Index of /php.ihc-ru.net/manual/pt_BR/


../
feeds/                                             30-Sep-2022 11:02                   -
images/                                            30-Sep-2022 11:02                   -
styles/                                            30-Sep-2022 11:01                   -
toc/                                               30-Sep-2022 11:02                   -
about.formats.php                                  30-Sep-2022 11:02                4274
about.generate.php                                 30-Sep-2022 11:02                2708
about.howtohelp.php                                30-Sep-2022 11:02                3553
about.more.php                                     30-Sep-2022 11:02                1903
about.notes.php                                    30-Sep-2022 11:02                2482
about.php                                          30-Sep-2022 11:02                1923
about.phpversions.php                              30-Sep-2022 11:02                3562
about.prototypes.php                               30-Sep-2022 11:02                7467
about.translations.php                             30-Sep-2022 11:02                3226
aliases.php                                        30-Sep-2022 11:02               29197
apache.configuration.php                           30-Sep-2022 11:02                5071
apache.constants.php                               30-Sep-2022 11:02                1160
apache.installation.php                            30-Sep-2022 11:02                1310
apache.requirements.php                            30-Sep-2022 11:02                1254
apache.resources.php                               30-Sep-2022 11:02                1238
apache.setup.php                                   30-Sep-2022 11:02                1653
apcu.configuration.php                             30-Sep-2022 11:02               14463
apcu.constants.php                                 30-Sep-2022 11:02                5280
apcu.installation.php                              30-Sep-2022 11:02                3242
apcu.requirements.php                              30-Sep-2022 11:02                1237
apcu.resources.php                                 30-Sep-2022 11:02                1221
apcu.setup.php                                     30-Sep-2022 11:02                1608
apcuiterator.construct.php                         30-Sep-2022 11:02                6401
apcuiterator.current.php                           30-Sep-2022 11:02                2973
apcuiterator.gettotalcount.php                     30-Sep-2022 11:02                3122
apcuiterator.gettotalhits.php                      30-Sep-2022 11:02                3206
apcuiterator.gettotalsize.php                      30-Sep-2022 11:02                2999
apcuiterator.key.php                               30-Sep-2022 11:02                2671
apcuiterator.next.php                              30-Sep-2022 11:02                2900
apcuiterator.rewind.php                            30-Sep-2022 11:02                2677
apcuiterator.valid.php                             30-Sep-2022 11:02                2759
appendices.php                                     30-Sep-2022 11:02               12275
appenditerator.append.php                          30-Sep-2022 11:02                5507
appenditerator.construct.php                       30-Sep-2022 11:02               10536
appenditerator.current.php                         30-Sep-2022 11:02                3480
appenditerator.getarrayiterator.php                30-Sep-2022 11:02                3153
appenditerator.getinneriterator.php                30-Sep-2022 11:02                6826
appenditerator.getiteratorindex.php                30-Sep-2022 11:02                6767
appenditerator.key.php                             30-Sep-2022 11:02                8187
appenditerator.next.php                            30-Sep-2022 11:02                3361
appenditerator.rewind.php                          30-Sep-2022 11:02                3357
appenditerator.valid.php                           30-Sep-2022 11:02                3200
array.configuration.php                            30-Sep-2022 11:02                1307
array.constants.php                                30-Sep-2022 11:02                8571
array.installation.php                             30-Sep-2022 11:02                1279
array.requirements.php                             30-Sep-2022 11:02                1247
array.resources.php                                30-Sep-2022 11:02                1231
array.setup.php                                    30-Sep-2022 11:02                1620
array.sorting.php                                  30-Sep-2022 11:02                6804
arrayaccess.offsetexists.php                       30-Sep-2022 11:01                9295
arrayaccess.offsetget.php                          30-Sep-2022 11:01                5125
arrayaccess.offsetset.php                          30-Sep-2022 11:01                5292
arrayaccess.offsetunset.php                        30-Sep-2022 11:01                2844
arrayiterator.append.php                           30-Sep-2022 11:02                3482
arrayiterator.asort.php                            30-Sep-2022 11:02                5804
arrayiterator.construct.php                        30-Sep-2022 11:02                3526
arrayiterator.count.php                            30-Sep-2022 11:02                2995
arrayiterator.current.php                          30-Sep-2022 11:02                5375
arrayiterator.getarraycopy.php                     30-Sep-2022 11:02                2886
arrayiterator.getflags.php                         30-Sep-2022 11:02                3103
arrayiterator.key.php                              30-Sep-2022 11:02                3824
arrayiterator.ksort.php                            30-Sep-2022 11:02                5744
arrayiterator.natcasesort.php                      30-Sep-2022 11:02                3976
arrayiterator.natsort.php                          30-Sep-2022 11:02                3755
arrayiterator.next.php                             30-Sep-2022 11:02                4674
arrayiterator.offsetexists.php                     30-Sep-2022 11:02                3186
arrayiterator.offsetget.php                        30-Sep-2022 11:02                3432
arrayiterator.offsetset.php                        30-Sep-2022 11:02                3678
arrayiterator.offsetunset.php                      30-Sep-2022 11:02                3770
arrayiterator.rewind.php                           30-Sep-2022 11:02                4627
arrayiterator.seek.php                             30-Sep-2022 11:02                2497
arrayiterator.serialize.php                        30-Sep-2022 11:02                2797
arrayiterator.setflags.php                         30-Sep-2022 11:02                4088
arrayiterator.uasort.php                           30-Sep-2022 11:02                5177
arrayiterator.uksort.php                           30-Sep-2022 11:02                4918
arrayiterator.unserialize.php                      30-Sep-2022 11:02                3020
arrayiterator.valid.php                            30-Sep-2022 11:02                4448
arrayobject.append.php                             30-Sep-2022 11:02                2399
arrayobject.asort.php                              30-Sep-2022 11:02                8824
arrayobject.construct.php                          30-Sep-2022 11:02                4708
arrayobject.count.php                              30-Sep-2022 11:02                2224
arrayobject.exchangearray.php                      30-Sep-2022 11:02                6088
arrayobject.getarraycopy.php                       30-Sep-2022 11:02                5279
arrayobject.getflags.php                           30-Sep-2022 11:02                6165
arrayobject.getiterator.php                        30-Sep-2022 11:02                5463
arrayobject.getiteratorclass.php                   30-Sep-2022 11:02                6728
arrayobject.ksort.php                              30-Sep-2022 11:02                8475
arrayobject.natcasesort.php                        30-Sep-2022 11:02                7592
arrayobject.natsort.php                            30-Sep-2022 11:02                7271
arrayobject.offsetexists.php                       30-Sep-2022 11:02                2704
arrayobject.offsetget.php                          30-Sep-2022 11:02                2685
arrayobject.offsetset.php                          30-Sep-2022 11:02                3103
arrayobject.offsetunset.php                        30-Sep-2022 11:02                2706
arrayobject.serialize.php                          30-Sep-2022 11:02                5015
arrayobject.setflags.php                           30-Sep-2022 11:02                6795
arrayobject.setiteratorclass.php                   30-Sep-2022 11:02                5918
arrayobject.uasort.php                             30-Sep-2022 11:02               10040
arrayobject.uksort.php                             30-Sep-2022 11:02                9347
arrayobject.unserialize.php                        30-Sep-2022 11:02                3427
backedenum.from.php                                30-Sep-2022 11:01                5988
backedenum.tryfrom.php                             30-Sep-2022 11:01                6301
bc.configuration.php                               30-Sep-2022 11:02                2488
bc.constants.php                                   30-Sep-2022 11:02                1134
bc.installation.php                                30-Sep-2022 11:02                1526
bc.requirements.php                                30-Sep-2022 11:02                1301
bc.resources.php                                   30-Sep-2022 11:02                1210
bc.setup.php                                       30-Sep-2022 11:02                1611
book.apache.php                                    30-Sep-2022 11:02                3583
book.apcu.php                                      30-Sep-2022 11:02                4457
book.array.php                                     30-Sep-2022 11:02               12944
book.bc.php                                        30-Sep-2022 11:02                3321
book.bson.php                                      30-Sep-2022 11:02               19876
book.bzip2.php                                     30-Sep-2022 11:02                3117
book.calendar.php                                  30-Sep-2022 11:02                4831
book.classobj.php                                  30-Sep-2022 11:02                4497
book.cmark.php                                     30-Sep-2022 11:02                8763
book.com.php                                       30-Sep-2022 11:02                8012
book.componere.php                                 30-Sep-2022 11:02                6215
book.csprng.php                                    30-Sep-2022 11:02                2261
book.ctype.php                                     30-Sep-2022 11:02                3463
book.cubrid.php                                    30-Sep-2022 11:02               13913
book.curl.php                                      30-Sep-2022 11:02                6730
book.datetime.php                                  30-Sep-2022 11:02               16727
book.dba.php                                       30-Sep-2022 11:02                3516
book.dbase.php                                     30-Sep-2022 11:02                3495
book.dio.php                                       30-Sep-2022 11:02                3053
book.dir.php                                       30-Sep-2022 11:02                2900
book.dom.php                                       30-Sep-2022 11:02               16954
book.ds.php                                        30-Sep-2022 11:02               25135
book.eio.php                                       30-Sep-2022 11:02                8034
book.enchant.php                                   30-Sep-2022 11:02                5478
book.errorfunc.php                                 30-Sep-2022 11:02                3716
book.ev.php                                        30-Sep-2022 11:02               13444
book.event.php                                     30-Sep-2022 11:02               23137
book.exec.php                                      30-Sep-2022 11:02                3396
book.exif.php                                      30-Sep-2022 11:02                2750
book.expect.php                                    30-Sep-2022 11:02                2569
book.fann.php                                      30-Sep-2022 11:02               23194
book.fdf.php                                       30-Sep-2022 11:02                5706
book.ffi.php                                       30-Sep-2022 11:02                5705
book.fileinfo.php                                  30-Sep-2022 11:02                3168
book.filesystem.php                                30-Sep-2022 11:02               10781
book.filter.php                                    30-Sep-2022 11:02                3621
book.fpm.php                                       30-Sep-2022 11:02                2008
book.ftp.php                                       30-Sep-2022 11:02                6200
book.funchand.php                                  30-Sep-2022 11:02                4049
book.gearman.php                                   30-Sep-2022 11:02               14875
book.gender.php                                    30-Sep-2022 11:02                2618
book.geoip.php                                     30-Sep-2022 11:02                4460
book.gettext.php                                   30-Sep-2022 11:02                3225
book.gmagick.php                                   30-Sep-2022 11:02               22669
book.gmp.php                                       30-Sep-2022 11:02                6616
book.gnupg.php                                     30-Sep-2022 11:02                4949
book.hash.php                                      30-Sep-2022 11:02                4248
book.hrtime.php                                    30-Sep-2022 11:02                3502
book.ibase.php                                     30-Sep-2022 11:02               13228
book.ibm-db2.php                                   30-Sep-2022 11:02                8706
book.iconv.php                                     30-Sep-2022 11:02                3333
book.igbinary.php                                  30-Sep-2022 11:02                2213
book.image.php                                     30-Sep-2022 11:02               15801
book.imagick.php                                   30-Sep-2022 11:02               62257
book.imap.php                                      30-Sep-2022 11:02               10288
book.info.php                                      30-Sep-2022 11:02                8825
book.inotify.php                                   30-Sep-2022 11:02                2655
book.intl.php                                      30-Sep-2022 11:02               45125
book.json.php                                      30-Sep-2022 11:02                2843
book.ldap.php                                      30-Sep-2022 11:02                9027
book.libxml.php                                    30-Sep-2022 11:02                3140
book.lua.php                                       30-Sep-2022 11:02                2836
book.luasandbox.php                                30-Sep-2022 11:02                5630
book.lzf.php                                       30-Sep-2022 11:02                2296
book.mail.php                                      30-Sep-2022 11:02                2177
book.mailparse.php                                 30-Sep-2022 11:02                3994
book.math.php                                      30-Sep-2022 11:02                6546
book.mbstring.php                                  30-Sep-2022 11:02                9690
book.mcrypt.php                                    30-Sep-2022 11:02                6472
book.memcache.php                                  30-Sep-2022 11:02                4298
book.memcached.php                                 30-Sep-2022 11:02                8142
book.mhash.php                                     30-Sep-2022 11:02                2571
book.misc.php                                      30-Sep-2022 11:02                5441
book.mongodb.php                                   30-Sep-2022 11:02               25591
book.mqseries.php                                  30-Sep-2022 11:02                3256
book.mysql-xdevapi.php                             30-Sep-2022 11:02               29051
