                3095
imagickdraw.getstrokecolor.php                     30-Sep-2022 11:09                3087
imagickdraw.getstrokedasharray.php                 30-Sep-2022 11:09                2882
imagickdraw.getstrokedashoffset.php                30-Sep-2022 11:09                2749
imagickdraw.getstrokelinecap.php                   30-Sep-2022 11:09                2940
imagickdraw.getstrokelinejoin.php                  30-Sep-2022 11:09                2954
imagickdraw.getstrokemiterlimit.php                30-Sep-2022 11:09                3059
imagickdraw.getstrokeopacity.php                   30-Sep-2022 11:09                2676
imagickdraw.getstrokewidth.php                     30-Sep-2022 11:09                2711
imagickdraw.gettextalignment.php                   30-Sep-2022 11:09                2725
imagickdraw.gettextantialias.php                   30-Sep-2022 11:09                2822
imagickdraw.gettextdecoration.php                  30-Sep-2022 11:09                2734
imagickdraw.gettextencoding.php                    30-Sep-2022 11:09                2773
imagickdraw.gettextinterlinespacing.php            30-Sep-2022 11:09                2475
imagickdraw.gettextinterwordspacing.php            30-Sep-2022 11:09                2495
imagickdraw.gettextkerning.php                     30-Sep-2022 11:09                2418
imagickdraw.gettextundercolor.php                  30-Sep-2022 11:09                2763
imagickdraw.getvectorgraphics.php                  30-Sep-2022 11:09                2849
imagickdraw.line.php                               30-Sep-2022 11:09                8863
imagickdraw.matte.php                              30-Sep-2022 11:09                8793
imagickdraw.pathclose.php                          30-Sep-2022 11:09                2808
imagickdraw.pathcurvetoabsolute.php                30-Sep-2022 11:09                5211
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-Sep-2022 11:09               13205
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-Sep-2022 11:09                4548
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-Sep-2022 11:09               11880
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-Sep-2022 11:09               12155
imagickdraw.pathcurvetorelative.php                30-Sep-2022 11:09                5266
imagickdraw.pathcurvetosmoothabsolute.php          30-Sep-2022 11:09                5167
imagickdraw.pathcurvetosmoothrelative.php          30-Sep-2022 11:09                5181
imagickdraw.pathellipticarcabsolute.php            30-Sep-2022 11:09                6018
imagickdraw.pathellipticarcrelative.php            30-Sep-2022 11:09                5994
imagickdraw.pathfinish.php                         30-Sep-2022 11:09                2453
imagickdraw.pathlinetoabsolute.php                 30-Sep-2022 11:09                3437
imagickdraw.pathlinetohorizontalabsolute.php       30-Sep-2022 11:09                3327
imagickdraw.pathlinetohorizontalrelative.php       30-Sep-2022 11:09                3333
imagickdraw.pathlinetorelative.php                 30-Sep-2022 11:09                3493
imagickdraw.pathlinetoverticalabsolute.php         30-Sep-2022 11:09                3295
imagickdraw.pathlinetoverticalrelative.php         30-Sep-2022 11:09                3301
imagickdraw.pathmovetoabsolute.php                 30-Sep-2022 11:09                3531
imagickdraw.pathmovetorelative.php                 30-Sep-2022 11:09                3473
imagickdraw.pathstart.php                          30-Sep-2022 11:09               12896
imagickdraw.point.php                              30-Sep-2022 11:09                7402
imagickdraw.polygon.php                            30-Sep-2022 11:09                9927
imagickdraw.polyline.php                           30-Sep-2022 11:09                9911
imagickdraw.pop.php                                30-Sep-2022 11:09                3201
imagickdraw.popclippath.php                        30-Sep-2022 11:09                2496
imagickdraw.popdefs.php                            30-Sep-2022 11:09                8407
imagickdraw.poppattern.php                         30-Sep-2022 11:09                2542
imagickdraw.push.php                               30-Sep-2022 11:09                9338
imagickdraw.pushclippath.php                       30-Sep-2022 11:09                3297
imagickdraw.pushdefs.php                           30-Sep-2022 11:09                2977
imagickdraw.pushpattern.php                        30-Sep-2022 11:09               16034
imagickdraw.rectangle.php                          30-Sep-2022 11:09                9166
imagickdraw.render.php                             30-Sep-2022 11:09                2656
imagickdraw.resetvectorgraphics.php                30-Sep-2022 11:09                2454
imagickdraw.rotate.php                             30-Sep-2022 11:09                8418
imagickdraw.roundrectangle.php                     30-Sep-2022 11:09                9999
imagickdraw.scale.php                              30-Sep-2022 11:09                8911
imagickdraw.setclippath.php                        30-Sep-2022 11:09                9272
imagickdraw.setcliprule.php                        30-Sep-2022 11:09               10393
imagickdraw.setclipunits.php                       30-Sep-2022 11:09                9695
imagickdraw.setfillalpha.php                       30-Sep-2022 11:09                8546
imagickdraw.setfillcolor.php                       30-Sep-2022 11:09                8596
imagickdraw.setfillopacity.php                     30-Sep-2022 11:09                8605
imagickdraw.setfillpatternurl.php                  30-Sep-2022 11:09                3729
imagickdraw.setfillrule.php                        30-Sep-2022 11:09               15266
imagickdraw.setfont.php                            30-Sep-2022 11:09               10020
imagickdraw.setfontfamily.php                      30-Sep-2022 11:09               10743
imagickdraw.setfontsize.php                        30-Sep-2022 11:09                9133
imagickdraw.setfontstretch.php                     30-Sep-2022 11:09               10939
imagickdraw.setfontstyle.php                       30-Sep-2022 11:09                9792
imagickdraw.setfontweight.php                      30-Sep-2022 11:09                9852
imagickdraw.setgravity.php                         30-Sep-2022 11:09               11839
imagickdraw.setresolution.php                      30-Sep-2022 11:09                2800
imagickdraw.setstrokealpha.php                     30-Sep-2022 11:09                9130
imagickdraw.setstrokeantialias.php                 30-Sep-2022 11:09                9862
imagickdraw.setstrokecolor.php                     30-Sep-2022 11:09                9271
imagickdraw.setstrokedasharray.php                 30-Sep-2022 11:09               14737
imagickdraw.setstrokedashoffset.php                30-Sep-2022 11:09               10813
imagickdraw.setstrokelinecap.php                   30-Sep-2022 11:09                9505
imagickdraw.setstrokelinejoin.php                  30-Sep-2022 11:09               13034
imagickdraw.setstrokemiterlimit.php                30-Sep-2022 11:09               12647
imagickdraw.setstrokeopacity.php                   30-Sep-2022 11:09               11094
imagickdraw.setstrokepatternurl.php                30-Sep-2022 11:09                3147
imagickdraw.setstrokewidth.php                     30-Sep-2022 11:09                9221
imagickdraw.settextalignment.php                   30-Sep-2022 11:09               10205
imagickdraw.settextantialias.php                   30-Sep-2022 11:09                9615
imagickdraw.settextdecoration.php                  30-Sep-2022 11:09                8080
imagickdraw.settextencoding.php                    30-Sep-2022 11:09                3699
imagickdraw.settextinterlinespacing.php            30-Sep-2022 11:09                3063
imagickdraw.settextinterwordspacing.php            30-Sep-2022 11:09                2760
imagickdraw.settextkerning.php                     30-Sep-2022 11:09                2997
imagickdraw.settextundercolor.php                  30-Sep-2022 11:09                8489
imagickdraw.setvectorgraphics.php                  30-Sep-2022 11:09               10253
imagickdraw.setviewbox.php                         30-Sep-2022 11:09               11785
imagickdraw.skewx.php                              30-Sep-2022 11:09                8868
imagickdraw.skewy.php                              30-Sep-2022 11:09                8853
imagickdraw.translate.php                          30-Sep-2022 11:09                9236
imagickkernel.addkernel.php                        30-Sep-2022 11:09                7843
imagickkernel.addunitykernel.php                   30-Sep-2022 11:09               16375
imagickkernel.frombuiltin.php                      30-Sep-2022 11:09               29768
imagickkernel.frommatrix.php                       30-Sep-2022 11:09               26695
imagickkernel.getmatrix.php                        30-Sep-2022 11:09                8546
imagickkernel.scale.php                            30-Sep-2022 11:09               15448
imagickkernel.separate.php                         30-Sep-2022 11:09               11798
imagickpixel.clear.php                             30-Sep-2022 11:09                2555
imagickpixel.construct.php                         30-Sep-2022 11:09               14297
imagickpixel.destroy.php                           30-Sep-2022 11:09                2675
imagickpixel.getcolor.php                          30-Sep-2022 11:09                8581
imagickpixel.getcolorasstring.php                  30-Sep-2022 11:09                5150
imagickpixel.getcolorcount.php                     30-Sep-2022 11:09                5406
imagickpixel.getcolorquantum.php                   30-Sep-2022 11:09                3161
imagickpixel.getcolorvalue.php                     30-Sep-2022 11:09                9574
imagickpixel.getcolorvaluequantum.php              30-Sep-2022 11:09                6984
imagickpixel.gethsl.php                            30-Sep-2022 11:09                4726
imagickpixel.getindex.php                          30-Sep-2022 11:09                2284
imagickpixel.ispixelsimilar.php                    30-Sep-2022 11:09                3943
imagickpixel.ispixelsimilarquantum.php             30-Sep-2022 11:09                3263
imagickpixel.issimilar.php                         30-Sep-2022 11:09               23520
imagickpixel.setcolor.php                          30-Sep-2022 11:09                8071
imagickpixel.setcolorcount.php                     30-Sep-2022 11:09                2604
imagickpixel.setcolorvalue.php                     30-Sep-2022 11:09                5414
imagickpixel.setcolorvaluequantum.php              30-Sep-2022 11:09                9032
imagickpixel.sethsl.php                            30-Sep-2022 11:09                8167
imagickpixel.setindex.php                          30-Sep-2022 11:09                2543
imagickpixeliterator.clear.php                     30-Sep-2022 11:09                7596
imagickpixeliterator.construct.php                 30-Sep-2022 11:09                7295
imagickpixeliterator.destroy.php                   30-Sep-2022 11:09                2626
imagickpixeliterator.getcurrentiteratorrow.php     30-Sep-2022 11:09                2848
imagickpixeliterator.getiteratorrow.php            30-Sep-2022 11:09                2814
imagickpixeliterator.getnextiteratorrow.php        30-Sep-2022 11:09                8515
imagickpixeliterator.getpreviousiteratorrow.php    30-Sep-2022 11:09                2939
imagickpixeliterator.newpixeliterator.php          30-Sep-2022 11:09                2923
imagickpixeliterator.newpixelregioniterator.php    30-Sep-2022 11:09                4378
imagickpixeliterator.resetiterator.php             30-Sep-2022 11:09               11133
imagickpixeliterator.setiteratorfirstrow.php       30-Sep-2022 11:09                2798
imagickpixeliterator.setiteratorlastrow.php        30-Sep-2022 11:09                2805
imagickpixeliterator.setiteratorrow.php            30-Sep-2022 11:09                8312
imagickpixeliterator.synciterator.php              30-Sep-2022 11:09                2602
imap.configuration.php                             30-Sep-2022 11:09                3702
imap.constants.php                                 30-Sep-2022 11:09               20344
imap.installation.php                              30-Sep-2022 11:09                3346
imap.requirements.php                              30-Sep-2022 11:09                3769
imap.resources.php                                 30-Sep-2022 11:09                1475
imap.setup.php                                     30-Sep-2022 11:09                1643
index.php                                          30-Sep-2022 11:09               18134
indexes.examples.php                               30-Sep-2022 11:09              892083
indexes.functions.php                              30-Sep-2022 11:09             1465834
indexes.php                                        30-Sep-2022 11:09                1493
infiniteiterator.construct.php                     30-Sep-2022 11:09                5410
infiniteiterator.next.php                          30-Sep-2022 11:09                3627
info.configuration.php                             30-Sep-2022 11:08               22069
info.constants.php                                 30-Sep-2022 11:08               18578
info.installation.php                              30-Sep-2022 11:08                1360
info.requirements.php                              30-Sep-2022 11:08                1251
info.resources.php                                 30-Sep-2022 11:08                1304
info.setup.php                                     30-Sep-2022 11:08                1652
ini.core.php                                       30-Sep-2022 11:09               82695
ini.list.php                                       30-Sep-2022 11:09               89957
ini.php                                            30-Sep-2022 11:09                1625
ini.sections.php                                   30-Sep-2022 11:09                4760
inotify.configuration.php                          30-Sep-2022 11:09                1396
inotify.constants.php                              30-Sep-2022 11:09                9397
inotify.install.php                                30-Sep-2022 11:09                2020
inotify.requirements.php                           30-Sep-2022 11:09                1335
inotify.resources.php                              30-Sep-2022 11:09                1426
inotify.setup.php                                  30-Sep-2022 11:09                1688
install.cloud.azure.php                            30-Sep-2022 11:08                5091
install.cloud.ec2.php                              30-Sep-2022 11:08                1482
install.cloud.php                                  30-Sep-2022 11:08                1690
install.fpm.configuration.php                      30-Sep-2022 11:08               41896
install.fpm.install.php                            30-Sep-2022 11:08                3598
install.fpm.php                                    30-Sep-2022 11:08                4783
install.general.php                                30-Sep-2022 11:08                5882
install.macosx.bundled.php                         30-Sep-2022 11:08               13415
install.macosx.compile.php                         30-Sep-2022 11:08                1441
install.macosx.packages.php                        30-Sep-2022 11:08                3616
install.macosx.php                                 30-Sep-2022 11:08                2182
install.pecl.downloads.php                         30-Sep-2022 11:08                4208
install.pecl.intro.php                             30-Sep-2022 11:08                3935
install.pecl.pear.php                              30-Sep-2022 11:08                3619
install.pecl.php                                   30-Sep-2022 11:08                2111
install.pecl.php-config.php                        30-Sep-2022 11:08                4584
install.pecl.phpize.php                            30-Sep-2022 11:08                3907
install.pecl.static.php                            30-Sep-2022 11:08                3751
install.pecl.windows.php                           30-Sep-2022 11:08               12340
install.php                                        30-Sep-2022 11:08                6390
install.problems.bugs.php                          30-Sep-2022 11:08                2379
install.problems.faq.php                           30-Sep-2022 11:08                1412