book.mysql.php                                     30-Sep-2022 11:02                8353
book.mysqli.php                                    30-Sep-2022 11:02               18508
book.mysqlnd.php                                   30-Sep-2022 11:02                2470
book.network.php                                   30-Sep-2022 11:02                6040
book.oauth.php                                     30-Sep-2022 11:02                7251
book.oci8.php                                      30-Sep-2022 11:02               17429
book.opcache.php                                   30-Sep-2022 11:02                2752
book.openal.php                                    30-Sep-2022 11:02                4539
book.openssl.php                                   30-Sep-2022 11:02               10979
book.outcontrol.php                                30-Sep-2022 11:02                4377
book.parallel.php                                  30-Sep-2022 11:02                5723
book.parle.php                                     30-Sep-2022 11:02                8852
book.password.php                                  30-Sep-2022 11:02                2703
book.pcntl.php                                     30-Sep-2022 11:02                5143
book.pcre.php                                      30-Sep-2022 11:02                3982
book.pdo.php                                       30-Sep-2022 11:02                8093
book.pgsql.php                                     30-Sep-2022 11:02               12869
book.phar.php                                      30-Sep-2022 11:02               15784
book.phpdbg.php                                    30-Sep-2022 11:02                2999
book.posix.php                                     30-Sep-2022 11:02                6246
book.ps.php                                        30-Sep-2022 11:02                9263
book.pspell.php                                    30-Sep-2022 11:02                4529
book.pthreads.php                                  30-Sep-2022 11:02                5523
book.quickhash.php                                 30-Sep-2022 11:02                8980
book.radius.php                                    30-Sep-2022 11:02                5644
book.rar.php                                       30-Sep-2022 11:02                5335
book.readline.php                                  30-Sep-2022 11:02                3864
book.recode.php                                    30-Sep-2022 11:02                2383
book.reflection.php                                30-Sep-2022 11:02               32537
book.rpminfo.php                                   30-Sep-2022 11:02                2478
book.rrd.php                                       30-Sep-2022 11:02                5177
book.runkit7.php                                   30-Sep-2022 11:02                4295
book.scoutapm.php                                  30-Sep-2022 11:02                2269
book.seaslog.php                                   30-Sep-2022 11:02                5243
book.sem.php                                       30-Sep-2022 11:02                4233
book.session.php                                   30-Sep-2022 11:02                7840
book.shmop.php                                     30-Sep-2022 11:02                2969
book.simplexml.php                                 30-Sep-2022 11:02                5854
book.snmp.php                                      30-Sep-2022 11:02                5927
book.soap.php                                      30-Sep-2022 11:02                6158
book.sockets.php                                   30-Sep-2022 11:02                7063
book.sodium.php                                    30-Sep-2022 11:02               17417
book.solr.php                                      30-Sep-2022 11:02               53300
book.spl.php                                       30-Sep-2022 11:02               10299
book.sqlite3.php                                   30-Sep-2022 11:02                7035
book.sqlsrv.php                                    30-Sep-2022 11:02                5397
book.ssdeep.php                                    30-Sep-2022 11:02                2394
book.ssh2.php                                      30-Sep-2022 11:02                5570
book.stats.php                                     30-Sep-2022 11:02               11890
book.stomp.php                                     30-Sep-2022 11:02                4204
book.stream.php                                    30-Sep-2022 11:02               11667
book.strings.php                                   30-Sep-2022 11:02               13885
book.svm.php                                       30-Sep-2022 11:02                3727
book.svn.php                                       30-Sep-2022 11:02                7672
book.swoole.php                                    30-Sep-2022 11:02               37443
book.sync.php                                      30-Sep-2022 11:02                4851
book.taint.php                                     30-Sep-2022 11:02                2591
book.tcpwrap.php                                   30-Sep-2022 11:02                2121
book.tidy.php                                      30-Sep-2022 11:02                3050
book.tokenizer.php                                 30-Sep-2022 11:02                2373
book.trader.php                                    30-Sep-2022 11:02               17586
book.ui.php                                        30-Sep-2022 11:02               27966
book.uodbc.php                                     30-Sep-2022 11:02                7714
book.uopz.php                                      30-Sep-2022 11:02                5163
book.url.php                                       30-Sep-2022 11:02                3093
book.v8js.php                                      30-Sep-2022 11:02                3152
book.var.php                                       30-Sep-2022 11:02                6194
book.var_representation.php                        30-Sep-2022 11:02                2188
book.varnish.php                                   30-Sep-2022 11:02                5425
book.wddx.php                                      30-Sep-2022 11:02                2917
book.win32service.php                              30-Sep-2022 11:02                5231
book.wincache.php                                  30-Sep-2022 11:02                5667
book.wkhtmltox.php                                 30-Sep-2022 11:02                3359
book.xattr.php                                     30-Sep-2022 11:02                2552
book.xdiff.php                                     30-Sep-2022 11:02                4208
book.xhprof.php                                    30-Sep-2022 11:02                2512
book.xlswriter.php                                 30-Sep-2022 11:02                4452
book.xml.php                                       30-Sep-2022 11:02                5621
book.xmldiff.php                                   30-Sep-2022 11:02                3150
book.xmlreader.php                                 30-Sep-2022 11:02                4936
book.xmlrpc.php                                    30-Sep-2022 11:02                4016
book.xmlwriter.php                                 30-Sep-2022 11:02                6588
book.xsl.php                                       30-Sep-2022 11:02                3745
book.yac.php                                       30-Sep-2022 11:02                2643
book.yaconf.php                                    30-Sep-2022 11:02                2205
book.yaf.php                                       30-Sep-2022 11:02               34716
book.yaml.php                                      30-Sep-2022 11:02                2842
book.yar.php                                       30-Sep-2022 11:02                3732
book.yaz.php                                       30-Sep-2022 11:02                4421
book.zip.php                                       30-Sep-2022 11:02               10015
book.zlib.php                                      30-Sep-2022 11:02                5201
book.zmq.php                                       30-Sep-2022 11:02                5922
book.zookeeper.php                                 30-Sep-2022 11:02                6721
bzip2.configuration.php                            30-Sep-2022 11:02                1307
bzip2.constants.php                                30-Sep-2022 11:02                1137
bzip2.examples.php                                 30-Sep-2022 11:02                4285
bzip2.installation.php                             30-Sep-2022 11:02                1423
bzip2.requirements.php                             30-Sep-2022 11:02                1413
bzip2.resources.php                                30-Sep-2022 11:02                1329
bzip2.setup.php                                    30-Sep-2022 11:02                1640
cachingiterator.construct.php                      30-Sep-2022 11:02                2732
cachingiterator.count.php                          30-Sep-2022 11:02                2409
cachingiterator.current.php                        30-Sep-2022 11:02                2831
cachingiterator.getcache.php                       30-Sep-2022 11:02                5586
cachingiterator.getflags.php                       30-Sep-2022 11:02                2421
cachingiterator.getinneriterator.php               30-Sep-2022 11:02                2560
cachingiterator.hasnext.php                        30-Sep-2022 11:02                2416
cachingiterator.key.php                            30-Sep-2022 11:02                2199
cachingiterator.next.php                           30-Sep-2022 11:02                2319
cachingiterator.offsetexists.php                   30-Sep-2022 11:02                2707
cachingiterator.offsetget.php                      30-Sep-2022 11:02                2658
cachingiterator.offsetset.php                      30-Sep-2022 11:02                3007
cachingiterator.offsetunset.php                    30-Sep-2022 11:02                2635
cachingiterator.rewind.php                         30-Sep-2022 11:02                2344
cachingiterator.setflags.php                       30-Sep-2022 11:02                2669
cachingiterator.tostring.php                       30-Sep-2022 11:02                2435
cachingiterator.valid.php                          30-Sep-2022 11:02                2434
calendar.configuration.php                         30-Sep-2022 11:02                1328
calendar.constants.php                             30-Sep-2022 11:02                5373
calendar.installation.php                          30-Sep-2022 11:02                1559
calendar.requirements.php                          30-Sep-2022 11:02                1268
calendar.resources.php                             30-Sep-2022 11:02                1252
calendar.setup.php                                 30-Sep-2022 11:02                1687
callbackfilteriterator.accept.php                  30-Sep-2022 11:02                3312
callbackfilteriterator.construct.php               30-Sep-2022 11:02                3837
cc.license.php                                     30-Sep-2022 11:02               21041
changelog.mysql_xdevapi.php                        30-Sep-2022 11:02                2280
changelog.mysqli.php                               30-Sep-2022 11:02                2289
changelog.strings.php                              30-Sep-2022 11:02                5714
class.apcuiterator.php                             30-Sep-2022 11:02                6518
class.appenditerator.php                           30-Sep-2022 11:02                8096
class.argumentcounterror.php                       30-Sep-2022 11:01                5693
class.arithmeticerror.php                          30-Sep-2022 11:01                4980
class.arrayaccess.php                              30-Sep-2022 11:01               13206
class.arrayiterator.php                            30-Sep-2022 11:02               14787
class.arrayobject.php                              30-Sep-2022 11:02               13499
class.assertionerror.php                           30-Sep-2022 11:01                4710
class.backedenum.php                               30-Sep-2022 11:01                4039
class.badfunctioncallexception.php                 30-Sep-2022 11:02                5768
class.badmethodcallexception.php                   30-Sep-2022 11:02                5774
class.cachingiterator.php                          30-Sep-2022 11:02                9396
class.callbackfilteriterator.php                   30-Sep-2022 11:02               11933
class.closure.php                                  30-Sep-2022 11:01                6386
class.collator.php                                 30-Sep-2022 11:02               24162
class.collectable.php                              30-Sep-2022 11:02                2409
class.com-exception.php                            30-Sep-2022 11:02                5562
class.com.php                                      30-Sep-2022 11:02               12790
class.commonmark-cql.php                           30-Sep-2022 11:02                7561
class.commonmark-interfaces-ivisitable.php         30-Sep-2022 11:02                2883
class.commonmark-interfaces-ivisitor.php           30-Sep-2022 11:02                4248
class.commonmark-node-blockquote.php               30-Sep-2022 11:02                8241
class.commonmark-node-bulletlist.php               30-Sep-2022 11:02               10117
class.commonmark-node-code.php                     30-Sep-2022 11:02                9115
class.commonmark-node-codeblock.php                30-Sep-2022 11:02               10312
class.commonmark-node-customblock.php              30-Sep-2022 11:02                8871
class.commonmark-node-custominline.php             30-Sep-2022 11:02                8851
class.commonmark-node-document.php                 30-Sep-2022 11:02                8205
class.commonmark-node-heading.php                  30-Sep-2022 11:02                9473
class.commonmark-node-htmlblock.php                30-Sep-2022 11:02                9173
class.commonmark-node-htmlinline.php               30-Sep-2022 11:02                9149
class.commonmark-node-image.php                    30-Sep-2022 11:02               10197
class.commonmark-node-item.php                     30-Sep-2022 11:02                8208
class.commonmark-node-linebreak.php                30-Sep-2022 11:02                8222
class.commonmark-node-link.php                     30-Sep-2022 11:02               10190
class.commonmark-node-orderedlist.php              30-Sep-2022 11:02               10851
class.commonmark-node-paragraph.php                30-Sep-2022 11:02                8247
class.commonmark-node-softbreak.php                30-Sep-2022 11:02                8240
class.commonmark-node-text-emphasis.php            30-Sep-2022 11:02                8269
class.commonmark-node-text-strong.php              30-Sep-2022 11:02                8258
class.commonmark-node-text.php                     30-Sep-2022 11:02                9507
class.commonmark-node-thematicbreak.php            30-Sep-2022 11:02                8269
class.commonmark-node.php                          30-Sep-2022 11:02                9153
class.commonmark-parser.php                        30-Sep-2022 11:02                3618
class.compersisthelper.php                         30-Sep-2022 11:02                6524
class.compileerror.php                             30-Sep-2022 11:01                5623
class.componere-abstract-definition.php            30-Sep-2022 11:02                4604
class.componere-definition.php                     30-Sep-2022 11:02                9378
class.componere-method.php                         30-Sep-2022 11:02                4352
class.componere-patch.php                          30-Sep-2022 11:02                7764
class.componere-value.php                          30-Sep-2022 11:02                5216
class.countable.php                                30-Sep-2022 11:02                2502
class.curlfile.php                                 30-Sep-2022 11:02                6970
class.dateinterval.php                             30-Sep-2022 11:02                8330
class.dateperiod.php                               30-Sep-2022 11:02               11628
class.datetime.php                                 30-Sep-2022 11:02               21325
class.datetimeimmutable.php                        30-Sep-2022 11:02               13714
class.datetimeinterface.php                        30-Sep-2022 11:02                5497
class.datetimezone.php                             30-Sep-2022 11:02               12931
class.directoryiterator.php                        30-Sep-2022 11:02               12990
class.divisionbyzeroerror.php                      30-Sep-2022 11:01                5681
class.domainexception.php                          30-Sep-2022 11:02                5689
class.domattr.php                                  30-Sep-2022 11:02               14726
class.domcdatasection.php                          30-Sep-2022 11:02               22721
class.domcharacterdata.php                         30-Sep-2022 11:02               23916
class.domcomment.php                               30-Sep-2022 11:02               21771
class.domdocument.php                              30-Sep-2022 11:02               54110
class.domdocumentfragment.php                      30-Sep-2022 11:02               20821
class.domdocumenttype.php                          30-Sep-2022 11:02               20991
class.domelement.php                               30-Sep-2022 11:02               35740
class.domentity.php                                30-Sep-2022 11:02               21319
class.domentityreference.php                       30-Sep-2022 11:02               17386
class.domexception.php                             30-Sep-2022 11:02                6457
class.domimplementation.php                        30-Sep-2022 11:02                5346
class.domnamednodemap.php                          30-Sep-2022 11:02                6478
class.domnode.php                                  30-Sep-2022 11:02               25103
class.domnodelist.php                              30-Sep-2022 11:02                5325
class.domnotation.php                              30-Sep-2022 11:02               17638
class.domprocessinginstruction.php                 30-Sep-2022 11:02               18714
class.domtext.php                                  30-Sep-2022 11:02               24344
class.domxpath.php                                 30-Sep-2022 11:02                7644
class.dotnet.php                                   30-Sep-2022 11:02                6791
class.ds-collection.php                            30-Sep-2022 11:02                5095
class.ds-deque.php                                 30-Sep-2022 11:02               21390
class.ds-hashable.php                              30-Sep-2022 11:02                4062
class.ds-map.php                                   30-Sep-2022 11:02               22568
class.ds-pair.php                                  30-Sep-2022 11:02                4462
class.ds-priorityqueue.php                         30-Sep-2022 11:02                7914
class.ds-queue.php                                 30-Sep-2022 11:02                7475
class.ds-sequence.php                              30-Sep-2022 11:02               19147
class.ds-set.php                                   30-Sep-2022 11:02               18000
class.ds-stack.php                                 30-Sep-2022 11:02                6898
class.ds-vector.php                                30-Sep-2022 11:02               20957
class.emptyiterator.php                            30-Sep-2022 11:02                3922
class.enchantbroker.php                            30-Sep-2022 11:02                1844
class.enchantdictionary.php                        30-Sep-2022 11:02                1834
class.error.php                                    30-Sep-2022 11:01                8288
class.errorexception.php                           30-Sep-2022 11:01               11657
class.ev.php                                       30-Sep-2022 11:02               37639
class.evcheck.php                                  30-Sep-2022 11:02               10070
class.evchild.php                                  30-Sep-2022 11:02               11522
class.evembed.php                                  30-Sep-2022 11:02                9239
class.event.php                                    30-Sep-2022 11:02               17138
class.eventbase.php                                30-Sep-2022 11:02               13326
class.eventbuffer.php                              30-Sep-2022 11:02               20235
class.eventbufferevent.php                         30-Sep-2022 11:02               33451
class.eventconfig.php                              30-Sep-2022 11:02                6832
class.eventdnsbase.php                             30-Sep-2022 11:02               10173
class.eventhttp.php                                30-Sep-2022 11:02                8486
class.eventhttpconnection.php                      30-Sep-2022 11:02                9458
class.eventhttprequest.php                         30-Sep-2022 11:02               19856
class.eventlistener.php                            30-Sep-2022 11:02               11607
class.eventsslcontext.php                          30-Sep-2022 11:02               16453
class.eventutil.php                                30-Sep-2022 11:02               22332
class.evfork.php                                   30-Sep-2022 11:02                8215
class.evidle.php                                   30-Sep-2022 11:02                9247
class.evio.php                                     30-Sep-2022 11:02               11923
class.evloop.php                                   30-Sep-2022 11:02               29220
class.evperiodic.php                               30-Sep-2022 11:02               13903
class.evprepare.php                                30-Sep-2022 11:02               10218
class.evsignal.php                                 30-Sep-2022 11:02               10946
class.evstat.php                                   30-Sep-2022 11:02               13335
class.evtimer.php                                  30-Sep-2022 11:02               13314
class.evwatcher.php                                30-Sep-2022 11:02                9193
class.exception.php                                30-Sep-2022 11:01                8717
class.fannconnection.php                           30-Sep-2022 11:02                6087
class.ffi-cdata.php                                30-Sep-2022 11:02                5468
class.ffi-ctype.php                                30-Sep-2022 11:02                7844
class.ffi-exception.php                            30-Sep-2022 11:02                5444
class.ffi-parserexception.php                      30-Sep-2022 11:02                5500
class.ffi.php                                      30-Sep-2022 11:02               17741
class.fiber.php                                    30-Sep-2022 11:01                7643
class.fibererror.php                               30-Sep-2022 11:01                6358
class.filesystemiterator.php                       30-Sep-2022 11:02               29008
class.filteriterator.php                           30-Sep-2022 11:02                5186
class.finfo.php                                    30-Sep-2022 11:02                5087
class.gearmanclient.php                            30-Sep-2022 11:02               29662
class.gearmanexception.php                         30-Sep-2022 11:02                5622
class.gearmanjob.php                               30-Sep-2022 11:02                9843
class.gearmantask.php                              30-Sep-2022 11:02                8158
class.gearmanworker.php                            30-Sep-2022 11:02               11340
class.gender.php                                   30-Sep-2022 11:02               33016
class.generator.php                                30-Sep-2022 11:01                6054
class.globiterator.php                             30-Sep-2022 11:02               25172
class.gmagick.php                                  30-Sep-2022 11:02               75800
class.gmagickdraw.php                              30-Sep-2022 11:02               21459
class.gmagickpixel.php                             30-Sep-2022 11:02                5261
class.hashcontext.php                              30-Sep-2022 11:02                3225
class.hrtime-performancecounter.php                30-Sep-2022 11:02                3523
class.hrtime-stopwatch.php                         30-Sep-2022 11:02                6281
class.hrtime-unit.php                              30-Sep-2022 11:02                3882
class.imagick.php                                  30-Sep-2022 11:02              240119
class.imagickdraw.php                              30-Sep-2022 11:02               66332
class.imagickkernel.php                            30-Sep-2022 11:02                5628
class.imagickpixel.php                             30-Sep-2022 11:02               11198
class.imagickpixeliterator.php                     30-Sep-2022 11:02                8498
class.imap-connection.php                          30-Sep-2022 11:02                1809
class.infiniteiterator.php                         30-Sep-2022 11:02                5234
class.intlbreakiterator.php                        30-Sep-2022 11:02               25899
class.intlcalendar.php                             30-Sep-2022 11:02               57654
class.intlchar.php                                 30-Sep-2022 11:02              340825
class.intlcodepointbreakiterator.php               30-Sep-2022 11:02               18462
class.intldateformatter.php                        30-Sep-2022 11:02               23266
class.intldatepatterngenerator.php                 30-Sep-2022 11:02                4117
class.intlexception.php                            30-Sep-2022 11:02                5797
class.intlgregoriancalendar.php                    30-Sep-2022 11:02               38863
class.intliterator.php                             30-Sep-2022 11:02                5110
class.intlpartsiterator.php                        30-Sep-2022 11:02                6665
class.intlrulebasedbreakiterator.php               30-Sep-2022 11:02               20866
class.intltimezone.php                             30-Sep-2022 11:02               18967
class.invalidargumentexception.php                 30-Sep-2022 11:02                5712
class.iterator.php                                 30-Sep-2022 11:01               11831
class.iteratoraggregate.php                        30-Sep-2022 11:01                6479
class.iteratoriterator.php                         30-Sep-2022 11:02                6108
class.jsonserializable.php                         30-Sep-2022 11:02                2840
class.ldap-connection.php                          30-Sep-2022 11:02                1829
class.ldap-result-entry.php                        30-Sep-2022 11:02                1844
class.ldap-result.php                              30-Sep-2022 11:02                1821
class.lengthexception.php                          30-Sep-2022 11:02                5638
class.libxmlerror.php                              30-Sep-2022 11:02                5152
class.limititerator.php                            30-Sep-2022 11:02                9094
class.locale.php                                   30-Sep-2022 11:02               20666
class.logicexception.php                           30-Sep-2022 11:02                5698
class.lua.php                                      30-Sep-2022 11:02                7294
class.luaclosure.php                               30-Sep-2022 11:02                2880
class.luasandbox.php                               30-Sep-2022 11:02               12409
class.luasandboxerror.php                          30-Sep-2022 11:02                7664
class.luasandboxerrorerror.php                     30-Sep-2022 11:02                5699
class.luasandboxfatalerror.php                     30-Sep-2022 11:02                5821
class.luasandboxfunction.php                       30-Sep-2022 11:02                3627
class.luasandboxmemoryerror.php                    30-Sep-2022 11:02                6027
class.luasandboxruntimeerror.php                   30-Sep-2022 11:02                5841
class.luasandboxsyntaxerror.php                    30-Sep-2022 11:02                5703
class.luasandboxtimeouterror.php                   30-Sep-2022 11:02                6011
class.memcache.php                                 30-Sep-2022 11:02               15399
class.memcached.php                                30-Sep-2022 11:02               35710
class.memcachedexception.php                       30-Sep-2022 11:02                5582
class.messageformatter.php                         30-Sep-2022 11:02               10699
class.mongodb-bson-binary.php                      30-Sep-2022 11:02               13702
class.mongodb-bson-binaryinterface.php             30-Sep-2022 11:02                4471
class.mongodb-bson-dbpointer.php                   30-Sep-2022 11:02                5812
class.mongodb-bson-decimal128.php                  30-Sep-2022 11:02                7473
class.mongodb-bson-decimal128interface.php         30-Sep-2022 11:02                3716
class.mongodb-bson-int64.php                       30-Sep-2022 11:02                6538
class.mongodb-bson-javascript.php                  30-Sep-2022 11:02                8078
class.mongodb-bson-javascriptinterface.php         30-Sep-2022 11:02                4643
class.mongodb-bson-maxkey.php                      30-Sep-2022 11:02                5698
class.mongodb-bson-maxkeyinterface.php             30-Sep-2022 11:02                2152
class.mongodb-bson-minkey.php                      30-Sep-2022 11:02                5689
class.mongodb-bson-minkeyinterface.php             30-Sep-2022 11:02                2133
class.mongodb-bson-objectid.php                    30-Sep-2022 11:02                8804
class.mongodb-bson-objectidinterface.php           30-Sep-2022 11:02                4148
class.mongodb-bson-persistable.php                 30-Sep-2022 11:02                4522
class.mongodb-bson-regex.php                       30-Sep-2022 11:02                7730
class.mongodb-bson-regexinterface.php              30-Sep-2022 11:02                4488
class.mongodb-bson-serializable.php                30-Sep-2022 11:02                3760
class.mongodb-bson-symbol.php                      30-Sep-2022 11:02                5700
class.mongodb-bson-timestamp.php                   30-Sep-2022 11:02                7985
class.mongodb-bson-timestampinterface.php          30-Sep-2022 11:02                4650
class.mongodb-bson-type.php                        30-Sep-2022 11:02                1980
class.mongodb-bson-undefined.php                   30-Sep-2022 11:02                5788
class.mongodb-bson-unserializable.php              30-Sep-2022 11:02                3825
class.mongodb-bson-utcdatetime.php                 30-Sep-2022 11:02                7539
class.mongodb-bson-utcdatetimeinterface.php        30-Sep-2022 11:02                4279
class.mongodb-driver-bulkwrite.php                 30-Sep-2022 11:02               25895
class.mongodb-driver-clientencryption.php          30-Sep-2022 11:02               11805
class.mongodb-driver-command.php                   30-Sep-2022 11:02               15950
class.mongodb-driver-cursor.php                    30-Sep-2022 11:02               27569
class.mongodb-driver-cursorid.php                  30-Sep-2022 11:02                5290
class.mongodb-driver-cursorinterface.php           30-Sep-2022 11:02                5927
class.mongodb-driver-exception-authenticationex..> 30-Sep-2022 11:02                7076
class.mongodb-driver-exception-bulkwriteexcepti..> 30-Sep-2022 11:02                7930
class.mongodb-driver-exception-commandexception..> 30-Sep-2022 11:02                8710
class.mongodb-driver-exception-connectionexcept..> 30-Sep-2022 11:02                7145
class.mongodb-driver-exception-connectiontimeou..> 30-Sep-2022 11:02                7533
class.mongodb-driver-exception-encryptionexcept..> 30-Sep-2022 11:02                7079
class.mongodb-driver-exception-exception.php       30-Sep-2022 11:02                2147
class.mongodb-driver-exception-executiontimeout..> 30-Sep-2022 11:02                8183
class.mongodb-driver-exception-invalidargumente..> 30-Sep-2022 11:02                6282
class.mongodb-driver-exception-logicexception.php  30-Sep-2022 11:02                6166
class.mongodb-driver-exception-runtimeexception..> 30-Sep-2022 11:02                9578
class.mongodb-driver-exception-serverexception.php 30-Sep-2022 11:02                7156
class.mongodb-driver-exception-sslconnectionexc..> 30-Sep-2022 11:02                7421
class.mongodb-driver-exception-unexpectedvaluee..> 30-Sep-2022 11:02                6299
class.mongodb-driver-exception-writeexception.php  30-Sep-2022 11:02               10096
class.mongodb-driver-manager.php                   30-Sep-2022 11:02               19662