install.problems.php                               30-Sep-2022 11:08                1606
install.problems.support.php                       30-Sep-2022 11:08                2834
install.unix.apache2.php                           30-Sep-2022 11:08               17354
install.unix.commandline.php                       30-Sep-2022 11:08                4652
install.unix.debian.php                            30-Sep-2022 11:08                8700
install.unix.lighttpd-14.php                       30-Sep-2022 11:08                7650
install.unix.litespeed.php                         30-Sep-2022 11:08               11478
install.unix.nginx.php                             30-Sep-2022 11:08               10418
install.unix.openbsd.php                           30-Sep-2022 11:08                7361
install.unix.php                                   30-Sep-2022 11:08                9284
install.unix.solaris.php                           30-Sep-2022 11:08                4775
install.windows.apache2.php                        30-Sep-2022 11:08                8693
install.windows.building.php                       30-Sep-2022 11:08                1945
install.windows.commandline.php                    30-Sep-2022 11:08               10372
install.windows.manual.php                         30-Sep-2022 11:08                6192
install.windows.pecl.php                           30-Sep-2022 11:08                1794
install.windows.php                                30-Sep-2022 11:08                3811
install.windows.recommended.php                    30-Sep-2022 11:08                6304
install.windows.requirements.php                   30-Sep-2022 11:08                2631
install.windows.tools.php                          30-Sep-2022 11:08                2043
install.windows.troubleshooting.php                30-Sep-2022 11:08                2094
internaliterator.construct.php                     30-Sep-2022 11:08                2037
internaliterator.current.php                       30-Sep-2022 11:08                2432
internaliterator.key.php                           30-Sep-2022 11:08                2427
internaliterator.next.php                          30-Sep-2022 11:08                2414
internaliterator.rewind.php                        30-Sep-2022 11:08                2438
internaliterator.valid.php                         30-Sep-2022 11:08                2382
intl.configuration.php                             30-Sep-2022 11:09                6091
intl.constants.php                                 30-Sep-2022 11:09                8239
intl.examples.basic.php                            30-Sep-2022 11:09                4779
intl.examples.php                                  30-Sep-2022 11:09                1443
intl.installation.php                              30-Sep-2022 11:09                2917
intl.requirements.php                              30-Sep-2022 11:09                1735
intl.resources.php                                 30-Sep-2022 11:09                1304
intl.setup.php                                     30-Sep-2022 11:09                1642
intlbreakiterator.construct.php                    30-Sep-2022 11:09                2675
intlbreakiterator.createcharacterinstance.php      30-Sep-2022 11:09                3378
intlbreakiterator.createcodepointinstance.php      30-Sep-2022 11:09                2996
intlbreakiterator.createlineinstance.php           30-Sep-2022 11:09                3320
intlbreakiterator.createsentenceinstance.php       30-Sep-2022 11:09                3311
intlbreakiterator.createtitleinstance.php          30-Sep-2022 11:09                3285
intlbreakiterator.createwordinstance.php           30-Sep-2022 11:09                3235
intlbreakiterator.current.php                      30-Sep-2022 11:09                2614
intlbreakiterator.first.php                        30-Sep-2022 11:09                2607
intlbreakiterator.following.php                    30-Sep-2022 11:09                2837
intlbreakiterator.geterrorcode.php                 30-Sep-2022 11:09                3145
intlbreakiterator.geterrormessage.php              30-Sep-2022 11:09                3294
intlbreakiterator.getlocale.php                    30-Sep-2022 11:09                2813
intlbreakiterator.getpartsiterator.php             30-Sep-2022 11:09                3989
intlbreakiterator.gettext.php                      30-Sep-2022 11:09                2667
intlbreakiterator.isboundary.php                   30-Sep-2022 11:09                2802
intlbreakiterator.last.php                         30-Sep-2022 11:09                2622
intlbreakiterator.next.php                         30-Sep-2022 11:09                2878
intlbreakiterator.preceding.php                    30-Sep-2022 11:09                2824
intlbreakiterator.previous.php                     30-Sep-2022 11:09                2684
intlbreakiterator.settext.php                      30-Sep-2022 11:09                2809
intlcalendar.add.php                               30-Sep-2022 11:09                9298
intlcalendar.after.php                             30-Sep-2022 11:09                7264
intlcalendar.before.php                            30-Sep-2022 11:09                4454
intlcalendar.clear.php                             30-Sep-2022 11:09               21954
intlcalendar.construct.php                         30-Sep-2022 11:09                2512
intlcalendar.createinstance.php                    30-Sep-2022 11:09               14201
intlcalendar.equals.php                            30-Sep-2022 11:09               11571
intlcalendar.fielddifference.php                   30-Sep-2022 11:09               12399
intlcalendar.fromdatetime.php                      30-Sep-2022 11:09                8270
intlcalendar.get.php                               30-Sep-2022 11:09                9196
intlcalendar.getactualmaximum.php                  30-Sep-2022 11:09                9516
intlcalendar.getactualminimum.php                  30-Sep-2022 11:09                6495
intlcalendar.getavailablelocales.php               30-Sep-2022 11:09                4689
intlcalendar.getdayofweektype.php                  30-Sep-2022 11:09               10463
intlcalendar.geterrorcode.php                      30-Sep-2022 11:09               10137
intlcalendar.geterrormessage.php                   30-Sep-2022 11:09                6673
intlcalendar.getfirstdayofweek.php                 30-Sep-2022 11:09                9059
intlcalendar.getgreatestminimum.php                30-Sep-2022 11:09                4977
intlcalendar.getkeywordvaluesforlocale.php         30-Sep-2022 11:09                8472
intlcalendar.getleastmaximum.php                   30-Sep-2022 11:09                8926
intlcalendar.getlocale.php                         30-Sep-2022 11:09                6802
intlcalendar.getmaximum.php                        30-Sep-2022 11:09                5766
intlcalendar.getminimaldaysinfirstweek.php         30-Sep-2022 11:09                9837
intlcalendar.getminimum.php                        30-Sep-2022 11:09                4926
intlcalendar.getnow.php                            30-Sep-2022 11:09                5742
intlcalendar.getrepeatedwalltimeoption.php         30-Sep-2022 11:09               11205
intlcalendar.getskippedwalltimeoption.php          30-Sep-2022 11:09               13771
intlcalendar.gettime.php                           30-Sep-2022 11:09                6956
intlcalendar.gettimezone.php                       30-Sep-2022 11:09                8038
intlcalendar.gettype.php                           30-Sep-2022 11:09                5930
intlcalendar.getweekendtransition.php              30-Sep-2022 11:09                5269
intlcalendar.indaylighttime.php                    30-Sep-2022 11:09                9404
intlcalendar.isequivalentto.php                    30-Sep-2022 11:09                9478
intlcalendar.islenient.php                         30-Sep-2022 11:09                8843
intlcalendar.isset.php                             30-Sep-2022 11:09                5225
intlcalendar.isweekend.php                         30-Sep-2022 11:09                9640
intlcalendar.roll.php                              30-Sep-2022 11:09                9797
intlcalendar.set.php                               30-Sep-2022 11:09               15129
intlcalendar.setfirstdayofweek.php                 30-Sep-2022 11:09                8445
intlcalendar.setlenient.php                        30-Sep-2022 11:09                4619
intlcalendar.setminimaldaysinfirstweek.php         30-Sep-2022 11:09                4780
intlcalendar.setrepeatedwalltimeoption.php         30-Sep-2022 11:09                6381
intlcalendar.setskippedwalltimeoption.php          30-Sep-2022 11:09                7266
intlcalendar.settime.php                           30-Sep-2022 11:09                9376
intlcalendar.settimezone.php                       30-Sep-2022 11:09               11727
intlcalendar.todatetime.php                        30-Sep-2022 11:09                7898
intlchar.charage.php                               30-Sep-2022 11:09                6158
intlchar.chardigitvalue.php                        30-Sep-2022 11:09                5712
intlchar.chardirection.php                         30-Sep-2022 11:09                9199
intlchar.charfromname.php                          30-Sep-2022 11:09                7334
intlchar.charmirror.php                            30-Sep-2022 11:09                6757
intlchar.charname.php                              30-Sep-2022 11:09                7583
intlchar.chartype.php                              30-Sep-2022 11:09                9453
intlchar.chr.php                                   30-Sep-2022 11:09                5839
intlchar.digit.php                                 30-Sep-2022 11:09                9173
intlchar.enumcharnames.php                         30-Sep-2022 11:09                8424
intlchar.enumchartypes.php                         30-Sep-2022 11:09                6411
intlchar.foldcase.php                              30-Sep-2022 11:09                3948
intlchar.fordigit.php                              30-Sep-2022 11:09                7612
intlchar.getbidipairedbracket.php                  30-Sep-2022 11:09                6114
intlchar.getblockcode.php                          30-Sep-2022 11:09                5535
intlchar.getcombiningclass.php                     30-Sep-2022 11:09                4926
intlchar.getfc-nfkc-closure.php                    30-Sep-2022 11:09                4812
intlchar.getintpropertymaxvalue.php                30-Sep-2022 11:09                6838
intlchar.getintpropertyminvalue.php                30-Sep-2022 11:09                6829
intlchar.getintpropertyvalue.php                   30-Sep-2022 11:09                8534
intlchar.getnumericvalue.php                       30-Sep-2022 11:09                5568
intlchar.getpropertyenum.php                       30-Sep-2022 11:09                6927
intlchar.getpropertyname.php                       30-Sep-2022 11:09                8971
intlchar.getpropertyvalueenum.php                  30-Sep-2022 11:09                8512
intlchar.getpropertyvaluename.php                  30-Sep-2022 11:09               11149
intlchar.getunicodeversion.php                     30-Sep-2022 11:09                4187
intlchar.hasbinaryproperty.php                     30-Sep-2022 11:09                9430
intlchar.isalnum.php                               30-Sep-2022 11:09                5700
intlchar.isalpha.php                               30-Sep-2022 11:09                5595
intlchar.isbase.php                                30-Sep-2022 11:09                6293
intlchar.isblank.php                               30-Sep-2022 11:09                7173
intlchar.iscntrl.php                               30-Sep-2022 11:09                6393
intlchar.isdefined.php                             30-Sep-2022 11:09                7063
intlchar.isdigit.php                               30-Sep-2022 11:09                6061
intlchar.isgraph.php                               30-Sep-2022 11:09                5785
intlchar.isidignorable.php                         30-Sep-2022 11:09                6466
intlchar.isidpart.php                              30-Sep-2022 11:09                7063
intlchar.isidstart.php                             30-Sep-2022 11:09                6485
intlchar.isisocontrol.php                          30-Sep-2022 11:09                5603
intlchar.isjavaidpart.php                          30-Sep-2022 11:09                7149
intlchar.isjavaidstart.php                         30-Sep-2022 11:09                6802
intlchar.isjavaspacechar.php                       30-Sep-2022 11:09                7021
intlchar.islower.php                               30-Sep-2022 11:09                7398
intlchar.ismirrored.php                            30-Sep-2022 11:09                5745
intlchar.isprint.php                               30-Sep-2022 11:09                5950
intlchar.ispunct.php                               30-Sep-2022 11:09                5359
intlchar.isspace.php                               30-Sep-2022 11:09                6599
intlchar.istitle.php                               30-Sep-2022 11:09                6837
intlchar.isualphabetic.php                         30-Sep-2022 11:09                5927
intlchar.isulowercase.php                          30-Sep-2022 11:09                7005
intlchar.isupper.php                               30-Sep-2022 11:09                7398
intlchar.isuuppercase.php                          30-Sep-2022 11:09                7075
intlchar.isuwhitespace.php                         30-Sep-2022 11:09                7626
intlchar.iswhitespace.php                          30-Sep-2022 11:09                7826
intlchar.isxdigit.php                              30-Sep-2022 11:09                7154
intlchar.ord.php                                   30-Sep-2022 11:09                5564
intlchar.tolower.php                               30-Sep-2022 11:09                7863
intlchar.totitle.php                               30-Sep-2022 11:09                7895
intlchar.toupper.php                               30-Sep-2022 11:09                7761
intlcodepointbreakiterator.getlastcodepoint.php    30-Sep-2022 11:09                2905
intldateformatter.create.php                       30-Sep-2022 11:09               28977
intldateformatter.format.php                       30-Sep-2022 11:09               29610
intldateformatter.formatobject.php                 30-Sep-2022 11:09               15370
intldateformatter.getcalendar.php                  30-Sep-2022 11:09               10361
intldateformatter.getcalendarobject.php            30-Sep-2022 11:09                8462
intldateformatter.getdatetype.php                  30-Sep-2022 11:09               13310
intldateformatter.geterrorcode.php                 30-Sep-2022 11:09                9833
intldateformatter.geterrormessage.php              30-Sep-2022 11:09                9668
intldateformatter.getlocale.php                    30-Sep-2022 11:09               13735
intldateformatter.getpattern.php                   30-Sep-2022 11:09               11813
intldateformatter.gettimetype.php                  30-Sep-2022 11:09               13156
intldateformatter.gettimezone.php                  30-Sep-2022 11:09                9506
intldateformatter.gettimezoneid.php                30-Sep-2022 11:09                9937
intldateformatter.islenient.php                    30-Sep-2022 11:09               17224
intldateformatter.localtime.php                    30-Sep-2022 11:09               12849
intldateformatter.parse.php                        30-Sep-2022 11:09               13839
intldateformatter.setcalendar.php                  30-Sep-2022 11:09               15934
intldateformatter.setlenient.php                   30-Sep-2022 11:09               18153
intldateformatter.setpattern.php                   30-Sep-2022 11:09               12889
intldateformatter.settimezone.php                  30-Sep-2022 11:09               12448
intldatepatterngenerator.create.php                30-Sep-2022 11:09                4040
intldatepatterngenerator.getbestpattern.php        30-Sep-2022 11:09                7222
intlgregoriancalendar.construct.php                30-Sep-2022 11:09                5239
intlgregoriancalendar.getgregorianchange.php       30-Sep-2022 11:09                2868
intlgregoriancalendar.isleapyear.php               30-Sep-2022 11:09                3171
intlgregoriancalendar.setgregorianchange.php       30-Sep-2022 11:09                3167