class.mongodb-driver-monitoring-commandfailedev..> 30-Sep-2022 11:02                7534
class.mongodb-driver-monitoring-commandstartede..> 30-Sep-2022 11:02                7036
class.mongodb-driver-monitoring-commandsubscrib..> 30-Sep-2022 11:02                6139
class.mongodb-driver-monitoring-commandsucceede..> 30-Sep-2022 11:02                7116
class.mongodb-driver-monitoring-sdamsubscriber.php 30-Sep-2022 11:02               11373
class.mongodb-driver-monitoring-serverchangedev..> 30-Sep-2022 11:02                5578
class.mongodb-driver-monitoring-serverclosedeve..> 30-Sep-2022 11:02                4225
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:02                5459
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:02                4344
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:02                5471
class.mongodb-driver-monitoring-serveropeningev..> 30-Sep-2022 11:02                4245
class.mongodb-driver-monitoring-subscriber.php     30-Sep-2022 11:02                2595
class.mongodb-driver-monitoring-topologychanged..> 30-Sep-2022 11:02                4691
class.mongodb-driver-monitoring-topologyclosede..> 30-Sep-2022 11:02                3302
class.mongodb-driver-monitoring-topologyopening..> 30-Sep-2022 11:02                3316
class.mongodb-driver-query.php                     30-Sep-2022 11:02                3118
class.mongodb-driver-readconcern.php               30-Sep-2022 11:02               16004
class.mongodb-driver-readpreference.php            30-Sep-2022 11:02               18159
class.mongodb-driver-server.php                    30-Sep-2022 11:02               23566
class.mongodb-driver-serverapi.php                 30-Sep-2022 11:02               15125
class.mongodb-driver-serverdescription.php         30-Sep-2022 11:02               14697
class.mongodb-driver-session.php                   30-Sep-2022 11:02               13716
class.mongodb-driver-topologydescription.php       30-Sep-2022 11:02               10201
class.mongodb-driver-writeconcern.php              30-Sep-2022 11:02                9094
class.mongodb-driver-writeconcernerror.php         30-Sep-2022 11:02                4100
class.mongodb-driver-writeerror.php                30-Sep-2022 11:02                4366
class.mongodb-driver-writeresult.php               30-Sep-2022 11:02                7835
class.multipleiterator.php                         30-Sep-2022 11:02               10225
class.mysql-xdevapi-baseresult.php                 30-Sep-2022 11:02                2883
class.mysql-xdevapi-client.php                     30-Sep-2022 11:02                3022
class.mysql-xdevapi-collection.php                 30-Sep-2022 11:02                9938
class.mysql-xdevapi-collectionadd.php              30-Sep-2022 11:02                2900
class.mysql-xdevapi-collectionfind.php             30-Sep-2022 11:02                8258
class.mysql-xdevapi-collectionmodify.php           30-Sep-2022 11:02                9415
class.mysql-xdevapi-collectionremove.php           30-Sep-2022 11:02                4998
class.mysql-xdevapi-columnresult.php               30-Sep-2022 11:02                6014
class.mysql-xdevapi-crudoperationbindable.php      30-Sep-2022 11:02                2878
class.mysql-xdevapi-crudoperationlimitable.php     30-Sep-2022 11:02                2884
class.mysql-xdevapi-crudoperationskippable.php     30-Sep-2022 11:02                2895
class.mysql-xdevapi-crudoperationsortable.php      30-Sep-2022 11:02                2869
class.mysql-xdevapi-databaseobject.php             30-Sep-2022 11:02                3381
class.mysql-xdevapi-docresult.php                  30-Sep-2022 11:02                3770
class.mysql-xdevapi-exception.php                  30-Sep-2022 11:02                2163
class.mysql-xdevapi-executable.php                 30-Sep-2022 11:02                2578
class.mysql-xdevapi-executionstatus.php            30-Sep-2022 11:02                4836
class.mysql-xdevapi-expression.php                 30-Sep-2022 11:02                3157
class.mysql-xdevapi-result.php                     30-Sep-2022 11:02                4096
class.mysql-xdevapi-rowresult.php                  30-Sep-2022 11:02                4693
class.mysql-xdevapi-schema.php                     30-Sep-2022 11:02                7165
class.mysql-xdevapi-schemaobject.php               30-Sep-2022 11:02                2763
class.mysql-xdevapi-session.php                    30-Sep-2022 11:02                8492
class.mysql-xdevapi-sqlstatement.php               30-Sep-2022 11:02                6213
class.mysql-xdevapi-sqlstatementresult.php         30-Sep-2022 11:02                6640
class.mysql-xdevapi-statement.php                  30-Sep-2022 11:02                4637
class.mysql-xdevapi-table.php                      30-Sep-2022 11:02                7318
class.mysql-xdevapi-tabledelete.php                30-Sep-2022 11:02                4903
class.mysql-xdevapi-tableinsert.php                30-Sep-2022 11:02                3402
class.mysql-xdevapi-tableselect.php                30-Sep-2022 11:02                7997
class.mysql-xdevapi-tableupdate.php                30-Sep-2022 11:02                5860
class.mysql-xdevapi-warning.php                    30-Sep-2022 11:02                3720
class.mysqli-driver.php                            30-Sep-2022 11:02                7612
class.mysqli-result.php                            30-Sep-2022 11:02               10118
class.mysqli-sql-exception.php                     30-Sep-2022 11:02                7114
class.mysqli-stmt.php                              30-Sep-2022 11:02               17099
class.mysqli-warning.php                           30-Sep-2022 11:02                4204
class.mysqli.php                                   30-Sep-2022 11:02               31908
class.norewinditerator.php                         30-Sep-2022 11:02                7104
class.normalizer.php                               30-Sep-2022 11:02                8994
class.numberformatter.php                          30-Sep-2022 11:02               39385
class.oauth.php                                    30-Sep-2022 11:02               17205
class.oauthexception.php                           30-Sep-2022 11:02                6638
class.oauthprovider.php                            30-Sep-2022 11:02               11561
class.ocicollection.php                            30-Sep-2022 11:02                5946
class.ocilob.php                                   30-Sep-2022 11:02               12019
class.opensslasymmetrickey.php                     30-Sep-2022 11:02                1907
class.opensslcertificate.php                       30-Sep-2022 11:02                1911
class.opensslcertificatesigningrequest.php         30-Sep-2022 11:02                1998
class.outeriterator.php                            30-Sep-2022 11:02                4305
class.outofboundsexception.php                     30-Sep-2022 11:02                5747
class.outofrangeexception.php                      30-Sep-2022 11:02                5749
class.overflowexception.php                        30-Sep-2022 11:02                5668
class.parallel-channel.php                         30-Sep-2022 11:02                7992
class.parallel-events-event-type.php               30-Sep-2022 11:02                3323
class.parallel-events-event.php                    30-Sep-2022 11:02                3298
class.parallel-events-input.php                    30-Sep-2022 11:02                4546
class.parallel-events.php                          30-Sep-2022 11:02                6663
class.parallel-future.php                          30-Sep-2022 11:02                8199
class.parallel-runtime.php                         30-Sep-2022 11:02                6134
class.parallel-sync.php                            30-Sep-2022 11:02                5215
class.parentiterator.php                           30-Sep-2022 11:02                4504
class.parle-errorinfo.php                          30-Sep-2022 11:02                3697
class.parle-lexer.php                              30-Sep-2022 11:02               11770
class.parle-lexerexception.php                     30-Sep-2022 11:02                5836
class.parle-parser.php                             30-Sep-2022 11:02               14709
class.parle-parserexception.php                    30-Sep-2022 11:02                5818
class.parle-rlexer.php                             30-Sep-2022 11:02               13411
class.parle-rparser.php                            30-Sep-2022 11:02               14860
class.parle-stack.php                              30-Sep-2022 11:02                4645
class.parle-token.php                              30-Sep-2022 11:02                4423
class.parseerror.php                               30-Sep-2022 11:01                4684
class.pdo.php                                      30-Sep-2022 11:02               13102
class.pdoexception.php                             30-Sep-2022 11:02                7419
class.pdostatement.php                             30-Sep-2022 11:02               19276
class.phar.php                                     30-Sep-2022 11:02               58896
class.phardata.php                                 30-Sep-2022 11:02               43041
class.pharexception.php                            30-Sep-2022 11:02                5626
class.pharfileinfo.php                             30-Sep-2022 11:02               18274
class.php-user-filter.php                          30-Sep-2022 11:02                6015
class.pool.php                                     30-Sep-2022 11:02                7157
class.pspell-config.php                            30-Sep-2022 11:02                1828
class.pspell-dictionary.php                        30-Sep-2022 11:02                1865
class.quickhashinthash.php                         30-Sep-2022 11:02               12920
class.quickhashintset.php                          30-Sep-2022 11:02               11116
class.quickhashintstringhash.php                   30-Sep-2022 11:02               13734
class.quickhashstringinthash.php                   30-Sep-2022 11:02               11849
class.rangeexception.php                           30-Sep-2022 11:02                5877
class.rararchive.php                               30-Sep-2022 11:02                6940
class.rarentry.php                                 30-Sep-2022 11:02               41840
class.rarexception.php                             30-Sep-2022 11:02                7653
class.recursivearrayiterator.php                   30-Sep-2022 11:02               13522
class.recursivecachingiterator.php                 30-Sep-2022 11:02                8897
class.recursivecallbackfilteriterator.php          30-Sep-2022 11:02               13877
class.recursivedirectoryiterator.php               30-Sep-2022 11:02               12180
class.recursivefilteriterator.php                  30-Sep-2022 11:02                8109
class.recursiveiterator.php                        30-Sep-2022 11:02                4785
class.recursiveiteratoriterator.php                30-Sep-2022 11:02               12590
class.recursiveregexiterator.php                   30-Sep-2022 11:02               13016
class.recursivetreeiterator.php                    30-Sep-2022 11:02               22098
class.reflection.php                               30-Sep-2022 11:02                3179
class.reflectionclass.php                          30-Sep-2022 11:02               30658
class.reflectionclassconstant.php                  30-Sep-2022 11:02               13354
class.reflectionexception.php                      30-Sep-2022 11:02                5620
class.reflectionextension.php                      30-Sep-2022 11:02                8730
class.reflectionfunction.php                       30-Sep-2022 11:02               17895
class.reflectionfunctionabstract.php               30-Sep-2022 11:02               17251
class.reflectiongenerator.php                      30-Sep-2022 11:02                6027
class.reflectionmethod.php                         30-Sep-2022 11:02               27310
class.reflectionnamedtype.php                      30-Sep-2022 11:02                3586
class.reflectionobject.php                         30-Sep-2022 11:02               23452
class.reflectionparameter.php                      30-Sep-2022 11:02               14208
class.reflectionproperty.php                       30-Sep-2022 11:02               18860
class.reflectionreference.php                      30-Sep-2022 11:02                3864
class.reflectiontype.php                           30-Sep-2022 11:02                4431
class.reflectionuniontype.php                      30-Sep-2022 11:02                3216
class.reflectionzendextension.php                  30-Sep-2022 11:02                6704
class.reflector.php                                30-Sep-2022 11:02                3852
class.regexiterator.php                            30-Sep-2022 11:02               15193
class.resourcebundle.php                           30-Sep-2022 11:02               11195
class.rrdcreator.php                               30-Sep-2022 11:02                4025
class.rrdgraph.php                                 30-Sep-2022 11:02                3595
class.rrdupdater.php                               30-Sep-2022 11:02                3003
class.runtimeexception.php                         30-Sep-2022 11:02                5655
class.seaslog.php                                  30-Sep-2022 11:02               17882
class.seekableiterator.php                         30-Sep-2022 11:02               12720
class.serializable.php                             30-Sep-2022 11:01                8378
class.sessionhandler.php                           30-Sep-2022 11:02               27455
class.sessionhandlerinterface.php                  30-Sep-2022 11:02               15681
class.simplexmlelement.php                         30-Sep-2022 11:02               10694
class.simplexmliterator.php                        30-Sep-2022 11:02               12024
class.snmp.php                                     30-Sep-2022 11:02               23828
class.snmpexception.php                            30-Sep-2022 11:02                6568
class.soapclient.php                               30-Sep-2022 11:02               29684
class.soapfault.php                                30-Sep-2022 11:02               11719
class.soapheader.php                               30-Sep-2022 11:02                5535
class.soapparam.php                                30-Sep-2022 11:02                3713
class.soapserver.php                               30-Sep-2022 11:02                9114
class.soapvar.php                                  30-Sep-2022 11:02                7028
class.sodiumexception.php                          30-Sep-2022 11:02                5586
class.solrclient.php                               30-Sep-2022 11:02               21131
class.solrclientexception.php                      30-Sep-2022 11:02                7478
class.solrcollapsefunction.php                     30-Sep-2022 11:02               10434
class.solrdismaxquery.php                          30-Sep-2022 11:02               94825
class.solrdocument.php                             30-Sep-2022 11:02               20087
class.solrdocumentfield.php                        30-Sep-2022 11:02                4416
class.solrexception.php                            30-Sep-2022 11:02                7936
class.solrgenericresponse.php                      30-Sep-2022 11:02               10932
class.solrillegalargumentexception.php             30-Sep-2022 11:02                7602
class.solrillegaloperationexception.php            30-Sep-2022 11:02                7640
class.solrinputdocument.php                        30-Sep-2022 11:02               16604
class.solrmissingmandatoryparameterexception.php   30-Sep-2022 11:02                6851
class.solrmodifiableparams.php                     30-Sep-2022 11:02                7925
class.solrobject.php                               30-Sep-2022 11:02                5344
class.solrparams.php                               30-Sep-2022 11:02                8107
class.solrpingresponse.php                         30-Sep-2022 11:02               10101
class.solrquery.php                                30-Sep-2022 11:02              104079
class.solrqueryresponse.php                        30-Sep-2022 11:02               10859
class.solrresponse.php                             30-Sep-2022 11:02               12778
class.solrserverexception.php                      30-Sep-2022 11:02                7484
class.solrupdateresponse.php                       30-Sep-2022 11:02               10903
class.solrutils.php                                30-Sep-2022 11:02                4426
class.spldoublylinkedlist.php                      30-Sep-2022 11:02               16295
class.splfileinfo.php                              30-Sep-2022 11:02               15543
class.splfileobject.php                            30-Sep-2022 11:02               30442
class.splfixedarray.php                            30-Sep-2022 11:02               17168
class.splheap.php                                  30-Sep-2022 11:02                7584
class.splmaxheap.php                               30-Sep-2022 11:02                6998
class.splminheap.php                               30-Sep-2022 11:02                7008
class.splobjectstorage.php                         30-Sep-2022 11:02               20103
class.splobserver.php                              30-Sep-2022 11:02                2811
class.splpriorityqueue.php                         30-Sep-2022 11:02                9388
class.splqueue.php                                 30-Sep-2022 11:02               12309
class.splstack.php                                 30-Sep-2022 11:02               11339
class.splsubject.php                               30-Sep-2022 11:02                3630
class.spltempfileobject.php                        30-Sep-2022 11:02               25481
class.spoofchecker.php                             30-Sep-2022 11:02               13181
class.sqlite3.php                                  30-Sep-2022 11:02               15453
class.sqlite3result.php                            30-Sep-2022 11:02                5168
class.sqlite3stmt.php                              30-Sep-2022 11:02                7226
class.stomp.php                                    30-Sep-2022 11:02               16981
class.stompexception.php                           30-Sep-2022 11:02                5292
class.stompframe.php                               30-Sep-2022 11:02                4055
class.streamwrapper.php                            30-Sep-2022 11:02               17107
class.stringable.php                               30-Sep-2022 11:01                8830
class.svm.php                                      30-Sep-2022 11:02               15549
class.svmmodel.php                                 30-Sep-2022 11:02                6034
class.swoole-async.php                             30-Sep-2022 11:02                7048
class.swoole-atomic.php                            30-Sep-2022 11:02                4393
class.swoole-buffer.php                            30-Sep-2022 11:02                6505
class.swoole-channel.php                           30-Sep-2022 11:02                3710
class.swoole-client.php                            30-Sep-2022 11:02               14255
class.swoole-connection-iterator.php               30-Sep-2022 11:02                7033
class.swoole-coroutine.php                         30-Sep-2022 11:02               20031
class.swoole-event.php                             30-Sep-2022 11:02                6595
class.swoole-exception.php                         30-Sep-2022 11:02                3065
class.swoole-http-client.php                       30-Sep-2022 11:02               12892
class.swoole-http-request.php                      30-Sep-2022 11:02                2851
class.swoole-http-response.php                     30-Sep-2022 11:02                9459
class.swoole-http-server.php                       30-Sep-2022 11:02               21545
class.swoole-lock.php                              30-Sep-2022 11:02                4431
class.swoole-mmap.php                              30-Sep-2022 11:02                2839
class.swoole-mysql-exception.php                   30-Sep-2022 11:02                3106
class.swoole-mysql.php                             30-Sep-2022 11:02                5116
class.swoole-process.php                           30-Sep-2022 11:02               11856
class.swoole-redis-server.php                      30-Sep-2022 11:02               26080
class.swoole-serialize.php                         30-Sep-2022 11:02                3350
class.swoole-server.php                            30-Sep-2022 11:02               24756
class.swoole-table.php                             30-Sep-2022 11:02               10958
class.swoole-timer.php                             30-Sep-2022 11:02                4476
class.swoole-websocket-frame.php                   30-Sep-2022 11:02                1861
class.swoole-websocket-server.php                  30-Sep-2022 11:02                6983
class.syncevent.php                                30-Sep-2022 11:02                4283
class.syncmutex.php                                30-Sep-2022 11:02                3785
class.syncreaderwriter.php                         30-Sep-2022 11:02                4639
class.syncsemaphore.php                            30-Sep-2022 11:02                4095
class.syncsharedmemory.php                         30-Sep-2022 11:02                4938
class.sysvmessagequeue.php                         30-Sep-2022 11:02                1836
class.sysvsemaphore.php                            30-Sep-2022 11:02                1821
class.sysvsharedmemory.php                         30-Sep-2022 11:02                1839
class.thread.php                                   30-Sep-2022 11:02               10111
class.threaded.php                                 30-Sep-2022 11:02                8011
class.throwable.php                                30-Sep-2022 11:01                5709
class.transliterator.php                           30-Sep-2022 11:02                8456
class.traversable.php                              30-Sep-2022 11:01                4012
class.typeerror.php                                30-Sep-2022 11:01                4893
class.uconverter.php                               30-Sep-2022 11:02               31488
class.ui-area.php                                  30-Sep-2022 11:02               11100
class.ui-control.php                               30-Sep-2022 11:02                5203
class.ui-controls-box.php                          30-Sep-2022 11:02                9122
class.ui-controls-button.php                       30-Sep-2022 11:02                6224
class.ui-controls-check.php                        30-Sep-2022 11:02                6950
class.ui-controls-colorbutton.php                  30-Sep-2022 11:02                6260
class.ui-controls-combo.php                        30-Sep-2022 11:02                6196
class.ui-controls-editablecombo.php                30-Sep-2022 11:02                6304
class.ui-controls-entry.php                        30-Sep-2022 11:02                8693
class.ui-controls-form.php                         30-Sep-2022 11:02                7314
class.ui-controls-grid.php                         30-Sep-2022 11:02               11283
class.ui-controls-group.php                        30-Sep-2022 11:02                7788
class.ui-controls-label.php                        30-Sep-2022 11:02                5975
class.ui-controls-multilineentry.php               30-Sep-2022 11:02                8976
class.ui-controls-picker.php                       30-Sep-2022 11:02                6859
class.ui-controls-progress.php                     30-Sep-2022 11:02                5540
class.ui-controls-radio.php                        30-Sep-2022 11:02                6175
class.ui-controls-separator.php                    30-Sep-2022 11:02                6477
class.ui-controls-slider.php                       30-Sep-2022 11:02                6507
class.ui-controls-spin.php                         30-Sep-2022 11:02                6377
class.ui-controls-tab.php                          30-Sep-2022 11:02                8239
class.ui-draw-brush-gradient.php                   30-Sep-2022 11:02                6318
class.ui-draw-brush-lineargradient.php             30-Sep-2022 11:02                5678
class.ui-draw-brush-radialgradient.php             30-Sep-2022 11:02                5806
class.ui-draw-brush.php                            30-Sep-2022 11:02                4173
class.ui-draw-color.php                            30-Sep-2022 11:02                7712
class.ui-draw-line-cap.php                         30-Sep-2022 11:02                2402
class.ui-draw-line-join.php                        30-Sep-2022 11:02                2362
class.ui-draw-matrix.php                           30-Sep-2022 11:02                5412
class.ui-draw-path.php                             30-Sep-2022 11:02                9443
class.ui-draw-pen.php                              30-Sep-2022 11:02                7920
class.ui-draw-stroke.php                           30-Sep-2022 11:02                6091
class.ui-draw-text-font-descriptor.php             30-Sep-2022 11:02                5365
class.ui-draw-text-font-italic.php                 30-Sep-2022 11:02                2592
class.ui-draw-text-font-stretch.php                30-Sep-2022 11:02                3991
class.ui-draw-text-font-weight.php                 30-Sep-2022 11:02                3970
class.ui-draw-text-font.php                        30-Sep-2022 11:02                4488
class.ui-draw-text-layout.php                      30-Sep-2022 11:02                4722
class.ui-exception-invalidargumentexception.php    30-Sep-2022 11:02                5852
class.ui-exception-runtimeexception.php            30-Sep-2022 11:02                5775
class.ui-executor.php                              30-Sep-2022 11:02                4823
class.ui-key.php                                   30-Sep-2022 11:02                9134
class.ui-menu.php                                  30-Sep-2022 11:02                5717
class.ui-menuitem.php                              30-Sep-2022 11:02                3549
class.ui-point.php                                 30-Sep-2022 11:02                5827
class.ui-size.php                                  30-Sep-2022 11:02                5911
class.ui-window.php                                30-Sep-2022 11:02               11796
class.underflowexception.php                       30-Sep-2022 11:02                5739
class.unexpectedvalueexception.php                 30-Sep-2022 11:02                5914
class.unhandledmatcherror.php                      30-Sep-2022 11:01                5692
class.unitenum.php                                 30-Sep-2022 11:01                2719
class.v8js.php                                     30-Sep-2022 11:02                7746
class.v8jsexception.php                            30-Sep-2022 11:02                9179
class.valueerror.php                               30-Sep-2022 11:01                5767
class.variant.php                                  30-Sep-2022 11:02                5547
class.varnishadmin.php                             30-Sep-2022 11:02                9877
class.varnishlog.php                               30-Sep-2022 11:02               28012
class.varnishstat.php                              30-Sep-2022 11:02                2800
class.volatile.php                                 30-Sep-2022 11:02               11540
class.vtiful-kernel-excel.php                      30-Sep-2022 11:02               10233
class.vtiful-kernel-format.php                     30-Sep-2022 11:02               13134
class.weakmap.php                                  30-Sep-2022 11:01                9465
class.weakreference.php                            30-Sep-2022 11:01                5502
class.win32serviceexception.php                    30-Sep-2022 11:02                5903
class.wkhtmltox-image-converter.php                30-Sep-2022 11:02                3772
class.wkhtmltox-pdf-converter.php                  30-Sep-2022 11:02                4163
class.wkhtmltox-pdf-object.php                     30-Sep-2022 11:02                2786
class.worker.php                                   30-Sep-2022 11:02                7636
class.xmldiff-base.php                             30-Sep-2022 11:02                4226
class.xmldiff-dom.php                              30-Sep-2022 11:02                5229
class.xmldiff-file.php                             30-Sep-2022 11:02                4845
class.xmldiff-memory.php                           30-Sep-2022 11:02                4877
class.xmlreader.php                                30-Sep-2022 11:02               32204
class.xmlwriter.php                                30-Sep-2022 11:02               25083
class.xsltprocessor.php                            30-Sep-2022 11:02                8299
class.yac.php                                      30-Sep-2022 11:02                8363
class.yaconf.php                                   30-Sep-2022 11:02                3307
class.yaf-action-abstract.php                      30-Sep-2022 11:02               11552
class.yaf-application.php                          30-Sep-2022 11:02               12355
class.yaf-bootstrap-abstract.php                   30-Sep-2022 11:02                6152
class.yaf-config-abstract.php                      30-Sep-2022 11:02                5047
class.yaf-config-ini.php                           30-Sep-2022 11:02               16543
class.yaf-config-simple.php                        30-Sep-2022 11:02               11991
class.yaf-controller-abstract.php                  30-Sep-2022 11:02               18680
class.yaf-dispatcher.php                           30-Sep-2022 11:02               19346
class.yaf-exception-dispatchfailed.php             30-Sep-2022 11:02                2547
class.yaf-exception-loadfailed-action.php          30-Sep-2022 11:02                2618
class.yaf-exception-loadfailed-controller.php      30-Sep-2022 11:02                2643
class.yaf-exception-loadfailed-module.php          30-Sep-2022 11:02                2607
class.yaf-exception-loadfailed-view.php            30-Sep-2022 11:02                2547
class.yaf-exception-loadfailed.php                 30-Sep-2022 11:02                2521
class.yaf-exception-routerfailed.php               30-Sep-2022 11:02                2532
class.yaf-exception-startuperror.php               30-Sep-2022 11:02                2530
class.yaf-exception-typeerror.php                  30-Sep-2022 11:02                2501
class.yaf-exception.php                            30-Sep-2022 11:02                6520
class.yaf-loader.php                               30-Sep-2022 11:02               17971
class.yaf-plugin-abstract.php                      30-Sep-2022 11:02               18319
class.yaf-registry.php                             30-Sep-2022 11:02                5552
class.yaf-request-abstract.php                     30-Sep-2022 11:02               21239
class.yaf-request-http.php                         30-Sep-2022 11:02               20482
class.yaf-request-simple.php                       30-Sep-2022 11:02               19734
class.yaf-response-abstract.php                    30-Sep-2022 11:02               10499
class.yaf-route-interface.php                      30-Sep-2022 11:02                3415
class.yaf-route-map.php                            30-Sep-2022 11:02                6023
class.yaf-route-regex.php                          30-Sep-2022 11:02                7509
class.yaf-route-rewrite.php                        30-Sep-2022 11:02                6784
class.yaf-route-simple.php                         30-Sep-2022 11:02                6040
class.yaf-route-static.php                         30-Sep-2022 11:02                4650
class.yaf-route-supervar.php                       30-Sep-2022 11:02                4370
class.yaf-router.php                               30-Sep-2022 11:02               11702
class.yaf-session.php                              30-Sep-2022 11:02               11402
class.yaf-view-interface.php                       30-Sep-2022 11:02                5335
class.yaf-view-simple.php                          30-Sep-2022 11:02                9885
class.yar-client-exception.php                     30-Sep-2022 11:02                6062
class.yar-client.php                               30-Sep-2022 11:02                5459
class.yar-concurrent-client.php                    30-Sep-2022 11:02                6148
class.yar-server-exception.php                     30-Sep-2022 11:02                6522
class.yar-server.php                               30-Sep-2022 11:02                3285
class.ziparchive.php                               30-Sep-2022 11:02               36604
class.zmq.php                                      30-Sep-2022 11:02               33956