intliterator.current.php                           30-Sep-2022 11:09                2576
intliterator.key.php                               30-Sep-2022 11:09                2562
intliterator.next.php                              30-Sep-2022 11:09                2495
intliterator.rewind.php                            30-Sep-2022 11:09                2509
intliterator.valid.php                             30-Sep-2022 11:09                2486
intlpartsiterator.getbreakiterator.php             30-Sep-2022 11:09                2762
intlrulebasedbreakiterator.construct.php           30-Sep-2022 11:09                3215
intlrulebasedbreakiterator.getbinaryrules.php      30-Sep-2022 11:09                2954
intlrulebasedbreakiterator.getrules.php            30-Sep-2022 11:09                2939
intlrulebasedbreakiterator.getrulestatus.php       30-Sep-2022 11:09                2943
intlrulebasedbreakiterator.getrulestatusvec.php    30-Sep-2022 11:09                3029
intltimezone.construct.php                         30-Sep-2022 11:09                2045
intltimezone.countequivalentids.php                30-Sep-2022 11:09                3707
intltimezone.createdefault.php                     30-Sep-2022 11:09                3298
intltimezone.createenumeration.php                 30-Sep-2022 11:09                4436
intltimezone.createtimezone.php                    30-Sep-2022 11:09                3696
intltimezone.createtimezoneidenumeration.php       30-Sep-2022 11:09                5423
intltimezone.fromdatetimezone.php                  30-Sep-2022 11:09                3901
intltimezone.getcanonicalid.php                    30-Sep-2022 11:09                4315
intltimezone.getdisplayname.php                    30-Sep-2022 11:09                5033
intltimezone.getdstsavings.php                     30-Sep-2022 11:09                3369
intltimezone.getequivalentid.php                   30-Sep-2022 11:09                3982
intltimezone.geterrorcode.php                      30-Sep-2022 11:09                3407
intltimezone.geterrormessage.php                   30-Sep-2022 11:09                3440
intltimezone.getgmt.php                            30-Sep-2022 11:09                3107
intltimezone.getid.php                             30-Sep-2022 11:09                3298
intltimezone.getidforwindowsid.php                 30-Sep-2022 11:09                5882
intltimezone.getoffset.php                         30-Sep-2022 11:09                4846
intltimezone.getrawoffset.php                      30-Sep-2022 11:09                3280
intltimezone.getregion.php                         30-Sep-2022 11:09                3708
intltimezone.gettzdataversion.php                  30-Sep-2022 11:09                3378
intltimezone.getunknown.php                        30-Sep-2022 11:09                3399
intltimezone.getwindowsid.php                      30-Sep-2022 11:09                4626
intltimezone.hassamerules.php                      30-Sep-2022 11:09                3734
intltimezone.todatetimezone.php                    30-Sep-2022 11:09                3636
intltimezone.usedaylighttime.php                   30-Sep-2022 11:09                3288
intro-whatcando.php                                30-Sep-2022 11:08               12300
intro-whatis.php                                   30-Sep-2022 11:08                5761
intro.apache.php                                   30-Sep-2022 11:09                1238
intro.apcu.php                                     30-Sep-2022 11:08                1925
intro.array.php                                    30-Sep-2022 11:09                2399
intro.bc.php                                       30-Sep-2022 11:09                5099
intro.bzip2.php                                    30-Sep-2022 11:08                1213
intro.calendar.php                                 30-Sep-2022 11:09                2596
intro.classobj.php                                 30-Sep-2022 11:09                2167
intro.cmark.php                                    30-Sep-2022 11:09                6657
intro.com.php                                      30-Sep-2022 11:09                4659
intro.componere.php                                30-Sep-2022 11:08                6823
intro.csprng.php                                   30-Sep-2022 11:09                2035
intro.ctype.php                                    30-Sep-2022 11:09                5302
intro.cubrid.php                                   30-Sep-2022 11:09                1550
intro.curl.php                                     30-Sep-2022 11:09                2033
intro.datetime.php                                 30-Sep-2022 11:09                2769
intro.dba.php                                      30-Sep-2022 11:09                1682
intro.dbase.php                                    30-Sep-2022 11:09                7931
intro.dio.php                                      30-Sep-2022 11:09                2049
intro.dom.php                                      30-Sep-2022 11:09                1770
intro.ds.php                                       30-Sep-2022 11:09                1582
intro.eio.php                                      30-Sep-2022 11:09               17355
intro.enchant.php                                  30-Sep-2022 11:09                3062
intro.errorfunc.php                                30-Sep-2022 11:08                2531
intro.ev.php                                       30-Sep-2022 11:09                2906
intro.event.php                                    30-Sep-2022 11:09                2466
intro.exec.php                                     30-Sep-2022 11:09                1961
intro.exif.php                                     30-Sep-2022 11:09                1701
intro.expect.php                                   30-Sep-2022 11:09                1585
intro.fann.php                                     30-Sep-2022 11:09                1610
intro.fdf.php                                      30-Sep-2022 11:09                4570
intro.ffi.php                                      30-Sep-2022 11:08                3692
intro.fileinfo.php                                 30-Sep-2022 11:09                1660
intro.filesystem.php                               30-Sep-2022 11:09                1647
intro.filter.php                                   30-Sep-2022 11:09                3629
intro.fpm.php                                      30-Sep-2022 11:09                1528
intro.ftp.php                                      30-Sep-2022 11:09                1947
intro.funchand.php                                 30-Sep-2022 11:09                1349
intro.gearman.php                                  30-Sep-2022 11:09                2008
intro.gender.php                                   30-Sep-2022 11:09                1456
intro.geoip.php                                    30-Sep-2022 11:09                1754
intro.gettext.php                                  30-Sep-2022 11:09                1623
intro.gmagick.php                                  30-Sep-2022 11:09                2002
intro.gmp.php                                      30-Sep-2022 11:09                3805
intro.gnupg.php                                    30-Sep-2022 11:09                1236
intro.hash.php                                     30-Sep-2022 11:09                1384
intro.hrtime.php                                   30-Sep-2022 11:09                1995
intro.ibase.php                                    30-Sep-2022 11:09                4103
intro.ibm-db2.php                                  30-Sep-2022 11:09                1321
intro.iconv.php                                    30-Sep-2022 11:09                2268
intro.igbinary.php                                 30-Sep-2022 11:09                2009
intro.image.php                                    30-Sep-2022 11:09                7637
intro.imagick.php                                  30-Sep-2022 11:09                2172
intro.imap.php                                     30-Sep-2022 11:09                1915
intro.info.php                                     30-Sep-2022 11:08                1723
intro.inotify.php                                  30-Sep-2022 11:09                2538
intro.intl.php                                     30-Sep-2022 11:09                7348
intro.json.php                                     30-Sep-2022 11:09                1777
intro.ldap.php                                     30-Sep-2022 11:09                5109
intro.libxml.php                                   30-Sep-2022 11:09                1801
intro.lua.php                                      30-Sep-2022 11:09                1361
intro.luasandbox.php                               30-Sep-2022 11:09                2922
intro.lzf.php                                      30-Sep-2022 11:08                1679
intro.mail.php                                     30-Sep-2022 11:09                1253
intro.mailparse.php                                30-Sep-2022 11:09                2138
intro.math.php                                     30-Sep-2022 11:09                1748
intro.mbstring.php                                 30-Sep-2022 11:09                4200
intro.mcrypt.php                                   30-Sep-2022 11:09                2611
intro.memcache.php                                 30-Sep-2022 11:09                1975
intro.memcached.php                                30-Sep-2022 11:09                2203
intro.mhash.php                                    30-Sep-2022 11:09                3564
intro.misc.php                                     30-Sep-2022 11:09                1209
intro.mqseries.php                                 30-Sep-2022 11:09                2017
intro.mysql-xdevapi.php                            30-Sep-2022 11:09                2231
intro.mysql.php                                    30-Sep-2022 11:09                2042
intro.mysqli.php                                   30-Sep-2022 11:09                2555
intro.mysqlnd.php                                  30-Sep-2022 11:09                2386
intro.network.php                                  30-Sep-2022 11:09                1195
intro.oauth.php                                    30-Sep-2022 11:09                1537
intro.oci8.php                                     30-Sep-2022 11:09                1864
intro.opcache.php                                  30-Sep-2022 11:08                1748
intro.openal.php                                   30-Sep-2022 11:08                1297
intro.openssl.php                                  30-Sep-2022 11:09                1819
intro.outcontrol.php                               30-Sep-2022 11:08                2189
intro.parallel.php                                 30-Sep-2022 11:09                9029
intro.parle.php                                    30-Sep-2022 11:09                5275
intro.password.php                                 30-Sep-2022 11:09                1575
intro.pcntl.php                                    30-Sep-2022 11:09                4002
intro.pcre.php                                     30-Sep-2022 11:09                3746
intro.pdo.php                                      30-Sep-2022 11:09                3040
intro.pgsql.php                                    30-Sep-2022 11:09                1961
intro.phar.php                                     30-Sep-2022 11:08               13556
intro.phpdbg.php                                   30-Sep-2022 11:08                7760
intro.posix.php                                    30-Sep-2022 11:09                1902
intro.ps.php                                       30-Sep-2022 11:09                2324
intro.pspell.php                                   30-Sep-2022 11:09                1245
intro.pthreads.php                                 30-Sep-2022 11:09               12811
intro.quickhash.php                                30-Sep-2022 11:09                1352
intro.radius.php                                   30-Sep-2022 11:08                2410
intro.rar.php                                      30-Sep-2022 11:09                1740
intro.readline.php                                 30-Sep-2022 11:08                2417
intro.recode.php                                   30-Sep-2022 11:09                2619
intro.reflection.php                               30-Sep-2022 11:09                2151
intro.rpminfo.php                                  30-Sep-2022 11:09                1258
intro.rrd.php                                      30-Sep-2022 11:09                1549
intro.runkit7.php                                  30-Sep-2022 11:08                1688
intro.scoutapm.php                                 30-Sep-2022 11:09                1658
intro.seaslog.php                                  30-Sep-2022 11:09                6077
intro.sem.php                                      30-Sep-2022 11:09                4534
intro.session.php                                  30-Sep-2022 11:09                6466
intro.shmop.php                                    30-Sep-2022 11:09                1456
intro.simplexml.php                                30-Sep-2022 11:09                1471
intro.snmp.php                                     30-Sep-2022 11:09                1965
intro.soap.php                                     30-Sep-2022 11:09                1542
intro.sockets.php                                  30-Sep-2022 11:09                3251
intro.sodium.php                                   30-Sep-2022 11:09                1607
intro.solr.php                                     30-Sep-2022 11:09                2139
intro.spl.php                                      30-Sep-2022 11:09                1810
intro.sqlite3.php                                  30-Sep-2022 11:09                1182
intro.sqlsrv.php                                   30-Sep-2022 11:09                2347
intro.ssdeep.php                                   30-Sep-2022 11:09                2089
intro.ssh2.php                                     30-Sep-2022 11:09                1534
intro.stats.php                                    30-Sep-2022 11:09                1762
intro.stomp.php                                    30-Sep-2022 11:09                1524
intro.stream.php                                   30-Sep-2022 11:09                5361
intro.strings.php                                  30-Sep-2022 11:09                1939
intro.svm.php                                      30-Sep-2022 11:09                1341
intro.svn.php                                      30-Sep-2022 11:09                2142
intro.swoole.php                                   30-Sep-2022 11:09                1972
intro.sync.php                                     30-Sep-2022 11:09                3335
intro.taint.php                                    30-Sep-2022 11:09                4917
intro.tcpwrap.php                                  30-Sep-2022 11:09                1322
intro.tidy.php                                     30-Sep-2022 11:09                1666
intro.tokenizer.php                                30-Sep-2022 11:09                1802
intro.trader.php                                   30-Sep-2022 11:09                3201
intro.ui.php                                       30-Sep-2022 11:09                1353
intro.uodbc.php                                    30-Sep-2022 11:09                3451
intro.uopz.php                                     30-Sep-2022 11:08                3033
intro.url.php                                      30-Sep-2022 11:09                1169
intro.v8js.php                                     30-Sep-2022 11:09                1207
intro.var.php                                      30-Sep-2022 11:09                1495
intro.var_representation.php                       30-Sep-2022 11:09                1509
intro.varnish.php                                  30-Sep-2022 11:09                1447
intro.wddx.php                                     30-Sep-2022 11:09                2435
intro.win32service.php                             30-Sep-2022 11:09                1541
intro.wincache.php                                 30-Sep-2022 11:08                7001
intro.wkhtmltox.php                                30-Sep-2022 11:09                1394
intro.xattr.php                                    30-Sep-2022 11:09                1248
intro.xdiff.php                                    30-Sep-2022 11:09                3186
intro.xhprof.php                                   30-Sep-2022 11:08                3846
intro.xlswriter.php                                30-Sep-2022 11:09                1206
intro.xml.php                                      30-Sep-2022 11:09                2915