class.zmqcontext.php                               30-Sep-2022 11:02                4978
class.zmqdevice.php                                30-Sep-2022 11:02                6931
class.zmqpoll.php                                  30-Sep-2022 11:02                4752
class.zmqsocket.php                                30-Sep-2022 11:02                9934
class.zookeeper.php                                30-Sep-2022 11:02               46813
class.zookeeperauthenticationexception.php         30-Sep-2022 11:02                5782
class.zookeeperconfig.php                          30-Sep-2022 11:02                5383
class.zookeeperconnectionexception.php             30-Sep-2022 11:02                5777
class.zookeeperexception.php                       30-Sep-2022 11:02                5643
class.zookeepermarshallingexception.php            30-Sep-2022 11:02                5798
class.zookeepernonodeexception.php                 30-Sep-2022 11:02                5765
class.zookeeperoperationtimeoutexception.php       30-Sep-2022 11:02                5808
class.zookeepersessionexception.php                30-Sep-2022 11:02                5736
classobj.configuration.php                         30-Sep-2022 11:02                1328
classobj.constants.php                             30-Sep-2022 11:02                1168
classobj.examples.php                              30-Sep-2022 11:02               14873
classobj.installation.php                          30-Sep-2022 11:02                1300
classobj.requirements.php                          30-Sep-2022 11:02                1268
classobj.resources.php                             30-Sep-2022 11:02                1252
classobj.setup.php                                 30-Sep-2022 11:02                1665
closure.bind.php                                   30-Sep-2022 11:01                7715
closure.bindto.php                                 30-Sep-2022 11:01                9137
closure.call.php                                   30-Sep-2022 11:01                6640
closure.construct.php                              30-Sep-2022 11:01                2426
closure.fromcallable.php                           30-Sep-2022 11:01                3817
cmark.installation.php                             30-Sep-2022 11:02                1983
cmark.requirements.php                             30-Sep-2022 11:02                1343
cmark.setup.php                                    30-Sep-2022 11:02                1456
collator.asort.php                                 30-Sep-2022 11:02                8994
collator.compare.php                               30-Sep-2022 11:02               10572
collator.construct.php                             30-Sep-2022 11:02                5535
collator.create.php                                30-Sep-2022 11:02                5355
collator.getattribute.php                          30-Sep-2022 11:02                5861
collator.geterrorcode.php                          30-Sep-2022 11:02                5147
collator.geterrormessage.php                       30-Sep-2022 11:02                5209
collator.getlocale.php                             30-Sep-2022 11:02                6537
collator.getsortkey.php                            30-Sep-2022 11:02                6627
collator.getstrength.php                           30-Sep-2022 11:02                4796
collator.setattribute.php                          30-Sep-2022 11:02                6420
collator.setstrength.php                           30-Sep-2022 11:02               12783
collator.sort.php                                  30-Sep-2022 11:02                7699
collator.sortwithsortkeys.php                      30-Sep-2022 11:02                6275
collectable.isgarbage.php                          30-Sep-2022 11:02                2667
com.configuration.php                              30-Sep-2022 11:02                7770
com.constants.php                                  30-Sep-2022 11:02               18677
com.construct.php                                  30-Sep-2022 11:02                8039
com.error-handling.php                             30-Sep-2022 11:02                1566
com.examples.arrays.php                            30-Sep-2022 11:02                2056
com.examples.foreach.php                           30-Sep-2022 11:02                2961
com.examples.php                                   30-Sep-2022 11:02                1393
com.installation.php                               30-Sep-2022 11:02                1642
com.requirements.php                               30-Sep-2022 11:02                1303
com.resources.php                                  30-Sep-2022 11:02                1214
com.setup.php                                      30-Sep-2022 11:02                1612
commonmark-cql.construct.php                       30-Sep-2022 11:02                2125
commonmark-cql.invoke.php                          30-Sep-2022 11:02                3754
commonmark-interfaces-ivisitable.accept.php        30-Sep-2022 11:02                3108
commonmark-interfaces-ivisitor.enter.php           30-Sep-2022 11:02                4109
commonmark-interfaces-ivisitor.leave.php           30-Sep-2022 11:02                4111
commonmark-node-bulletlist.construct.php           30-Sep-2022 11:02                2988
commonmark-node-codeblock.construct.php            30-Sep-2022 11:02                2700
commonmark-node-heading.construct.php              30-Sep-2022 11:02                2545
commonmark-node-image.construct.php                30-Sep-2022 11:02                3083
commonmark-node-link.construct.php                 30-Sep-2022 11:02                3080
commonmark-node-orderedlist.construct.php          30-Sep-2022 11:02                3804
commonmark-node-text.construct.php                 30-Sep-2022 11:02                2584
commonmark-node.accept.php                         30-Sep-2022 11:02                2848
commonmark-node.appendchild.php                    30-Sep-2022 11:02                2686
commonmark-node.insertafter.php                    30-Sep-2022 11:02                2711
commonmark-node.insertbefore.php                   30-Sep-2022 11:02                2709
commonmark-node.prependchild.php                   30-Sep-2022 11:02                2713
commonmark-node.replace.php                        30-Sep-2022 11:02                2657
commonmark-node.unlink.php                         30-Sep-2022 11:02                2330
commonmark-parser.construct.php                    30-Sep-2022 11:02                3236
commonmark-parser.finish.php                       30-Sep-2022 11:02                2385
commonmark-parser.parse.php                        30-Sep-2022 11:02                2531
compersisthelper.construct.php                     30-Sep-2022 11:02                3460
compersisthelper.getcurfilename.php                30-Sep-2022 11:02                3011
compersisthelper.getmaxstreamsize.php              30-Sep-2022 11:02                3045
compersisthelper.initnew.php                       30-Sep-2022 11:02                2891
compersisthelper.loadfromfile.php                  30-Sep-2022 11:02                3993
compersisthelper.loadfromstream.php                30-Sep-2022 11:02                3260
compersisthelper.savetofile.php                    30-Sep-2022 11:02                5894
compersisthelper.savetostream.php                  30-Sep-2022 11:02                3287
componere-abstract-definition.addinterface.php     30-Sep-2022 11:02                3248
componere-abstract-definition.addmethod.php        30-Sep-2022 11:02                4014
componere-abstract-definition.addtrait.php         30-Sep-2022 11:02                3200
componere-abstract-definition.getreflector.php     30-Sep-2022 11:02                2363
componere-definition.addconstant.php               30-Sep-2022 11:02                4298
componere-definition.addproperty.php               30-Sep-2022 11:02                3709
componere-definition.construct.php                 30-Sep-2022 11:02                5451
componere-definition.getclosure.php                30-Sep-2022 11:02                3374
componere-definition.getclosures.php               30-Sep-2022 11:02                2623
componere-definition.isregistered.php              30-Sep-2022 11:02                2186
componere-definition.register.php                  30-Sep-2022 11:02                2403
componere-method.construct.php                     30-Sep-2022 11:02                2181
componere-method.getreflector.php                  30-Sep-2022 11:02                2166
componere-method.setprivate.php                    30-Sep-2022 11:02                2426
componere-method.setprotected.php                  30-Sep-2022 11:02                2441
componere-method.setstatic.php                     30-Sep-2022 11:02                2024
componere-patch.apply.php                          30-Sep-2022 11:02                1825
componere-patch.construct.php                      30-Sep-2022 11:02                3417
componere-patch.derive.php                         30-Sep-2022 11:02                3159
componere-patch.getclosure.php                     30-Sep-2022 11:02                2968
componere-patch.getclosures.php                    30-Sep-2022 11:02                2108
componere-patch.isapplied.php                      30-Sep-2022 11:02                1745
componere-patch.revert.php                         30-Sep-2022 11:02                1822
componere-value.construct.php                      30-Sep-2022 11:02                2613
componere-value.hasdefault.php                     30-Sep-2022 11:02                1804
componere-value.isprivate.php                      30-Sep-2022 11:02                1810
componere-value.isprotected.php                    30-Sep-2022 11:02                1820
componere-value.isstatic.php                       30-Sep-2022 11:02                1804
componere-value.setprivate.php                     30-Sep-2022 11:02                2448
componere-value.setprotected.php                   30-Sep-2022 11:02                2462
componere-value.setstatic.php                      30-Sep-2022 11:02                2040
componere.cast.php                                 30-Sep-2022 11:02                4889
componere.cast_by_ref.php                          30-Sep-2022 11:02                5055
componere.installation.php                         30-Sep-2022 11:02                1354
componere.requirements.php                         30-Sep-2022 11:02                1233
componere.setup.php                                30-Sep-2022 11:02                1495
configuration.changes.modes.php                    30-Sep-2022 11:01                3789
configuration.changes.php                          30-Sep-2022 11:01                8863
configuration.file.per-user.php                    30-Sep-2022 11:01                3210
configuration.file.php                             30-Sep-2022 11:01               10195
configuration.php                                  30-Sep-2022 11:01                1766
configure.about.php                                30-Sep-2022 11:02               12683
configure.php                                      30-Sep-2022 11:02                1440
context.curl.php                                   30-Sep-2022 11:01                8943
context.ftp.php                                    30-Sep-2022 11:01                4206
context.http.php                                   30-Sep-2022 11:01               16121
context.params.php                                 30-Sep-2022 11:01                2529
context.phar.php                                   30-Sep-2022 11:01                2871
context.php                                        30-Sep-2022 11:01                3147
context.socket.php                                 30-Sep-2022 11:01               10241
context.ssl.php                                    30-Sep-2022 11:01               11181
context.zip.php                                    30-Sep-2022 11:01                4391
control-structures.alternative-syntax.php          30-Sep-2022 11:01                7163
control-structures.break.php                       30-Sep-2022 11:01                5466
control-structures.continue.php                    30-Sep-2022 11:01                7557
control-structures.declare.php                     30-Sep-2022 11:01               10558
control-structures.do.while.php                    30-Sep-2022 11:01                5350
control-structures.else.php                        30-Sep-2022 11:01                4831
control-structures.elseif.php                      30-Sep-2022 11:01                7781
control-structures.for.php                         30-Sep-2022 11:01               12507
control-structures.foreach.php                     30-Sep-2022 11:01               23135
control-structures.goto.php                        30-Sep-2022 11:01                7101
control-structures.if.php                          30-Sep-2022 11:01                4763
control-structures.intro.php                       30-Sep-2022 11:01                2526
control-structures.match.php                       30-Sep-2022 11:01               19977
control-structures.switch.php                      30-Sep-2022 11:01               16949
control-structures.while.php                       30-Sep-2022 11:01                4879
copyright.php                                      30-Sep-2022 11:01                2021
countable.count.php                                30-Sep-2022 11:02                5423
csprng.configuration.php                           30-Sep-2022 11:02                1311
csprng.constants.php                               30-Sep-2022 11:02                1157
csprng.installation.php                            30-Sep-2022 11:02                1283
csprng.requirements.php                            30-Sep-2022 11:02                1251
csprng.resources.php                               30-Sep-2022 11:02                1235
csprng.setup.php                                   30-Sep-2022 11:02                1629
ctype.configuration.php                            30-Sep-2022 11:02                1307
ctype.constants.php                                30-Sep-2022 11:02                1154
ctype.installation.php                             30-Sep-2022 11:02                1890
ctype.requirements.php                             30-Sep-2022 11:02                1280
ctype.resources.php                                30-Sep-2022 11:02                1231
ctype.setup.php                                    30-Sep-2022 11:02                1624
cubrid.configuration.php                           30-Sep-2022 11:02                1251
cubrid.constants.php                               30-Sep-2022 11:02               13781
cubrid.examples.php                                30-Sep-2022 11:02               21193
cubrid.installation.php                            30-Sep-2022 11:02                2091
cubrid.requirements.php                            30-Sep-2022 11:02                1309
cubrid.resources.php                               30-Sep-2022 11:02                3131
cubrid.setup.php                                   30-Sep-2022 11:02                1635
cubridmysql.cubrid.php                             30-Sep-2022 11:02                4899
curl.configuration.php                             30-Sep-2022 11:02                2472
curl.constants.php                                 30-Sep-2022 11:02              101403
curl.examples-basic.php                            30-Sep-2022 11:02                4690
curl.examples.php                                  30-Sep-2022 11:02                1357
curl.installation.php                              30-Sep-2022 11:02                2673
curl.requirements.php                              30-Sep-2022 11:02                1387
curl.resources.php                                 30-Sep-2022 11:02                1289
curl.setup.php                                     30-Sep-2022 11:02                1632
curlfile.construct.php                             30-Sep-2022 11:02               10329
curlfile.getfilename.php                           30-Sep-2022 11:02                2071
curlfile.getmimetype.php                           30-Sep-2022 11:02                2071
curlfile.getpostfilename.php                       30-Sep-2022 11:02                2145
curlfile.setmimetype.php                           30-Sep-2022 11:02                2335
curlfile.setpostfilename.php                       30-Sep-2022 11:02                2360