intro.xmldiff.php                                  30-Sep-2022 11:09                1748
intro.xmlreader.php                                30-Sep-2022 11:09                1840
intro.xmlrpc.php                                   30-Sep-2022 11:09                2244
intro.xmlwriter.php                                30-Sep-2022 11:09                1897
intro.xsl.php                                      30-Sep-2022 11:09                1384
intro.yac.php                                      30-Sep-2022 11:08                1361
intro.yaconf.php                                   30-Sep-2022 11:09                3334
intro.yaf.php                                      30-Sep-2022 11:09                1641
intro.yaml.php                                     30-Sep-2022 11:09                1448
intro.yar.php                                      30-Sep-2022 11:09                1395
intro.yaz.php                                      30-Sep-2022 11:09                3377
intro.zip.php                                      30-Sep-2022 11:09                1239
intro.zlib.php                                     30-Sep-2022 11:09                1892
intro.zmq.php                                      30-Sep-2022 11:09                1565
intro.zookeeper.php                                30-Sep-2022 11:09                1691
introduction.php                                   30-Sep-2022 11:08                1483
iterator.current.php                               30-Sep-2022 11:08                2295
iterator.key.php                                   30-Sep-2022 11:08                2800
iterator.next.php                                  30-Sep-2022 11:08                2590
iterator.rewind.php                                30-Sep-2022 11:08                2806
iterator.valid.php                                 30-Sep-2022 11:08                2870
iteratoraggregate.getiterator.php                  30-Sep-2022 11:08                3032
iteratoriterator.construct.php                     30-Sep-2022 11:09                3127
iteratoriterator.current.php                       30-Sep-2022 11:09                2925
iteratoriterator.getinneriterator.php              30-Sep-2022 11:09                3301
iteratoriterator.key.php                           30-Sep-2022 11:09                2861
iteratoriterator.next.php                          30-Sep-2022 11:09                3135
iteratoriterator.rewind.php                        30-Sep-2022 11:09                3147
iteratoriterator.valid.php                         30-Sep-2022 11:09                3204
json.configuration.php                             30-Sep-2022 11:09                1358
json.constants.php                                 30-Sep-2022 11:09               14996
json.installation.php                              30-Sep-2022 11:09                2070
json.requirements.php                              30-Sep-2022 11:09                1339
json.resources.php                                 30-Sep-2022 11:09                1304
json.setup.php                                     30-Sep-2022 11:09                1616
jsonserializable.jsonserialize.php                 30-Sep-2022 11:09               13596
langref.php                                        30-Sep-2022 11:08               22545
language.attributes.classes.php                    30-Sep-2022 11:08                6497
language.attributes.overview.php                   30-Sep-2022 11:08               12805
language.attributes.php                            30-Sep-2022 11:08                1851
language.attributes.reflection.php                 30-Sep-2022 11:08                9365
language.attributes.syntax.php                     30-Sep-2022 11:08                5862
language.basic-syntax.comments.php                 30-Sep-2022 11:08                4895
language.basic-syntax.instruction-separation.php   30-Sep-2022 11:08                5368
language.basic-syntax.php                          30-Sep-2022 11:08                1729
language.basic-syntax.phpmode.php                  30-Sep-2022 11:08                6190
language.basic-syntax.phptags.php                  30-Sep-2022 11:08                6699
language.constants.magic.php                       30-Sep-2022 11:08                6112
language.constants.php                             30-Sep-2022 11:08                7943
language.constants.predefined.php                  30-Sep-2022 11:08                1856
language.constants.syntax.php                      30-Sep-2022 11:08               12401
language.control-structures.php                    30-Sep-2022 11:08                2828
language.enumerations.backed.php                   30-Sep-2022 11:08               13861
language.enumerations.basics.php                   30-Sep-2022 11:08                9142
language.enumerations.constants.php                30-Sep-2022 11:08                2740
language.enumerations.examples.php                 30-Sep-2022 11:08                8467
language.enumerations.expressions.php              30-Sep-2022 11:08                7014
language.enumerations.listing.php                  30-Sep-2022 11:08                2525
language.enumerations.methods.php                  30-Sep-2022 11:08               17324
language.enumerations.object-differences.php       30-Sep-2022 11:08                6308
language.enumerations.overview.php                 30-Sep-2022 11:08                3200
language.enumerations.php                          30-Sep-2022 11:08                2727
language.enumerations.serialization.php            30-Sep-2022 11:08                5706
language.enumerations.static-methods.php           30-Sep-2022 11:08                4138
language.enumerations.traits.php                   30-Sep-2022 11:08                5384
language.errors.basics.php                         30-Sep-2022 11:08                6883
language.errors.php                                30-Sep-2022 11:08                2166
language.errors.php7.php                           30-Sep-2022 11:08                6386
language.exceptions.extending.php                  30-Sep-2022 11:08               26869
language.exceptions.php                            30-Sep-2022 11:08               34897
language.expressions.php                           30-Sep-2022 11:08               21950
language.fibers.php                                30-Sep-2022 11:08                7718
language.functions.php                             30-Sep-2022 11:08                2163
language.generators.comparison.php                 30-Sep-2022 11:08               11021
language.generators.overview.php                   30-Sep-2022 11:08               11889
language.generators.php                            30-Sep-2022 11:08                1701
language.generators.syntax.php                     30-Sep-2022 11:08               30118
language.namespaces.basics.php                     30-Sep-2022 11:08               14664
language.namespaces.definition.php                 30-Sep-2022 11:08                5482
language.namespaces.definitionmultiple.php         30-Sep-2022 11:08               11174
language.namespaces.dynamic.php                    30-Sep-2022 11:08               10979
language.namespaces.fallback.php                   30-Sep-2022 11:08                7660
language.namespaces.faq.php                        30-Sep-2022 11:08               40881
language.namespaces.global.php                     30-Sep-2022 11:08                3704
language.namespaces.importing.php                  30-Sep-2022 11:08               21279
language.namespaces.nested.php                     30-Sep-2022 11:08                3343
language.namespaces.nsconstants.php                30-Sep-2022 11:08               11273
language.namespaces.php                            30-Sep-2022 11:08                3103
language.namespaces.rationale.php                  30-Sep-2022 11:08                8680
language.namespaces.rules.php                      30-Sep-2022 11:08               19388
language.oop5.abstract.php                         30-Sep-2022 11:08               13262
language.oop5.anonymous.php                        30-Sep-2022 11:08               13101
language.oop5.autoload.php                         30-Sep-2022 11:08                8219
language.oop5.basic.php                            30-Sep-2022 11:08               55124
language.oop5.changelog.php                        30-Sep-2022 11:08               16640
language.oop5.cloning.php                          30-Sep-2022 11:08               10893
language.oop5.constants.php                        30-Sep-2022 11:08               10712
language.oop5.decon.php                            30-Sep-2022 11:08               36397
language.oop5.final.php                            30-Sep-2022 11:08                8235
language.oop5.inheritance.php                      30-Sep-2022 11:08               16963
language.oop5.interfaces.php                       30-Sep-2022 11:08               26758
language.oop5.iterations.php                       30-Sep-2022 11:08                7099
language.oop5.late-static-bindings.php             30-Sep-2022 11:08               18985
language.oop5.magic.php                            30-Sep-2022 11:08               49331
language.oop5.object-comparison.php                30-Sep-2022 11:08               10066
language.oop5.overloading.php                      30-Sep-2022 11:08               29141
language.oop5.paamayim-nekudotayim.php             30-Sep-2022 11:08               10335
language.oop5.php                                  30-Sep-2022 11:08                3721
language.oop5.properties.php                       30-Sep-2022 11:08               31459
language.oop5.references.php                       30-Sep-2022 11:08                7028
language.oop5.serialization.php                    30-Sep-2022 11:08                9174
language.oop5.static.php                           30-Sep-2022 11:08               10714
language.oop5.traits.php                           30-Sep-2022 11:08               39329
language.oop5.variance.php                         30-Sep-2022 11:08               18625
language.oop5.visibility.php                       30-Sep-2022 11:08               30897
language.operators.arithmetic.php                  30-Sep-2022 11:08                7032
language.operators.array.php                       30-Sep-2022 11:08               10295
language.operators.assignment.php                  30-Sep-2022 11:08               14253
language.operators.bitwise.php                     30-Sep-2022 11:08               53587
language.operators.comparison.php                  30-Sep-2022 11:08               48366
language.operators.errorcontrol.php                30-Sep-2022 11:08                7735
language.operators.execution.php                   30-Sep-2022 11:08                4052
language.operators.increment.php                   30-Sep-2022 11:08               13102
language.operators.logical.php                     30-Sep-2022 11:08                8459
language.operators.php                             30-Sep-2022 11:08                5129
language.operators.precedence.php                  30-Sep-2022 11:08               24056
language.operators.string.php                      30-Sep-2022 11:08                3834
language.operators.type.php                        30-Sep-2022 11:08               20609
language.references.arent.php                      30-Sep-2022 11:08                3756
language.references.pass.php                       30-Sep-2022 11:08                7697
language.references.php                            30-Sep-2022 11:08                2098
language.references.return.php                     30-Sep-2022 11:08                8548
language.references.spot.php                       30-Sep-2022 11:08                2996
language.references.unset.php                      30-Sep-2022 11:08                2508
language.references.whatare.php                    30-Sep-2022 11:08                2529
language.references.whatdo.php                     30-Sep-2022 11:08               21358
language.types.array.php                           30-Sep-2022 11:08              122158
language.types.boolean.php                         30-Sep-2022 11:08               10264
language.types.callable.php                        30-Sep-2022 11:08               14091
language.types.declarations.php                    30-Sep-2022 11:08               62306
language.types.enumerations.php                    30-Sep-2022 11:08                4102
language.types.float.php                           30-Sep-2022 11:08               12365
language.types.integer.php                         30-Sep-2022 11:08               24215
language.types.intro.php                           30-Sep-2022 11:08                8549
language.types.iterable.php                        30-Sep-2022 11:08                7786
language.types.null.php                            30-Sep-2022 11:08                4046
language.types.numeric-strings.php                 30-Sep-2022 11:08               13101
language.types.object.php                          30-Sep-2022 11:08                6174
language.types.php                                 30-Sep-2022 11:08                2529
language.types.resource.php                        30-Sep-2022 11:08                3499
language.types.string.php                          30-Sep-2022 11:08               99727
language.types.type-juggling.php                   30-Sep-2022 11:08               23921
language.variables.basics.php                      30-Sep-2022 11:08               17554
language.variables.external.php                    30-Sep-2022 11:08               21572
language.variables.php                             30-Sep-2022 11:08                1836
language.variables.predefined.php                  30-Sep-2022 11:08                4156
language.variables.scope.php                       30-Sep-2022 11:08               34653
language.variables.superglobals.php                30-Sep-2022 11:08                5312
language.variables.variable.php                    30-Sep-2022 11:08               12134
ldap.configuration.php                             30-Sep-2022 11:09                2632
ldap.constants.php                                 30-Sep-2022 11:09               29060
ldap.controls.php                                  30-Sep-2022 11:09               10914
ldap.examples-basic.php                            30-Sep-2022 11:09                9956
ldap.examples-controls.php                         30-Sep-2022 11:09               19189
ldap.examples.php                                  30-Sep-2022 11:09                1475
ldap.installation.php                              30-Sep-2022 11:09                3551
ldap.requirements.php                              30-Sep-2022 11:09                1700
ldap.resources.php                                 30-Sep-2022 11:09                1622
ldap.setup.php                                     30-Sep-2022 11:09                1642
ldap.using.php                                     30-Sep-2022 11:09                2886
libxml.configuration.php                           30-Sep-2022 11:09                1372
libxml.constants.php                               30-Sep-2022 11:09               11902
libxml.installation.php                            30-Sep-2022 11:09                2993
libxml.requirements.php                            30-Sep-2022 11:09                1320
libxml.resources.php                               30-Sep-2022 11:09                1318
libxml.setup.php                                   30-Sep-2022 11:09                1658
limititerator.construct.php                        30-Sep-2022 11:09                8180
limititerator.current.php                          30-Sep-2022 11:09                4012
limititerator.getinneriterator.php                 30-Sep-2022 11:09                3468
limititerator.getposition.php                      30-Sep-2022 11:09                6241
limititerator.key.php                              30-Sep-2022 11:09                4145
limititerator.next.php                             30-Sep-2022 11:09                3701
limititerator.rewind.php                           30-Sep-2022 11:09                3935
limititerator.seek.php                             30-Sep-2022 11:09                4587
limititerator.valid.php                            30-Sep-2022 11:09                3828
locale.acceptfromhttp.php                          30-Sep-2022 11:09                6395
locale.canonicalize.php                            30-Sep-2022 11:09                3117
locale.composelocale.php                           30-Sep-2022 11:09               15432
locale.filtermatches.php                           30-Sep-2022 11:09                9192
locale.getallvariants.php                          30-Sep-2022 11:09                6670
locale.getdefault.php                              30-Sep-2022 11:09                6329
locale.getdisplaylanguage.php                      30-Sep-2022 11:09               10398
locale.getdisplayname.php                          30-Sep-2022 11:09               10202
locale.getdisplayregion.php                        30-Sep-2022 11:09               10153
locale.getdisplayscript.php                        30-Sep-2022 11:09               10165
locale.getdisplayvariant.php                       30-Sep-2022 11:09               10195
locale.getkeywords.php                             30-Sep-2022 11:09                7483
locale.getprimarylanguage.php                      30-Sep-2022 11:09                6084
locale.getregion.php                               30-Sep-2022 11:09                6011
locale.getscript.php                               30-Sep-2022 11:09                5764
locale.lookup.php                                  30-Sep-2022 11:09                9973
locale.parselocale.php                             30-Sep-2022 11:09                8081
locale.setdefault.php                              30-Sep-2022 11:09                5651
lua.assign.php                                     30-Sep-2022 11:09                4895
lua.call.php                                       30-Sep-2022 11:09                7843
lua.configuration.php                              30-Sep-2022 11:09                1351
lua.construct.php                                  30-Sep-2022 11:09                2507
lua.eval.php                                       30-Sep-2022 11:09                4011
lua.getversion.php                                 30-Sep-2022 11:09                2410
lua.include.php                                    30-Sep-2022 11:09                2869
lua.installation.php                               30-Sep-2022 11:09                2298
lua.registercallback.php                           30-Sep-2022 11:09                4771
lua.requirements.php                               30-Sep-2022 11:09                1413
lua.resources.php                                  30-Sep-2022 11:09                1271
lua.setup.php                                      30-Sep-2022 11:09                1603
luaclosure.invoke.php                              30-Sep-2022 11:09                4488
luasandbox.callfunction.php                        30-Sep-2022 11:09                5505
luasandbox.configuration.php                       30-Sep-2022 11:09                1400
luasandbox.disableprofiler.php                     30-Sep-2022 11:09                3102
luasandbox.enableprofiler.php                      30-Sep-2022 11:09                3946
luasandbox.examples-basic.php                      30-Sep-2022 11:09                7825
luasandbox.examples.php                            30-Sep-2022 11:09                1516
luasandbox.getcpuusage.php                         30-Sep-2022 11:09                4193
luasandbox.getmemoryusage.php                      30-Sep-2022 11:09                3495
luasandbox.getpeakmemoryusage.php                  30-Sep-2022 11:09                3551
luasandbox.getprofilerfunctionreport.php           30-Sep-2022 11:09                6571
luasandbox.getversioninfo.php                      30-Sep-2022 11:09                3055
luasandbox.installation.php                        30-Sep-2022 11:09                2417
luasandbox.loadbinary.php                          30-Sep-2022 11:09                3720
luasandbox.loadstring.php                          30-Sep-2022 11:09                6038
luasandbox.pauseusagetimer.php                     30-Sep-2022 11:09               11356
luasandbox.registerlibrary.php                     30-Sep-2022 11:09                7601
luasandbox.requirements.php                        30-Sep-2022 11:09                2180
luasandbox.resources.php                           30-Sep-2022 11:09                1355
luasandbox.setcpulimit.php                         30-Sep-2022 11:09                7007
luasandbox.setmemorylimit.php                      30-Sep-2022 11:09                6185
luasandbox.setup.php                               30-Sep-2022 11:09                1694
luasandbox.unpauseusagetimer.php                   30-Sep-2022 11:09                3506
luasandbox.wrapphpfunction.php                     30-Sep-2022 11:09                4928
luasandboxfunction.call.php                        30-Sep-2022 11:09                8931
luasandboxfunction.construct.php                   30-Sep-2022 11:09                2899
luasandboxfunction.dump.php                        30-Sep-2022 11:09                2509
lzf.configuration.php                              30-Sep-2022 11:08                1351
lzf.constants.php                                  30-Sep-2022 11:08                1213
lzf.installation.php                               30-Sep-2022 11:08                2944
lzf.requirements.php                               30-Sep-2022 11:08                1244
lzf.resources.php                                  30-Sep-2022 11:08                1297
lzf.setup.php                                      30-Sep-2022 11:08                1624
mail.configuration.php                             30-Sep-2022 11:09                8769
mail.constants.php                                 30-Sep-2022 11:09                1213
mail.installation.php                              30-Sep-2022 11:09                1360
mail.requirements.php                              30-Sep-2022 11:09                2367
mail.resources.php                                 30-Sep-2022 11:09                1304
mail.setup.php                                     30-Sep-2022 11:09                1637
mailparse.configuration.php                        30-Sep-2022 11:09                2734
mailparse.constants.php                            30-Sep-2022 11:09                2252
mailparse.installation.php                         30-Sep-2022 11:09                3000
mailparse.requirements.php                         30-Sep-2022 11:09                1286
mailparse.resources.php                            30-Sep-2022 11:09                1666
mailparse.setup.php                                30-Sep-2022 11:09                1702
manual.php                                         30-Sep-2022 11:08                1335
math.configuration.php                             30-Sep-2022 11:09                1358
math.constants.php                                 30-Sep-2022 11:09                6433
math.installation.php                              30-Sep-2022 11:09                1360
math.requirements.php                              30-Sep-2022 11:09                1251
math.resources.php                                 30-Sep-2022 11:09                1304
math.setup.php                                     30-Sep-2022 11:09                1632
mbstring.configuration.php                         30-Sep-2022 11:09               18133
mbstring.constants.php                             30-Sep-2022 11:09                6549
mbstring.encodings.php                             30-Sep-2022 11:09               18753
mbstring.http.php                                  30-Sep-2022 11:09                6743
mbstring.installation.php                          30-Sep-2022 11:09                4225
mbstring.ja-basic.php                              30-Sep-2022 11:09                5049
mbstring.overload.php                              30-Sep-2022 11:09                8807
mbstring.php4.req.php                              30-Sep-2022 11:09                5319
mbstring.requirements.php                          30-Sep-2022 11:09                1279
mbstring.resources.php                             30-Sep-2022 11:09                1332
mbstring.setup.php                                 30-Sep-2022 11:09                1724
mbstring.supported-encodings.php                   30-Sep-2022 11:09                8993
mcrypt.ciphers.php                                 30-Sep-2022 11:09                7236
mcrypt.configuration.php                           30-Sep-2022 11:09                3978
mcrypt.constants.php                               30-Sep-2022 11:09                7130
mcrypt.installation.php                            30-Sep-2022 11:09                2032
mcrypt.requirements.php                            30-Sep-2022 11:09                2539
mcrypt.resources.php                               30-Sep-2022 11:09                1402
mcrypt.setup.php                                   30-Sep-2022 11:09                1669
memcache.add.php                                   30-Sep-2022 11:09                7894
memcache.addserver.php                             30-Sep-2022 11:09               17040
memcache.close.php                                 30-Sep-2022 11:09                5753
memcache.connect.php                               30-Sep-2022 11:09                8575
memcache.constants.php                             30-Sep-2022 11:09                4721
memcache.decrement.php                             30-Sep-2022 11:09                8107
memcache.delete.php                                30-Sep-2022 11:09                7147
memcache.examples-overview.php                     30-Sep-2022 11:09                7188
memcache.examples.php                              30-Sep-2022 11:09                1465
memcache.flush.php                                 30-Sep-2022 11:09                4998
memcache.get.php                                   30-Sep-2022 11:09                9646
memcache.getextendedstats.php                      30-Sep-2022 11:09                9103
memcache.getserverstatus.php                       30-Sep-2022 11:09                6753
memcache.getstats.php                              30-Sep-2022 11:09                5347
memcache.getversion.php                            30-Sep-2022 11:09                5406
memcache.increment.php                             30-Sep-2022 11:09                7870
memcache.ini.php                                   30-Sep-2022 11:09               11411
memcache.installation.php                          30-Sep-2022 11:09                2643
memcache.pconnect.php                              30-Sep-2022 11:09                7193
memcache.replace.php                               30-Sep-2022 11:09                7947
memcache.requirements.php                          30-Sep-2022 11:09                1491
memcache.resources.php                             30-Sep-2022 11:09                1452
memcache.set.php                                   30-Sep-2022 11:09               11246
memcache.setcompressthreshold.php                  30-Sep-2022 11:09                6457
memcache.setserverparams.php                       30-Sep-2022 11:09               12836
memcache.setup.php                                 30-Sep-2022 11:09                1684
memcached.add.php                                  30-Sep-2022 11:09                4997
memcached.addbykey.php                             30-Sep-2022 11:09                6298
memcached.addserver.php                            30-Sep-2022 11:09                8753
memcached.addservers.php                           30-Sep-2022 11:09                6043
memcached.append.php                               30-Sep-2022 11:09                7532
memcached.appendbykey.php                          30-Sep-2022 11:09                5318
memcached.callbacks.php                            30-Sep-2022 11:09                1797
memcached.callbacks.read-through.php               30-Sep-2022 11:09                5278
memcached.callbacks.result.php                     30-Sep-2022 11:09                5618
memcached.cas.php                                  30-Sep-2022 11:09               10874
memcached.casbykey.php                             30-Sep-2022 11:09                6449
memcached.configuration.php                        30-Sep-2022 11:09               28665
memcached.constants.php                            30-Sep-2022 11:09               27565
memcached.construct.php                            30-Sep-2022 11:09                5052
memcached.decrement.php                            30-Sep-2022 11:09                9868
memcached.decrementbykey.php                       30-Sep-2022 11:09                6645
memcached.delete.php                               30-Sep-2022 11:09                6779
memcached.deletebykey.php                          30-Sep-2022 11:09                5527
memcached.deletemulti.php                          30-Sep-2022 11:09                5820
memcached.deletemultibykey.php                     30-Sep-2022 11:09                5568
memcached.expiration.php                           30-Sep-2022 11:09                2539
memcached.fetch.php                                30-Sep-2022 11:09                7014
memcached.fetchall.php                             30-Sep-2022 11:09                6866
memcached.flush.php                                30-Sep-2022 11:09                5266
memcached.get.php                                  30-Sep-2022 11:09               11313
memcached.getallkeys.php                           30-Sep-2022 11:09                3222
memcached.getbykey.php                             30-Sep-2022 11:09                7003
memcached.getdelayed.php                           30-Sep-2022 11:09                9238
memcached.getdelayedbykey.php                      30-Sep-2022 11:09                6089
memcached.getmulti.php                             30-Sep-2022 11:09               22498
memcached.getmultibykey.php                        30-Sep-2022 11:09                6161
memcached.getoption.php                            30-Sep-2022 11:09                5756
memcached.getresultcode.php                        30-Sep-2022 11:09                4596
memcached.getresultmessage.php                     30-Sep-2022 11:09                5062
memcached.getserverbykey.php                       30-Sep-2022 11:09                7924
memcached.getserverlist.php                        30-Sep-2022 11:09                4797
memcached.getstats.php                             30-Sep-2022 11:09                5607
memcached.getversion.php                           30-Sep-2022 11:09                4230
memcached.increment.php                            30-Sep-2022 11:09                9222
memcached.incrementbykey.php                       30-Sep-2022 11:09                6585
memcached.installation.php                         30-Sep-2022 11:09                3359
memcached.ispersistent.php                         30-Sep-2022 11:09                3171
memcached.ispristine.php                           30-Sep-2022 11:09                2980
memcached.prepend.php                              30-Sep-2022 11:09                7716
memcached.prependbykey.php                         30-Sep-2022 11:09                5340
memcached.quit.php                                 30-Sep-2022 11:09                2504
memcached.replace.php                              30-Sep-2022 11:09                5096
memcached.replacebykey.php                         30-Sep-2022 11:09                6420
memcached.requirements.php                         30-Sep-2022 11:09                1676
memcached.resetserverlist.php                      30-Sep-2022 11:09                3244
memcached.resources.php                            30-Sep-2022 11:09                1339
memcached.sessions.php                             30-Sep-2022 11:09                2907
memcached.set.php                                  30-Sep-2022 11:09               10054
memcached.setbykey.php                             30-Sep-2022 11:09                7848
memcached.setmulti.php                             30-Sep-2022 11:09                6818
memcached.setmultibykey.php                        30-Sep-2022 11:09                5564
memcached.setoption.php                            30-Sep-2022 11:09                8050
memcached.setoptions.php                           30-Sep-2022 11:09                7407
memcached.setsaslauthdata.php                      30-Sep-2022 11:09                3605
memcached.setup.php                                30-Sep-2022 11:09                1701
memcached.touch.php                                30-Sep-2022 11:09                3989
memcached.touchbykey.php                           30-Sep-2022 11:09                5184
messageformatter.create.php                        30-Sep-2022 11:09               11803
messageformatter.format.php                        30-Sep-2022 11:09               10495