dateinterval.construct.php                         30-Sep-2022 11:02                8288
dateinterval.createfromdatestring.php              30-Sep-2022 11:02                8366
dateinterval.format.php                            30-Sep-2022 11:02               13726
dateperiod.construct.php                           30-Sep-2022 11:02               13419
dateperiod.getdateinterval.php                     30-Sep-2022 11:02                4631
dateperiod.getenddate.php                          30-Sep-2022 11:02                7575
dateperiod.getrecurrences.php                      30-Sep-2022 11:02                2615
dateperiod.getstartdate.php                        30-Sep-2022 11:02                5075
datetime.add.php                                   30-Sep-2022 11:02               12606
datetime.configuration.php                         30-Sep-2022 11:02                5389
datetime.constants.php                             30-Sep-2022 11:02                2703
datetime.construct.php                             30-Sep-2022 11:02               16411
datetime.createfromformat.php                      30-Sep-2022 11:02               27933
datetime.createfromimmutable.php                   30-Sep-2022 11:02                4266
datetime.createfrominterface.php                   30-Sep-2022 11:02                4883
datetime.diff.php                                  30-Sep-2022 11:02               11836
datetime.format.php                                30-Sep-2022 11:02               21221
datetime.formats.compound.php                      30-Sep-2022 11:02                9346
datetime.formats.date.php                          30-Sep-2022 11:02               13515
datetime.formats.php                               30-Sep-2022 11:02                2660
datetime.formats.relative.php                      30-Sep-2022 11:02               14535
datetime.formats.time.php                          30-Sep-2022 11:02                7243
datetime.getlasterrors.php                         30-Sep-2022 11:02                5750
datetime.getoffset.php                             30-Sep-2022 11:02                7805
datetime.gettimestamp.php                          30-Sep-2022 11:02                6136
datetime.gettimezone.php                           30-Sep-2022 11:02                7323
datetime.installation.php                          30-Sep-2022 11:02                2263
datetime.modify.php                                30-Sep-2022 11:02               10711
datetime.requirements.php                          30-Sep-2022 11:02                1268
datetime.resources.php                             30-Sep-2022 11:02                1252
datetime.set-state.php                             30-Sep-2022 11:02                2507
datetime.setdate.php                               30-Sep-2022 11:02               11097
datetime.setisodate.php                            30-Sep-2022 11:02               14146
datetime.settime.php                               30-Sep-2022 11:02               13952
datetime.settimestamp.php                          30-Sep-2022 11:02                9414
datetime.settimezone.php                           30-Sep-2022 11:02                9312
datetime.setup.php                                 30-Sep-2022 11:02                1687
datetime.sub.php                                   30-Sep-2022 11:02               12630
datetime.wakeup.php                                30-Sep-2022 11:02                2726
datetimeimmutable.add.php                          30-Sep-2022 11:02                2336
datetimeimmutable.construct.php                    30-Sep-2022 11:02                3394
datetimeimmutable.createfromformat.php             30-Sep-2022 11:02                3761
datetimeimmutable.createfrominterface.php          30-Sep-2022 11:02                5147
datetimeimmutable.createfrommutable.php            30-Sep-2022 11:02                4453
datetimeimmutable.getlasterrors.php                30-Sep-2022 11:02                2183
datetimeimmutable.modify.php                       30-Sep-2022 11:02                3258
datetimeimmutable.set-state.php                    30-Sep-2022 11:02                2319
datetimeimmutable.setdate.php                      30-Sep-2022 11:02                2453
datetimeimmutable.setisodate.php                   30-Sep-2022 11:02                2512
datetimeimmutable.settime.php                      30-Sep-2022 11:02                2504
datetimeimmutable.settimestamp.php                 30-Sep-2022 11:02                2344
datetimeimmutable.settimezone.php                  30-Sep-2022 11:02                2367
datetimeimmutable.sub.php                          30-Sep-2022 11:02                2337
datetimezone.construct.php                         30-Sep-2022 11:02                6084
datetimezone.getlocation.php                       30-Sep-2022 11:02                5002
datetimezone.getname.php                           30-Sep-2022 11:02                3044
datetimezone.getoffset.php                         30-Sep-2022 11:02                7401
datetimezone.gettransitions.php                    30-Sep-2022 11:02                7169
datetimezone.listabbreviations.php                 30-Sep-2022 11:02                4999
datetimezone.listidentifiers.php                   30-Sep-2022 11:02                7062
dba.configuration.php                              30-Sep-2022 11:02                2262
dba.constants.php                                  30-Sep-2022 11:02                1903
dba.example.php                                    30-Sep-2022 11:02                6666
dba.examples.php                                   30-Sep-2022 11:02                1293
dba.installation.php                               30-Sep-2022 11:02                9450
dba.requirements.php                               30-Sep-2022 11:02                7257
dba.resources.php                                  30-Sep-2022 11:02                1495
dba.setup.php                                      30-Sep-2022 11:02                1616
dbase.configuration.php                            30-Sep-2022 11:02                1307
dbase.constants.php                                30-Sep-2022 11:02                1154
dbase.installation.php                             30-Sep-2022 11:02                1356
dbase.requirements.php                             30-Sep-2022 11:02                1247
dbase.resources.php                                30-Sep-2022 11:02                1231
dbase.setup.php                                    30-Sep-2022 11:02                1640
debugger-about.php                                 30-Sep-2022 11:02                1820
debugger.php                                       30-Sep-2022 11:02                1353
dio.configuration.php                              30-Sep-2022 11:02                1290
dio.constants.php                                  30-Sep-2022 11:02                7248
dio.installation.php                               30-Sep-2022 11:02                2026
dio.requirements.php                               30-Sep-2022 11:02                1230
dio.resources.php                                  30-Sep-2022 11:02                1353
dio.setup.php                                      30-Sep-2022 11:02                1617
dir.configuration.php                              30-Sep-2022 11:02                1293
dir.constants.php                                  30-Sep-2022 11:02                1870
dir.installation.php                               30-Sep-2022 11:02                1265
dir.requirements.php                               30-Sep-2022 11:02                1233
dir.resources.php                                  30-Sep-2022 11:02                1217
dir.setup.php                                      30-Sep-2022 11:02                1615
directoryiterator.construct.php                    30-Sep-2022 11:02                2623
directoryiterator.current.php                      30-Sep-2022 11:02                2450
directoryiterator.getatime.php                     30-Sep-2022 11:02                2421
directoryiterator.getbasename.php                  30-Sep-2022 11:02                6775
directoryiterator.getctime.php                     30-Sep-2022 11:02                2451
directoryiterator.getextension.php                 30-Sep-2022 11:02                5203
directoryiterator.getfilename.php                  30-Sep-2022 11:02                2499
directoryiterator.getgroup.php                     30-Sep-2022 11:02                2371
directoryiterator.getinode.php                     30-Sep-2022 11:02                2365
directoryiterator.getmtime.php                     30-Sep-2022 11:02                2437
directoryiterator.getowner.php                     30-Sep-2022 11:02                2387
directoryiterator.getpath.php                      30-Sep-2022 11:02                2379
directoryiterator.getpathname.php                  30-Sep-2022 11:02                2515
directoryiterator.getperms.php                     30-Sep-2022 11:02                2390
directoryiterator.getsize.php                      30-Sep-2022 11:02                2359
directoryiterator.gettype.php                      30-Sep-2022 11:02                2347
directoryiterator.isdir.php                        30-Sep-2022 11:02                2452
directoryiterator.isdot.php                        30-Sep-2022 11:02                2615
directoryiterator.isexecutable.php                 30-Sep-2022 11:02                2518
directoryiterator.isfile.php                       30-Sep-2022 11:02                2466
directoryiterator.islink.php                       30-Sep-2022 11:02                2496
directoryiterator.isreadable.php                   30-Sep-2022 11:02                2504
directoryiterator.iswritable.php                   30-Sep-2022 11:02                2513
directoryiterator.key.php                          30-Sep-2022 11:02                2350
directoryiterator.next.php                         30-Sep-2022 11:02                2359
directoryiterator.rewind.php                       30-Sep-2022 11:02                2388
directoryiterator.seek.php                         30-Sep-2022 11:02                5406
directoryiterator.tostring.php                     30-Sep-2022 11:02                4644
directoryiterator.valid.php                        30-Sep-2022 11:02                2375
doc.changelog.php                                  30-Sep-2022 11:02              145854
dom.configuration.php                              30-Sep-2022 11:02                1290
dom.constants.php                                  30-Sep-2022 11:02               15992
dom.examples.php                                   30-Sep-2022 11:02                2931
dom.installation.php                               30-Sep-2022 11:02                1352
dom.requirements.php                               30-Sep-2022 11:02                1410
dom.resources.php                                  30-Sep-2022 11:02                1214
dom.setup.php                                      30-Sep-2022 11:02                1606
domattr.construct.php                              30-Sep-2022 11:02                5481
domattr.isid.php                                   30-Sep-2022 11:02                4977
domcdatasection.construct.php                      30-Sep-2022 11:02                5154
domcharacterdata.appenddata.php                    30-Sep-2022 11:02                3669
domcharacterdata.deletedata.php                    30-Sep-2022 11:02                4664
domcharacterdata.insertdata.php                    30-Sep-2022 11:02                4384
domcharacterdata.replacedata.php                   30-Sep-2022 11:02                5004
domcharacterdata.substringdata.php                 30-Sep-2022 11:02                4663
domcomment.construct.php                           30-Sep-2022 11:02                5005
domdocument.construct.php                          30-Sep-2022 11:02                4288
domdocument.createattribute.php                    30-Sep-2022 11:02                5746
domdocument.createattributens.php                  30-Sep-2022 11:02                6591
domdocument.createcdatasection.php                 30-Sep-2022 11:02                5431
domdocument.createcomment.php                      30-Sep-2022 11:02                5831
domdocument.createdocumentfragment.php             30-Sep-2022 11:02                5720
domdocument.createelement.php                      30-Sep-2022 11:02               11287
domdocument.createelementns.php                    30-Sep-2022 11:02               14001
domdocument.createentityreference.php              30-Sep-2022 11:02                6063
domdocument.createprocessinginstruction.php        30-Sep-2022 11:02                6327
domdocument.createtextnode.php                     30-Sep-2022 11:02                5819
domdocument.getelementbyid.php                     30-Sep-2022 11:02                7604
domdocument.getelementsbytagname.php               30-Sep-2022 11:02                6131
domdocument.getelementsbytagnamens.php             30-Sep-2022 11:02                7603
domdocument.importnode.php                         30-Sep-2022 11:02                8924
domdocument.load.php                               30-Sep-2022 11:02                5922
domdocument.loadhtml.php                           30-Sep-2022 11:02                6515
domdocument.loadhtmlfile.php                       30-Sep-2022 11:02                6262
domdocument.loadxml.php                            30-Sep-2022 11:02                6674
domdocument.normalizedocument.php                  30-Sep-2022 11:02                2943
domdocument.registernodeclass.php                  30-Sep-2022 11:02               21087
domdocument.relaxngvalidate.php                    30-Sep-2022 11:02                3821
domdocument.relaxngvalidatesource.php              30-Sep-2022 11:02                3854
domdocument.save.php                               30-Sep-2022 11:02                7549
domdocument.savehtml.php                           30-Sep-2022 11:02                7438
domdocument.savehtmlfile.php                       30-Sep-2022 11:02                7987
domdocument.savexml.php                            30-Sep-2022 11:02                8850
domdocument.schemavalidate.php                     30-Sep-2022 11:02                4153
domdocument.schemavalidatesource.php               30-Sep-2022 11:02                4215
domdocument.validate.php                           30-Sep-2022 11:02                5957
domdocument.xinclude.php                           30-Sep-2022 11:02                7087
domdocumentfragment.appendxml.php                  30-Sep-2022 11:02                5300
domdocumentfragment.construct.php                  30-Sep-2022 11:02                2078
domelement.construct.php                           30-Sep-2022 11:02                6499
domelement.getattribute.php                        30-Sep-2022 11:02                3419
domelement.getattributenode.php                    30-Sep-2022 11:02                3942
domelement.getattributenodens.php                  30-Sep-2022 11:02                4326
domelement.getattributens.php                      30-Sep-2022 11:02                3877
domelement.getelementsbytagname.php                30-Sep-2022 11:02                3558
domelement.getelementsbytagnamens.php              30-Sep-2022 11:02                4274
domelement.hasattribute.php                        30-Sep-2022 11:02                3625
domelement.hasattributens.php                      30-Sep-2022 11:02                3999
domelement.removeattribute.php                     30-Sep-2022 11:02                3762
domelement.removeattributenode.php                 30-Sep-2022 11:02                4197
domelement.removeattributens.php                   30-Sep-2022 11:02                4167
domelement.setattribute.php                        30-Sep-2022 11:02                5961
domelement.setattributenode.php                    30-Sep-2022 11:02                3945
domelement.setattributenodens.php                  30-Sep-2022 11:02                3943
domelement.setattributens.php                      30-Sep-2022 11:02                4839
domelement.setidattribute.php                      30-Sep-2022 11:02                4467
domelement.setidattributenode.php                  30-Sep-2022 11:02                4521
domelement.setidattributens.php                    30-Sep-2022 11:02                4834
domentityreference.construct.php                   30-Sep-2022 11:02                4837
domimplementation.construct.php                    30-Sep-2022 11:02                2107