messageformatter.formatmessage.php                 30-Sep-2022 11:09               10941
messageformatter.geterrorcode.php                  30-Sep-2022 11:09                4324
messageformatter.geterrormessage.php               30-Sep-2022 11:09                8370
messageformatter.getlocale.php                     30-Sep-2022 11:09                5991
messageformatter.getpattern.php                    30-Sep-2022 11:09               11108
messageformatter.parse.php                         30-Sep-2022 11:09               10482
messageformatter.parsemessage.php                  30-Sep-2022 11:09               11157
messageformatter.setpattern.php                    30-Sep-2022 11:09               11719
mhash.configuration.php                            30-Sep-2022 11:09                1365
mhash.constants.php                                30-Sep-2022 11:09                5202
mhash.examples.php                                 30-Sep-2022 11:09                3556
mhash.installation.php                             30-Sep-2022 11:09                1880
mhash.requirements.php                             30-Sep-2022 11:09                1354
mhash.resources.php                                30-Sep-2022 11:09                1311
mhash.setup.php                                    30-Sep-2022 11:09                1651
migration56.changed-functions.php                  30-Sep-2022 11:09                7546
migration56.constants.php                          30-Sep-2022 11:09                5285
migration56.deprecated.php                         30-Sep-2022 11:09                6773
migration56.extensions.php                         30-Sep-2022 11:09                4943
migration56.incompatible.php                       30-Sep-2022 11:09               10768
migration56.new-features.php                       30-Sep-2022 11:09               34392
migration56.new-functions.php                      30-Sep-2022 11:09                7593
migration56.openssl.php                            30-Sep-2022 11:09               30285
migration56.php                                    30-Sep-2022 11:09                2928
migration70.changed-functions.php                  30-Sep-2022 11:09                5937
migration70.classes.php                            30-Sep-2022 11:09                4039
migration70.constants.php                          30-Sep-2022 11:09                7207
migration70.deprecated.php                         30-Sep-2022 11:09                6855
migration70.incompatible.php                       30-Sep-2022 11:09               73186
migration70.new-features.php                       30-Sep-2022 11:09               50335
migration70.new-functions.php                      30-Sep-2022 11:09                7647
migration70.other-changes.php                      30-Sep-2022 11:09                4263
migration70.php                                    30-Sep-2022 11:09                3569
migration70.removed-exts-sapis.php                 30-Sep-2022 11:09                3217
migration70.sapi-changes.php                       30-Sep-2022 11:09                2216
migration71.changed-functions.php                  30-Sep-2022 11:09                8774
migration71.constants.php                          30-Sep-2022 11:09                7399
migration71.deprecated.php                         30-Sep-2022 11:09                2607
migration71.incompatible.php                       30-Sep-2022 11:09               39461
migration71.new-features.php                       30-Sep-2022 11:09               31600
migration71.new-functions.php                      30-Sep-2022 11:09                5139
migration71.other-changes.php                      30-Sep-2022 11:09               10431
migration71.php                                    30-Sep-2022 11:09                2902
migration71.windows-support.php                    30-Sep-2022 11:09               10136
migration72.constants.php                          30-Sep-2022 11:09               24829
migration72.deprecated.php                         30-Sep-2022 11:09               13423
migration72.incompatible.php                       30-Sep-2022 11:09               23542
migration72.new-features.php                       30-Sep-2022 11:09               21565
migration72.new-functions.php                      30-Sep-2022 11:09               24488
migration72.other-changes.php                      30-Sep-2022 11:09                6720
migration72.php                                    30-Sep-2022 11:09                2767
migration73.constants.php                          30-Sep-2022 11:09               17982
migration73.deprecated.php                         30-Sep-2022 11:09               10187
migration73.incompatible.php                       30-Sep-2022 11:09               23599
migration73.new-features.php                       30-Sep-2022 11:09               19981
migration73.new-functions.php                      30-Sep-2022 11:09                7645
migration73.other-changes.php                      30-Sep-2022 11:09               19074
migration73.php                                    30-Sep-2022 11:09                2911
migration73.windows-support.php                    30-Sep-2022 11:09                2266
migration74.constants.php                          30-Sep-2022 11:09                6036
migration74.deprecated.php                         30-Sep-2022 11:09               18718
migration74.incompatible.php                       30-Sep-2022 11:09               22004
migration74.new-classes.php                        30-Sep-2022 11:09                1563
migration74.new-features.php                       30-Sep-2022 11:09               26583
migration74.new-functions.php                      30-Sep-2022 11:09                3832
migration74.other-changes.php                      30-Sep-2022 11:09               25608
migration74.php                                    30-Sep-2022 11:09                3144
migration74.removed-extensions.php                 30-Sep-2022 11:09                2209
migration74.windows-support.php                    30-Sep-2022 11:09                4759
migration80.deprecated.php                         30-Sep-2022 11:09               21475
migration80.incompatible.php                       30-Sep-2022 11:09              115755
migration80.new-features.php                       30-Sep-2022 11:09               39130
migration80.other-changes.php                      30-Sep-2022 11:09               17134
migration80.php                                    30-Sep-2022 11:09                2745
migration81.constants.php                          30-Sep-2022 11:09                6658
migration81.deprecated.php                         30-Sep-2022 11:09               21128
migration81.incompatible.php                       30-Sep-2022 11:09               28132
migration81.new-classes.php                        30-Sep-2022 11:09                2208
migration81.new-features.php                       30-Sep-2022 11:09               27872
migration81.new-functions.php                      30-Sep-2022 11:09                8617
migration81.other-changes.php                      30-Sep-2022 11:09               12118
migration81.php                                    30-Sep-2022 11:09                3030
migration82.constants.php                          30-Sep-2022 11:09               16278
migration82.deprecated.php                         30-Sep-2022 11:09                7391
migration82.incompatible.php                       30-Sep-2022 11:09                8154
migration82.new-features.php                       30-Sep-2022 11:09                6806
migration82.new-functions.php                      30-Sep-2022 11:09                3476
migration82.other-changes.php                      30-Sep-2022 11:09               25034
migration82.php                                    30-Sep-2022 11:09                2953
migration82.windows-support.php                    30-Sep-2022 11:09                2716
misc.configuration.php                             30-Sep-2022 11:09                5825
misc.constants.php                                 30-Sep-2022 11:09                2410
misc.installation.php                              30-Sep-2022 11:09                1360
misc.requirements.php                              30-Sep-2022 11:09                1251
misc.resources.php                                 30-Sep-2022 11:09                1304
misc.setup.php                                     30-Sep-2022 11:09                1622
mongodb-bson-binary.construct.php                  30-Sep-2022 11:09                7517
mongodb-bson-binary.getdata.php                    30-Sep-2022 11:09                4890
mongodb-bson-binary.gettype.php                    30-Sep-2022 11:09                4862
mongodb-bson-binary.jsonserialize.php              30-Sep-2022 11:09                6133
mongodb-bson-binary.serialize.php                  30-Sep-2022 11:09                3745
mongodb-bson-binary.tostring.php                   30-Sep-2022 11:09                4662
mongodb-bson-binary.unserialize.php                30-Sep-2022 11:09                4783
mongodb-bson-binaryinterface.getdata.php           30-Sep-2022 11:09                2893
mongodb-bson-binaryinterface.gettype.php           30-Sep-2022 11:09                2887
mongodb-bson-binaryinterface.tostring.php          30-Sep-2022 11:09                3419
mongodb-bson-dbpointer.construct.php               30-Sep-2022 11:09                2824
mongodb-bson-dbpointer.jsonserialize.php           30-Sep-2022 11:09                6208
mongodb-bson-dbpointer.serialize.php               30-Sep-2022 11:09                3820
mongodb-bson-dbpointer.tostring.php                30-Sep-2022 11:09                2746
mongodb-bson-dbpointer.unserialize.php             30-Sep-2022 11:09                4069
mongodb-bson-decimal128.construct.php              30-Sep-2022 11:09                6524
mongodb-bson-decimal128.jsonserialize.php          30-Sep-2022 11:09                6214
mongodb-bson-decimal128.serialize.php              30-Sep-2022 11:09                3849
mongodb-bson-decimal128.tostring.php               30-Sep-2022 11:09                5207
mongodb-bson-decimal128.unserialize.php            30-Sep-2022 11:09                4923
mongodb-bson-decimal128interface.tostring.php      30-Sep-2022 11:09                3096
mongodb-bson-int64.construct.php                   30-Sep-2022 11:09                2826
mongodb-bson-int64.jsonserialize.php               30-Sep-2022 11:09                5965
mongodb-bson-int64.serialize.php                   30-Sep-2022 11:09                3720
mongodb-bson-int64.tostring.php                    30-Sep-2022 11:09                4085
mongodb-bson-int64.unserialize.php                 30-Sep-2022 11:09                4799
mongodb-bson-javascript.construct.php              30-Sep-2022 11:09                7599
mongodb-bson-javascript.getcode.php                30-Sep-2022 11:09                4726
mongodb-bson-javascript.getscope.php               30-Sep-2022 11:09                5860
mongodb-bson-javascript.jsonserialize.php          30-Sep-2022 11:09                6208
mongodb-bson-javascript.serialize.php              30-Sep-2022 11:09                3853
mongodb-bson-javascript.tostring.php               30-Sep-2022 11:09                4514
mongodb-bson-javascript.unserialize.php            30-Sep-2022 11:09                4871
mongodb-bson-javascriptinterface.getcode.php       30-Sep-2022 11:09                2969
mongodb-bson-javascriptinterface.getscope.php      30-Sep-2022 11:09                3167
mongodb-bson-javascriptinterface.tostring.php      30-Sep-2022 11:09                3493
mongodb-bson-maxkey.construct.php                  30-Sep-2022 11:09                3979
mongodb-bson-maxkey.jsonserialize.php              30-Sep-2022 11:09                6148
mongodb-bson-maxkey.serialize.php                  30-Sep-2022 11:09                3749
mongodb-bson-maxkey.unserialize.php                30-Sep-2022 11:09                3996
mongodb-bson-minkey.construct.php                  30-Sep-2022 11:09                3979
mongodb-bson-minkey.jsonserialize.php              30-Sep-2022 11:09                6148
mongodb-bson-minkey.serialize.php                  30-Sep-2022 11:09                3749
mongodb-bson-minkey.unserialize.php                30-Sep-2022 11:09                4002
mongodb-bson-objectid.construct.php                30-Sep-2022 11:09                5762
mongodb-bson-objectid.gettimestamp.php             30-Sep-2022 11:09                6472
mongodb-bson-objectid.jsonserialize.php            30-Sep-2022 11:09                6191
mongodb-bson-objectid.serialize.php                30-Sep-2022 11:09                3795
mongodb-bson-objectid.tostring.php                 30-Sep-2022 11:09                4705
mongodb-bson-objectid.unserialize.php              30-Sep-2022 11:09                4877
mongodb-bson-objectidinterface.gettimestamp.php    30-Sep-2022 11:09                3090
mongodb-bson-objectidinterface.tostring.php        30-Sep-2022 11:09                3113
mongodb-bson-regex.construct.php                   30-Sep-2022 11:09                7699
mongodb-bson-regex.getflags.php                    30-Sep-2022 11:09                4917
mongodb-bson-regex.getpattern.php                  30-Sep-2022 11:09                4719
mongodb-bson-regex.jsonserialize.php               30-Sep-2022 11:09                6127
mongodb-bson-regex.serialize.php                   30-Sep-2022 11:09                3720
mongodb-bson-regex.tostring.php                    30-Sep-2022 11:09                4192
mongodb-bson-regex.unserialize.php                 30-Sep-2022 11:09                4759
mongodb-bson-regexinterface.getflags.php           30-Sep-2022 11:09                2883
mongodb-bson-regexinterface.getpattern.php         30-Sep-2022 11:09                2926
mongodb-bson-regexinterface.tostring.php           30-Sep-2022 11:09                3006
mongodb-bson-serializable.bsonserialize.php        30-Sep-2022 11:09               17491
mongodb-bson-symbol.construct.php                  30-Sep-2022 11:09                2767
mongodb-bson-symbol.jsonserialize.php              30-Sep-2022 11:09                6148
mongodb-bson-symbol.serialize.php                  30-Sep-2022 11:09                3745
mongodb-bson-symbol.tostring.php                   30-Sep-2022 11:09                2728
mongodb-bson-symbol.unserialize.php                30-Sep-2022 11:09                4004
mongodb-bson-timestamp.construct.php               30-Sep-2022 11:09                5116
mongodb-bson-timestamp.getincrement.php            30-Sep-2022 11:09                5135
mongodb-bson-timestamp.gettimestamp.php            30-Sep-2022 11:09                5131
mongodb-bson-timestamp.jsonserialize.php           30-Sep-2022 11:09                6215
mongodb-bson-timestamp.serialize.php               30-Sep-2022 11:09                3820
mongodb-bson-timestamp.tostring.php                30-Sep-2022 11:09                4361
mongodb-bson-timestamp.unserialize.php             30-Sep-2022 11:09                4855
mongodb-bson-timestampinterface.getincrement.php   30-Sep-2022 11:09                3679
mongodb-bson-timestampinterface.gettimestamp.php   30-Sep-2022 11:09                3713
mongodb-bson-timestampinterface.tostring.php       30-Sep-2022 11:09                3098
mongodb-bson-undefined.construct.php               30-Sep-2022 11:09                2827
mongodb-bson-undefined.jsonserialize.php           30-Sep-2022 11:09                6211
mongodb-bson-undefined.serialize.php               30-Sep-2022 11:09                3820
mongodb-bson-undefined.tostring.php                30-Sep-2022 11:09                2749
mongodb-bson-undefined.unserialize.php             30-Sep-2022 11:09                4066
mongodb-bson-unserializable.bsonunserialize.php    30-Sep-2022 11:09                8099
mongodb-bson-utcdatetime.construct.php             30-Sep-2022 11:09                9040
mongodb-bson-utcdatetime.jsonserialize.php         30-Sep-2022 11:09                6253
mongodb-bson-utcdatetime.serialize.php             30-Sep-2022 11:09                3872
mongodb-bson-utcdatetime.todatetime.php            30-Sep-2022 11:09                6336
mongodb-bson-utcdatetime.tostring.php              30-Sep-2022 11:09                4285
mongodb-bson-utcdatetime.unserialize.php           30-Sep-2022 11:09                4887
mongodb-bson-utcdatetimeinterface.todatetime.php   30-Sep-2022 11:09                3481
mongodb-bson-utcdatetimeinterface.tostring.php     30-Sep-2022 11:09                3114
mongodb-driver-bulkwrite.construct.php             30-Sep-2022 11:09               21826
mongodb-driver-bulkwrite.count.php                 30-Sep-2022 11:09                7685
mongodb-driver-bulkwrite.delete.php                30-Sep-2022 11:09               12830
mongodb-driver-bulkwrite.insert.php                30-Sep-2022 11:09               10607
mongodb-driver-bulkwrite.update.php                30-Sep-2022 11:09               17038
mongodb-driver-clientencryption.construct.php      30-Sep-2022 11:09                9788
mongodb-driver-clientencryption.createdatakey.php  30-Sep-2022 11:09               11942
mongodb-driver-clientencryption.decrypt.php        30-Sep-2022 11:09                4651
mongodb-driver-clientencryption.encrypt.php        30-Sep-2022 11:09               11439
mongodb-driver-command.construct.php               30-Sep-2022 11:09               16691
mongodb-driver-commandexception.getresultdocume..> 30-Sep-2022 11:09                3448
mongodb-driver-cursor.construct.php                30-Sep-2022 11:09                3695
mongodb-driver-cursor.current.php                  30-Sep-2022 11:09                3127
mongodb-driver-cursor.getid.php                    30-Sep-2022 11:09                8942
mongodb-driver-cursor.getserver.php                30-Sep-2022 11:09                8324
mongodb-driver-cursor.isdead.php                   30-Sep-2022 11:09               12450
mongodb-driver-cursor.key.php                      30-Sep-2022 11:09                2760
mongodb-driver-cursor.next.php                     30-Sep-2022 11:09                3898
mongodb-driver-cursor.rewind.php                   30-Sep-2022 11:09                4475
mongodb-driver-cursor.settypemap.php               30-Sep-2022 11:09                9030
mongodb-driver-cursor.toarray.php                  30-Sep-2022 11:09                8611
mongodb-driver-cursor.valid.php                    30-Sep-2022 11:09                2846
mongodb-driver-cursorid.construct.php              30-Sep-2022 11:09                3000
mongodb-driver-cursorid.serialize.php              30-Sep-2022 11:09                3847
mongodb-driver-cursorid.tostring.php               30-Sep-2022 11:09                8020
mongodb-driver-cursorid.unserialize.php            30-Sep-2022 11:09                4979
mongodb-driver-cursorinterface.getid.php           30-Sep-2022 11:09                4400
mongodb-driver-cursorinterface.getserver.php       30-Sep-2022 11:09                4409
mongodb-driver-cursorinterface.isdead.php          30-Sep-2022 11:09                4720
mongodb-driver-cursorinterface.settypemap.php      30-Sep-2022 11:09                4369
mongodb-driver-cursorinterface.toarray.php         30-Sep-2022 11:09                4262
mongodb-driver-manager.addsubscriber.php           30-Sep-2022 11:09                6084
mongodb-driver-manager.construct.php               30-Sep-2022 11:09               91764
mongodb-driver-manager.createclientencryption.php  30-Sep-2022 11:09               12034
mongodb-driver-manager.executebulkwrite.php        30-Sep-2022 11:09               26580
mongodb-driver-manager.executecommand.php          30-Sep-2022 11:09               28743
mongodb-driver-manager.executequery.php            30-Sep-2022 11:09               18368
mongodb-driver-manager.executereadcommand.php      30-Sep-2022 11:09               11176
mongodb-driver-manager.executereadwritecommand.php 30-Sep-2022 11:09               12202
mongodb-driver-manager.executewritecommand.php     30-Sep-2022 11:09               12350
mongodb-driver-manager.getencryptedfieldsmap.php   30-Sep-2022 11:09                4027
mongodb-driver-manager.getreadconcern.php          30-Sep-2022 11:09                6559
mongodb-driver-manager.getreadpreference.php       30-Sep-2022 11:09                7180
mongodb-driver-manager.getservers.php              30-Sep-2022 11:09                8843
mongodb-driver-manager.getwriteconcern.php         30-Sep-2022 11:09                6613
mongodb-driver-manager.removesubscriber.php        30-Sep-2022 11:09                5792
mongodb-driver-manager.selectserver.php            30-Sep-2022 11:09                8205
mongodb-driver-manager.startsession.php            30-Sep-2022 11:09               13698
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                3957
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                4168
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                3974
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                5685
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                4412
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                4667
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                4610
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                4262
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:09                4126
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:09                4366
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:09                3989
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:09                3923
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:09                6054
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:09                5197
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:09                4961
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:09                4287
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:09                4146
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:09                5501
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:09                5518
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:09                5555
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:09                4014
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:09                4237
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:09                5772
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:09                4438
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:09                4730
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:09                5221
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:09                4327
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:09                4172
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:09                5287
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:09                5225
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:09                5871
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:09                5876
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:09                5927
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:09                5271
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:09                5348
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:09                5280
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:09                5269
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:09                3279
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:09                3670
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:09                3395
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:09                3757
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:09                3524
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:09                3241
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:09                3339
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:09                3480
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:09                3879
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:09                3726
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:09                3416
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:09                3493
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:09                3858
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:09                3421
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:09                3511
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:09                3878
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:09                3931
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:09                3488
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:09                3545
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:09                4585
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:09                3894
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:09                3259
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:09                3357
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:09                3405
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:09                3743
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:09                3831
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:09                3511
mongodb-driver-monitoring-topologyclosedevent.g..> 30-Sep-2022 11:09                3456
mongodb-driver-monitoring-topologyopeningevent...> 30-Sep-2022 11:09                3466
mongodb-driver-query.construct.php                 30-Sep-2022 11:09               37786
mongodb-driver-readconcern.bsonserialize.php       30-Sep-2022 11:09                8328
mongodb-driver-readconcern.construct.php           30-Sep-2022 11:09                7026
mongodb-driver-readconcern.getlevel.php            30-Sep-2022 11:09                6686
mongodb-driver-readconcern.isdefault.php           30-Sep-2022 11:09                9677
mongodb-driver-readconcern.serialize.php           30-Sep-2022 11:09                3924
mongodb-driver-readconcern.unserialize.php         30-Sep-2022 11:09                5030
mongodb-driver-readpreference.bsonserialize.php    30-Sep-2022 11:09               13175
mongodb-driver-readpreference.construct.php        30-Sep-2022 11:09               21471
mongodb-driver-readpreference.gethedge.php         30-Sep-2022 11:09                3498
mongodb-driver-readpreference.getmaxstalenessse..> 30-Sep-2022 11:09                9910
mongodb-driver-readpreference.getmode.php          30-Sep-2022 11:09                9266
mongodb-driver-readpreference.getmodestring.php    30-Sep-2022 11:09                9473
mongodb-driver-readpreference.gettagsets.php       30-Sep-2022 11:09                9781
mongodb-driver-readpreference.serialize.php        30-Sep-2022 11:09                4001
mongodb-driver-readpreference.unserialize.php      30-Sep-2022 11:09                5108
mongodb-driver-runtimeexception.haserrorlabel.php  30-Sep-2022 11:09                4791
mongodb-driver-server.construct.php                30-Sep-2022 11:09                3640
mongodb-driver-server.executebulkwrite.php         30-Sep-2022 11:09               13256
mongodb-driver-server.executecommand.php           30-Sep-2022 11:09               14985
mongodb-driver-server.executequery.php             30-Sep-2022 11:09                9240
mongodb-driver-server.executereadcommand.php       30-Sep-2022 11:09               11782
mongodb-driver-server.executereadwritecommand.php  30-Sep-2022 11:09               12911
mongodb-driver-server.executewritecommand.php      30-Sep-2022 11:09               13072
mongodb-driver-server.gethost.php                  30-Sep-2022 11:09                6194
mongodb-driver-server.getinfo.php                  30-Sep-2022 11:09               11801
mongodb-driver-server.getlatency.php               30-Sep-2022 11:09                8113
mongodb-driver-server.getport.php                  30-Sep-2022 11:09                6291
mongodb-driver-server.getserverdescription.php     30-Sep-2022 11:09                3630
mongodb-driver-server.gettags.php                  30-Sep-2022 11:09                3966
mongodb-driver-server.gettype.php                  30-Sep-2022 11:09                4053
mongodb-driver-server.isarbiter.php                30-Sep-2022 11:09                3860
mongodb-driver-server.ishidden.php                 30-Sep-2022 11:09                3851
mongodb-driver-server.ispassive.php                30-Sep-2022 11:09                3958
mongodb-driver-server.isprimary.php                30-Sep-2022 11:09                3867
mongodb-driver-server.issecondary.php              30-Sep-2022 11:09                3941
mongodb-driver-serverapi.bsonserialize.php         30-Sep-2022 11:09                3513
mongodb-driver-serverapi.construct.php             30-Sep-2022 11:09                3269
mongodb-driver-serverapi.serialize.php             30-Sep-2022 11:09                3873
mongodb-driver-serverapi.unserialize.php           30-Sep-2022 11:09                4952
mongodb-driver-serverdescription.gethellorespon..> 30-Sep-2022 11:09                5788
mongodb-driver-serverdescription.gethost.php       30-Sep-2022 11:09                3607
mongodb-driver-serverdescription.getlastupdatet..> 30-Sep-2022 11:09                4075
mongodb-driver-serverdescription.getport.php       30-Sep-2022 11:09                3780
mongodb-driver-serverdescription.getroundtripti..> 30-Sep-2022 11:09                4069
mongodb-driver-serverdescription.gettype.php       30-Sep-2022 11:09                4047
mongodb-driver-session.aborttransaction.php        30-Sep-2022 11:09                4843
mongodb-driver-session.advanceclustertime.php      30-Sep-2022 11:09                5446
mongodb-driver-session.advanceoperationtime.php    30-Sep-2022 11:09                5476
mongodb-driver-session.committransaction.php       30-Sep-2022 11:09                6561
mongodb-driver-session.construct.php               30-Sep-2022 11:09                3097
mongodb-driver-session.endsession.php              30-Sep-2022 11:09                4967
mongodb-driver-session.getclustertime.php          30-Sep-2022 11:09                4154
mongodb-driver-session.getlogicalsessionid.php     30-Sep-2022 11:09                3450
mongodb-driver-session.getoperationtime.php        30-Sep-2022 11:09                4280
mongodb-driver-session.getserver.php               30-Sep-2022 11:09                4402
mongodb-driver-session.gettransactionoptions.php   30-Sep-2022 11:09                3898
mongodb-driver-session.gettransactionstate.php     30-Sep-2022 11:09                4043
mongodb-driver-session.isdirty.php                 30-Sep-2022 11:09                3272
mongodb-driver-session.isintransaction.php         30-Sep-2022 11:09                4029
mongodb-driver-session.starttransaction.php        30-Sep-2022 11:09               10138
mongodb-driver-topologydescription.getservers.php  30-Sep-2022 11:09                3666
mongodb-driver-topologydescription.gettype.php     30-Sep-2022 11:09                3602
mongodb-driver-topologydescription.hasreadables..> 30-Sep-2022 11:09                4273
mongodb-driver-topologydescription.haswritables..> 30-Sep-2022 11:09                3467
mongodb-driver-writeconcern.bsonserialize.php      30-Sep-2022 11:09                8713
mongodb-driver-writeconcern.construct.php          30-Sep-2022 11:09               12455
mongodb-driver-writeconcern.getjournal.php         30-Sep-2022 11:09                6610
mongodb-driver-writeconcern.getw.php               30-Sep-2022 11:09                5806
mongodb-driver-writeconcern.getwtimeout.php        30-Sep-2022 11:09                6723
mongodb-driver-writeconcern.isdefault.php          30-Sep-2022 11:09                9276
mongodb-driver-writeconcern.serialize.php          30-Sep-2022 11:09                3949
mongodb-driver-writeconcern.unserialize.php        30-Sep-2022 11:09                5069
mongodb-driver-writeconcernerror.getcode.php       30-Sep-2022 11:09                7315
mongodb-driver-writeconcernerror.getinfo.php       30-Sep-2022 11:09                7583
mongodb-driver-writeconcernerror.getmessage.php    30-Sep-2022 11:09                7432
mongodb-driver-writeerror.getcode.php              30-Sep-2022 11:09                6441
mongodb-driver-writeerror.getindex.php             30-Sep-2022 11:09                7037
mongodb-driver-writeerror.getinfo.php              30-Sep-2022 11:09                3171
mongodb-driver-writeerror.getmessage.php           30-Sep-2022 11:09                6603
mongodb-driver-writeexception.getwriteresult.php   30-Sep-2022 11:09                9237
mongodb-driver-writeresult.getdeletedcount.php     30-Sep-2022 11:09                8819
mongodb-driver-writeresult.getinsertedcount.php    30-Sep-2022 11:09                8935
mongodb-driver-writeresult.getmatchedcount.php     30-Sep-2022 11:09                9749
mongodb-driver-writeresult.getmodifiedcount.php    30-Sep-2022 11:09               10144
mongodb-driver-writeresult.getserver.php           30-Sep-2022 11:09                7532
mongodb-driver-writeresult.getupsertedcount.php    30-Sep-2022 11:09                9105
mongodb-driver-writeresult.getupsertedids.php      30-Sep-2022 11:09                9769
mongodb-driver-writeresult.getwriteconcernerror..> 30-Sep-2022 11:09                8286
mongodb-driver-writeresult.getwriteerrors.php      30-Sep-2022 11:09               15188
mongodb-driver-writeresult.isacknowledged.php      30-Sep-2022 11:09                9364
mongodb.architecture.php                           30-Sep-2022 11:09                2230
mongodb.configuration.php                          30-Sep-2022 11:09                4884
mongodb.connection-handling.php                    30-Sep-2022 11:09               12095
mongodb.constants.php                              30-Sep-2022 11:09                2268
mongodb.exceptions.php                             30-Sep-2022 11:09                5295
mongodb.exceptions.tree.php                        30-Sep-2022 11:09                5518
mongodb.installation.homebrew.php                  30-Sep-2022 11:09                2337
mongodb.installation.manual.php                    30-Sep-2022 11:09                8224
mongodb.installation.pecl.php                      30-Sep-2022 11:09                4572
mongodb.installation.php                           30-Sep-2022 11:09                1938
mongodb.installation.windows.php                   30-Sep-2022 11:09                3695
mongodb.monitoring.php                             30-Sep-2022 11:09               21277
mongodb.overview.php                               30-Sep-2022 11:09               10486
mongodb.persistence.deserialization.php            30-Sep-2022 11:09               24185
mongodb.persistence.php                            30-Sep-2022 11:09                2054
mongodb.persistence.serialization.php              30-Sep-2022 11:09               25974
mongodb.requirements.php                           30-Sep-2022 11:09                4232
mongodb.security.php                               30-Sep-2022 11:09                1646
mongodb.security.request_injection.php             30-Sep-2022 11:09                4021
mongodb.security.script_injection.php              30-Sep-2022 11:09               12045
mongodb.setup.php                                  30-Sep-2022 11:09                2229
mongodb.tutorial.apm.php                           30-Sep-2022 11:09               25780
mongodb.tutorial.library.php                       30-Sep-2022 11:09               13423
mongodb.tutorial.php                               30-Sep-2022 11:09                2028
mqseries.configure.php                             30-Sep-2022 11:09                3645
mqseries.constants.php                             30-Sep-2022 11:09                2396
mqseries.ini.php                                   30-Sep-2022 11:09                1448
mqseries.requirements.php                          30-Sep-2022 11:09                1803
mqseries.resources.php                             30-Sep-2022 11:09                1863
mqseries.setup.php                                 30-Sep-2022 11:09                1686
multipleiterator.attachiterator.php                30-Sep-2022 11:09                4646
multipleiterator.construct.php                     30-Sep-2022 11:09                8383
multipleiterator.containsiterator.php              30-Sep-2022 11:09                3733
multipleiterator.countiterators.php                30-Sep-2022 11:09                3333
multipleiterator.current.php                       30-Sep-2022 11:09                5083
multipleiterator.detachiterator.php                30-Sep-2022 11:09                3535
multipleiterator.getflags.php                      30-Sep-2022 11:09                3520
multipleiterator.key.php                           30-Sep-2022 11:09                4932
multipleiterator.next.php                          30-Sep-2022 11:09                3319
multipleiterator.rewind.php                        30-Sep-2022 11:09                3307
multipleiterator.setflags.php                      30-Sep-2022 11:09                3924
multipleiterator.valid.php                         30-Sep-2022 11:09                3318
mysql-xdevapi-baseresult.getwarnings.php           30-Sep-2022 11:09                7485
mysql-xdevapi-baseresult.getwarningscount.php      30-Sep-2022 11:09                7167
mysql-xdevapi-client.close.php                     30-Sep-2022 11:09                2472
mysql-xdevapi-client.construct.php                 30-Sep-2022 11:09                3732
mysql-xdevapi-client.getsession.php                30-Sep-2022 11:09                2513
mysql-xdevapi-collection.add.php                   30-Sep-2022 11:09               11238
mysql-xdevapi-collection.addorreplaceone.php       30-Sep-2022 11:09                9880
mysql-xdevapi-collection.construct.php             30-Sep-2022 11:09                7094
mysql-xdevapi-collection.count.php                 30-Sep-2022 11:09                7190
mysql-xdevapi-collection.createindex.php           30-Sep-2022 11:09               11316
mysql-xdevapi-collection.dropindex.php             30-Sep-2022 11:09                7347
mysql-xdevapi-collection.existsindatabase.php      30-Sep-2022 11:09                6643
mysql-xdevapi-collection.find.php                  30-Sep-2022 11:09               10895
mysql-xdevapi-collection.getname.php               30-Sep-2022 11:09                5482
mysql-xdevapi-collection.getone.php                30-Sep-2022 11:09                7842
mysql-xdevapi-collection.getschema.php             30-Sep-2022 11:09                5758
mysql-xdevapi-collection.getsession.php            30-Sep-2022 11:09                5946
mysql-xdevapi-collection.modify.php                30-Sep-2022 11:09                9338
mysql-xdevapi-collection.remove.php                30-Sep-2022 11:09                9681
mysql-xdevapi-collection.removeone.php             30-Sep-2022 11:09                8838
mysql-xdevapi-collection.replaceone.php            30-Sep-2022 11:09                9066
mysql-xdevapi-collectionadd.construct.php          30-Sep-2022 11:09                8915
mysql-xdevapi-collectionadd.execute.php            30-Sep-2022 11:09                8859
mysql-xdevapi-collectionfind.bind.php              30-Sep-2022 11:09                8851
mysql-xdevapi-collectionfind.construct.php         30-Sep-2022 11:09                7553
mysql-xdevapi-collectionfind.execute.php           30-Sep-2022 11:09                7777
mysql-xdevapi-collectionfind.fields.php            30-Sep-2022 11:09                8367
mysql-xdevapi-collectionfind.groupby.php           30-Sep-2022 11:09                4953
mysql-xdevapi-collectionfind.having.php            30-Sep-2022 11:09                5003
mysql-xdevapi-collectionfind.limit.php             30-Sep-2022 11:09                8961
mysql-xdevapi-collectionfind.lockexclusive.php     30-Sep-2022 11:09                7588
mysql-xdevapi-collectionfind.lockshared.php        30-Sep-2022 11:09                7306
mysql-xdevapi-collectionfind.offset.php            30-Sep-2022 11:09                8856
mysql-xdevapi-collectionfind.sort.php              30-Sep-2022 11:09                8963
mysql-xdevapi-collectionmodify.arrayappend.php     30-Sep-2022 11:09                8901
mysql-xdevapi-collectionmodify.arrayinsert.php     30-Sep-2022 11:09                9466
mysql-xdevapi-collectionmodify.bind.php            30-Sep-2022 11:09                9187
mysql-xdevapi-collectionmodify.construct.php       30-Sep-2022 11:09                7333
mysql-xdevapi-collectionmodify.execute.php         30-Sep-2022 11:09                3552
mysql-xdevapi-collectionmodify.limit.php           30-Sep-2022 11:09                9345
mysql-xdevapi-collectionmodify.patch.php           30-Sep-2022 11:09                4620
mysql-xdevapi-collectionmodify.replace.php         30-Sep-2022 11:09                8472
mysql-xdevapi-collectionmodify.set.php             30-Sep-2022 11:09                8421
mysql-xdevapi-collectionmodify.skip.php            30-Sep-2022 11:09                5400
mysql-xdevapi-collectionmodify.sort.php            30-Sep-2022 11:09                5467
mysql-xdevapi-collectionmodify.unset.php           30-Sep-2022 11:09                4869
mysql-xdevapi-collectionremove.bind.php            30-Sep-2022 11:09                5881
mysql-xdevapi-collectionremove.construct.php       30-Sep-2022 11:09                7920
mysql-xdevapi-collectionremove.execute.php         30-Sep-2022 11:09                4377
mysql-xdevapi-collectionremove.limit.php           30-Sep-2022 11:09                5004
mysql-xdevapi-collectionremove.sort.php            30-Sep-2022 11:09                5191
mysql-xdevapi-columnresult.construct.php           30-Sep-2022 11:09               10409
mysql-xdevapi-columnresult.getcharactersetname.php 30-Sep-2022 11:09                3513
mysql-xdevapi-columnresult.getcollationname.php    30-Sep-2022 11:09                3497
mysql-xdevapi-columnresult.getcolumnlabel.php      30-Sep-2022 11:09                3457
mysql-xdevapi-columnresult.getcolumnname.php       30-Sep-2022 11:09                3459
mysql-xdevapi-columnresult.getfractionaldigits.php 30-Sep-2022 11:09                3598
mysql-xdevapi-columnresult.getlength.php           30-Sep-2022 11:09                3409
mysql-xdevapi-columnresult.getschemaname.php       30-Sep-2022 11:09                3522
mysql-xdevapi-columnresult.gettablelabel.php       30-Sep-2022 11:09                3437
mysql-xdevapi-columnresult.gettablename.php        30-Sep-2022 11:09                3468
mysql-xdevapi-columnresult.gettype.php             30-Sep-2022 11:09                3360
mysql-xdevapi-columnresult.isnumbersigned.php      30-Sep-2022 11:09                3717
mysql-xdevapi-columnresult.ispadded.php            30-Sep-2022 11:09                3496
mysql-xdevapi-crudoperationbindable.bind.php       30-Sep-2022 11:09                6140
mysql-xdevapi-crudoperationlimitable.limit.php     30-Sep-2022 11:09                6284
mysql-xdevapi-crudoperationskippable.skip.php      30-Sep-2022 11:09                4911
mysql-xdevapi-crudoperationsortable.sort.php       30-Sep-2022 11:09                5155
mysql-xdevapi-databaseobject.existsindatabase.php  30-Sep-2022 11:09                3803
mysql-xdevapi-databaseobject.getname.php           30-Sep-2022 11:09                3720
mysql-xdevapi-databaseobject.getsession.php        30-Sep-2022 11:09                3829
mysql-xdevapi-docresult.construct.php              30-Sep-2022 11:09                8021
mysql-xdevapi-docresult.fetchall.php               30-Sep-2022 11:09                8661
mysql-xdevapi-docresult.fetchone.php               30-Sep-2022 11:09                8225
mysql-xdevapi-docresult.getwarnings.php            30-Sep-2022 11:09                9311
mysql-xdevapi-docresult.getwarningscount.php       30-Sep-2022 11:09                9140
mysql-xdevapi-executable.execute.php               30-Sep-2022 11:09                7082
mysql-xdevapi-executionstatus.construct.php        30-Sep-2022 11:09                3209
mysql-xdevapi-expression.construct.php             30-Sep-2022 11:09                3280
mysql-xdevapi-result.construct.php                 30-Sep-2022 11:09                7597
mysql-xdevapi-result.getaffecteditemscount.php     30-Sep-2022 11:09                6432
mysql-xdevapi-result.getautoincrementvalue.php     30-Sep-2022 11:09                7950
mysql-xdevapi-result.getgeneratedids.php           30-Sep-2022 11:09                7343
mysql-xdevapi-result.getwarnings.php               30-Sep-2022 11:09                7294
mysql-xdevapi-result.getwarningscount.php          30-Sep-2022 11:09                6979
mysql-xdevapi-rowresult.construct.php              30-Sep-2022 11:09                5247
mysql-xdevapi-rowresult.fetchall.php               30-Sep-2022 11:09                7089
mysql-xdevapi-rowresult.fetchone.php               30-Sep-2022 11:09                7321
mysql-xdevapi-rowresult.getcolumncount.php         30-Sep-2022 11:09                6523
mysql-xdevapi-rowresult.getcolumnnames.php         30-Sep-2022 11:09                6648
mysql-xdevapi-rowresult.getcolumns.php             30-Sep-2022 11:09                7628
mysql-xdevapi-rowresult.getwarnings.php            30-Sep-2022 11:09                7346
mysql-xdevapi-rowresult.getwarningscount.php       30-Sep-2022 11:09                7024
mysql-xdevapi-schema.construct.php                 30-Sep-2022 11:09                5799
mysql-xdevapi-schema.createcollection.php          30-Sep-2022 11:09               10764
mysql-xdevapi-schema.dropcollection.php            30-Sep-2022 11:09                7025
mysql-xdevapi-schema.existsindatabase.php          30-Sep-2022 11:09                7245
mysql-xdevapi-schema.getcollection.php             30-Sep-2022 11:09                5992
mysql-xdevapi-schema.getcollectionastable.php      30-Sep-2022 11:09                7674
mysql-xdevapi-schema.getcollections.php            30-Sep-2022 11:09                6763
mysql-xdevapi-schema.getname.php                   30-Sep-2022 11:09                5050
mysql-xdevapi-schema.getsession.php                30-Sep-2022 11:09                5550
mysql-xdevapi-schema.gettable.php                  30-Sep-2022 11:09                7110
mysql-xdevapi-schema.gettables.php                 30-Sep-2022 11:09                7546
mysql-xdevapi-schemaobject.getschema.php           30-Sep-2022 11:09                4352
mysql-xdevapi-session.close.php                    30-Sep-2022 11:09                4132
mysql-xdevapi-session.commit.php                   30-Sep-2022 11:09                4922
mysql-xdevapi-session.construct.php                30-Sep-2022 11:09                3251
mysql-xdevapi-session.createschema.php             30-Sep-2022 11:09                5315
mysql-xdevapi-session.dropschema.php               30-Sep-2022 11:09                4325
mysql-xdevapi-session.generateuuid.php             30-Sep-2022 11:09                4294
mysql-xdevapi-session.getdefaultschema.php         30-Sep-2022 11:09                4469
mysql-xdevapi-session.getschema.php                30-Sep-2022 11:09                4536
mysql-xdevapi-session.getschemas.php               30-Sep-2022 11:09                4373
mysql-xdevapi-session.getserverversion.php         30-Sep-2022 11:09                4197
mysql-xdevapi-session.listclients.php              30-Sep-2022 11:09                4565
mysql-xdevapi-session.quotename.php                30-Sep-2022 11:09                5765
mysql-xdevapi-session.releasesavepoint.php         30-Sep-2022 11:09                5926
mysql-xdevapi-session.rollback.php                 30-Sep-2022 11:09                5548
mysql-xdevapi-session.rollbackto.php               30-Sep-2022 11:09                5990
mysql-xdevapi-session.setsavepoint.php             30-Sep-2022 11:09                6411
mysql-xdevapi-session.sql.php                      30-Sep-2022 11:09                4216
mysql-xdevapi-session.starttransaction.php         30-Sep-2022 11:09                5631
mysql-xdevapi-sqlstatement.bind.php                30-Sep-2022 11:09                3601
mysql-xdevapi-sqlstatement.construct.php           30-Sep-2022 11:09                3141
mysql-xdevapi-sqlstatement.execute.php             30-Sep-2022 11:09                3447
mysql-xdevapi-sqlstatement.getnextresult.php       30-Sep-2022 11:09                3524
mysql-xdevapi-sqlstatement.getresult.php           30-Sep-2022 11:09                3479
mysql-xdevapi-sqlstatement.hasmoreresults.php      30-Sep-2022 11:09                3612
mysql-xdevapi-sqlstatementresult.construct.php     30-Sep-2022 11:09                3261
mysql-xdevapi-sqlstatementresult.fetchall.php      30-Sep-2022 11:09                7636
mysql-xdevapi-sqlstatementresult.fetchone.php      30-Sep-2022 11:09                7389
mysql-xdevapi-sqlstatementresult.getaffectedite..> 30-Sep-2022 11:09                3666
mysql-xdevapi-sqlstatementresult.getcolumncount..> 30-Sep-2022 11:09                4258
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 30-Sep-2022 11:09                3563
mysql-xdevapi-sqlstatementresult.getcolumns.php    30-Sep-2022 11:09                3511
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 30-Sep-2022 11:09                3770
mysql-xdevapi-sqlstatementresult.getlastinserti..> 30-Sep-2022 11:09                3695
mysql-xdevapi-sqlstatementresult.getwarningcoun..> 30-Sep-2022 11:09                3759