domimplementation.createdocument.php               30-Sep-2022 11:02                6556
domimplementation.createdocumenttype.php           30-Sep-2022 11:02                9055
domimplementation.hasfeature.php                   30-Sep-2022 11:02                9449
domnamednodemap.count.php                          30-Sep-2022 11:02                2327
domnamednodemap.getnameditem.php                   30-Sep-2022 11:02                3260
domnamednodemap.getnameditemns.php                 30-Sep-2022 11:02                3638
domnamednodemap.item.php                           30-Sep-2022 11:02                2842
domnode.appendchild.php                            30-Sep-2022 11:02                6296
domnode.c14n.php                                   30-Sep-2022 11:02                4259
domnode.c14nfile.php                               30-Sep-2022 11:02                4539
domnode.clonenode.php                              30-Sep-2022 11:02                2611
domnode.getlineno.php                              30-Sep-2022 11:02                4857
domnode.getnodepath.php                            30-Sep-2022 11:02                5141
domnode.hasattributes.php                          30-Sep-2022 11:02                2712
domnode.haschildnodes.php                          30-Sep-2022 11:02                2634
domnode.insertbefore.php                           30-Sep-2022 11:02                4997
domnode.isdefaultnamespace.php                     30-Sep-2022 11:02                2662
domnode.issamenode.php                             30-Sep-2022 11:02                2613
domnode.issupported.php                            30-Sep-2022 11:02                3508
domnode.lookupnamespaceuri.php                     30-Sep-2022 11:02                2944
domnode.lookupprefix.php                           30-Sep-2022 11:02                2920
domnode.normalize.php                              30-Sep-2022 11:02                2769
domnode.removechild.php                            30-Sep-2022 11:02                6784
domnode.replacechild.php                           30-Sep-2022 11:02                5298
domnodelist.count.php                              30-Sep-2022 11:02                2240
domnodelist.item.php                               30-Sep-2022 11:02                6767
domprocessinginstruction.construct.php             30-Sep-2022 11:02                6614
domtext.construct.php                              30-Sep-2022 11:02                4803
domtext.iselementcontentwhitespace.php             30-Sep-2022 11:02                2434
domtext.iswhitespaceinelementcontent.php           30-Sep-2022 11:02                2636
domtext.splittext.php                              30-Sep-2022 11:02                2992
domxpath.construct.php                             30-Sep-2022 11:02                2735
domxpath.evaluate.php                              30-Sep-2022 11:02                7399
domxpath.query.php                                 30-Sep-2022 11:02               12212
domxpath.registernamespace.php                     30-Sep-2022 11:02                2984
domxpath.registerphpfunctions.php                  30-Sep-2022 11:02               13998
dotnet.construct.php                               30-Sep-2022 11:02                2858
ds-collection.clear.php                            30-Sep-2022 11:02                3953
ds-collection.copy.php                             30-Sep-2022 11:02                4398
ds-collection.isempty.php                          30-Sep-2022 11:02                4241
ds-collection.toarray.php                          30-Sep-2022 11:02                4011
ds-deque.allocate.php                              30-Sep-2022 11:02                4600
ds-deque.apply.php                                 30-Sep-2022 11:02                5084
ds-deque.capacity.php                              30-Sep-2022 11:02                3913
ds-deque.clear.php                                 30-Sep-2022 11:02                3835
ds-deque.construct.php                             30-Sep-2022 11:02                4359
ds-deque.contains.php                              30-Sep-2022 11:02                7515
ds-deque.copy.php                                  30-Sep-2022 11:02                4225
ds-deque.count.php                                 30-Sep-2022 11:02                1532
ds-deque.filter.php                                30-Sep-2022 11:02                7518
ds-deque.find.php                                  30-Sep-2022 11:02                5481
ds-deque.first.php                                 30-Sep-2022 11:02                3814
ds-deque.get.php                                   30-Sep-2022 11:02                6668
ds-deque.insert.php                                30-Sep-2022 11:02                7009
ds-deque.isempty.php                               30-Sep-2022 11:02                4088
ds-deque.join.php                                  30-Sep-2022 11:02                5757
ds-deque.jsonserialize.php                         30-Sep-2022 11:02                1812
ds-deque.last.php                                  30-Sep-2022 11:02                3802
ds-deque.map.php                                   30-Sep-2022 11:02                5461
ds-deque.merge.php                                 30-Sep-2022 11:02                4892
ds-deque.pop.php                                   30-Sep-2022 11:02                4299
ds-deque.push.php                                  30-Sep-2022 11:02                4717
ds-deque.reduce.php                                30-Sep-2022 11:02                8685
ds-deque.remove.php                                30-Sep-2022 11:02                4868
ds-deque.reverse.php                               30-Sep-2022 11:02                3671
ds-deque.reversed.php                              30-Sep-2022 11:02                4040
ds-deque.rotate.php                                30-Sep-2022 11:02                5094
ds-deque.set.php                                   30-Sep-2022 11:02                6136
ds-deque.shift.php                                 30-Sep-2022 11:02                4400
ds-deque.slice.php                                 30-Sep-2022 11:02                7241
ds-deque.sort.php                                  30-Sep-2022 11:02                7551
ds-deque.sorted.php                                30-Sep-2022 11:02                7606
ds-deque.sum.php                                   30-Sep-2022 11:02                5134
ds-deque.toarray.php                               30-Sep-2022 11:02                3862
ds-deque.unshift.php                               30-Sep-2022 11:02                4797
ds-hashable.equals.php                             30-Sep-2022 11:02                3394
ds-hashable.hash.php                               30-Sep-2022 11:02                8541
ds-map.allocate.php                                30-Sep-2022 11:02                4466
ds-map.apply.php                                   30-Sep-2022 11:02                5856
ds-map.capacity.php                                30-Sep-2022 11:02                3198
ds-map.clear.php                                   30-Sep-2022 11:02                4391
ds-map.construct.php                               30-Sep-2022 11:02                4891
ds-map.copy.php                                    30-Sep-2022 11:02                4155
ds-map.count.php                                   30-Sep-2022 11:02                1493
ds-map.diff.php                                    30-Sep-2022 11:02                5647
ds-map.filter.php                                  30-Sep-2022 11:02                8383
ds-map.first.php                                   30-Sep-2022 11:02                4102
ds-map.get.php                                     30-Sep-2022 11:02                8680
ds-map.haskey.php                                  30-Sep-2022 11:02                4641
ds-map.hasvalue.php                                30-Sep-2022 11:02                4685
ds-map.intersect.php                               30-Sep-2022 11:02                6168
ds-map.isempty.php                                 30-Sep-2022 11:02                4340
ds-map.jsonserialize.php                           30-Sep-2022 11:02                1790
ds-map.keys.php                                    30-Sep-2022 11:02                3992
ds-map.ksort.php                                   30-Sep-2022 11:02                8283
ds-map.ksorted.php                                 30-Sep-2022 11:02                8400
ds-map.last.php                                    30-Sep-2022 11:02                4087
ds-map.map.php                                     30-Sep-2022 11:02                6501
ds-map.merge.php                                   30-Sep-2022 11:02                5801
ds-map.pairs.php                                   30-Sep-2022 11:02                4383
ds-map.put.php                                     30-Sep-2022 11:02               14865
ds-map.putall.php                                  30-Sep-2022 11:02                5448
ds-map.reduce.php                                  30-Sep-2022 11:02                9735
ds-map.remove.php                                  30-Sep-2022 11:02                7110
ds-map.reverse.php                                 30-Sep-2022 11:02                4153
ds-map.reversed.php                                30-Sep-2022 11:02                4280
ds-map.skip.php                                    30-Sep-2022 11:02                4592
ds-map.slice.php                                   30-Sep-2022 11:02                8142
ds-map.sort.php                                    30-Sep-2022 11:02                8201
ds-map.sorted.php                                  30-Sep-2022 11:02                8379
ds-map.sum.php                                     30-Sep-2022 11:02                5661
ds-map.toarray.php                                 30-Sep-2022 11:02                4823
ds-map.union.php                                   30-Sep-2022 11:02                6152
ds-map.values.php                                  30-Sep-2022 11:02                3986
ds-map.xor.php                                     30-Sep-2022 11:02                5709
ds-pair.clear.php                                  30-Sep-2022 11:02                3731
ds-pair.construct.php                              30-Sep-2022 11:02                2634
ds-pair.copy.php                                   30-Sep-2022 11:02                4144
ds-pair.isempty.php                                30-Sep-2022 11:02                4033
ds-pair.jsonserialize.php                          30-Sep-2022 11:02                1810
ds-pair.toarray.php                                30-Sep-2022 11:02                3787
ds-priorityqueue.allocate.php                      30-Sep-2022 11:02                4766
ds-priorityqueue.capacity.php                      30-Sep-2022 11:02                3407
ds-priorityqueue.clear.php                         30-Sep-2022 11:02                4502
ds-priorityqueue.construct.php                     30-Sep-2022 11:02                2939
ds-priorityqueue.copy.php                          30-Sep-2022 11:02                4528
ds-priorityqueue.count.php                         30-Sep-2022 11:02                1641
ds-priorityqueue.isempty.php                       30-Sep-2022 11:02                5008
ds-priorityqueue.jsonserialize.php                 30-Sep-2022 11:02                1930
ds-priorityqueue.peek.php                          30-Sep-2022 11:02                4802
ds-priorityqueue.pop.php                           30-Sep-2022 11:02                5572
ds-priorityqueue.push.php                          30-Sep-2022 11:02                5599
ds-priorityqueue.toarray.php                       30-Sep-2022 11:02                4971
ds-queue.allocate.php                              30-Sep-2022 11:02                4793
ds-queue.capacity.php                              30-Sep-2022 11:02                3919
ds-queue.clear.php                                 30-Sep-2022 11:02                3820
ds-queue.construct.php                             30-Sep-2022 11:02                4357
ds-queue.copy.php                                  30-Sep-2022 11:02                4362
ds-queue.count.php                                 30-Sep-2022 11:02                1529
ds-queue.isempty.php                               30-Sep-2022 11:02                4104
ds-queue.jsonserialize.php                         30-Sep-2022 11:02                1818
ds-queue.peek.php                                  30-Sep-2022 11:02                4386
ds-queue.pop.php                                   30-Sep-2022 11:02                4920
ds-queue.push.php                                  30-Sep-2022 11:02                4752
ds-queue.toarray.php                               30-Sep-2022 11:02                4022
ds-sequence.allocate.php                           30-Sep-2022 11:02                4504
ds-sequence.apply.php                              30-Sep-2022 11:02                5199
ds-sequence.capacity.php                           30-Sep-2022 11:02                4478
ds-sequence.contains.php                           30-Sep-2022 11:02                7642
ds-sequence.filter.php                             30-Sep-2022 11:02                7657
ds-sequence.find.php                               30-Sep-2022 11:02                5593
ds-sequence.first.php                              30-Sep-2022 11:02                3929
ds-sequence.get.php                                30-Sep-2022 11:02                6796
ds-sequence.insert.php                             30-Sep-2022 11:02                7128
ds-sequence.join.php                               30-Sep-2022 11:02                5853
ds-sequence.last.php                               30-Sep-2022 11:02                3896
ds-sequence.map.php                                30-Sep-2022 11:02                5590
ds-sequence.merge.php                              30-Sep-2022 11:02                5018
ds-sequence.pop.php                                30-Sep-2022 11:02                4411
ds-sequence.push.php                               30-Sep-2022 11:02                4839
ds-sequence.reduce.php                             30-Sep-2022 11:02                8804
ds-sequence.remove.php                             30-Sep-2022 11:02                4980
ds-sequence.reverse.php                            30-Sep-2022 11:02                3784
ds-sequence.reversed.php                           30-Sep-2022 11:02                4163
ds-sequence.rotate.php                             30-Sep-2022 11:02                5231
ds-sequence.set.php                                30-Sep-2022 11:02                6260
ds-sequence.shift.php                              30-Sep-2022 11:02                4512
ds-sequence.slice.php                              30-Sep-2022 11:02                7406
ds-sequence.sort.php                               30-Sep-2022 11:02                7678
ds-sequence.sorted.php                             30-Sep-2022 11:02                7733
ds-sequence.sum.php                                30-Sep-2022 11:02                5259
ds-sequence.unshift.php                            30-Sep-2022 11:02                4908
ds-set.add.php                                     30-Sep-2022 11:02               13049
ds-set.allocate.php                                30-Sep-2022 11:02                4479
ds-set.capacity.php                                30-Sep-2022 11:02                3872
ds-set.clear.php                                   30-Sep-2022 11:02                3766
ds-set.construct.php                               30-Sep-2022 11:02                4311
ds-set.contains.php                                30-Sep-2022 11:02                7470
ds-set.copy.php                                    30-Sep-2022 11:02                4301
ds-set.count.php                                   30-Sep-2022 11:02                1493
ds-set.diff.php                                    30-Sep-2022 11:02                4877
ds-set.filter.php                                  30-Sep-2022 11:02                7466
ds-set.first.php                                   30-Sep-2022 11:02                3767
ds-set.get.php                                     30-Sep-2022 11:02                6612
ds-set.intersect.php                               30-Sep-2022 11:02                5108
ds-set.isempty.php                                 30-Sep-2022 11:02                4046
ds-set.join.php                                    30-Sep-2022 11:02                5703
ds-set.jsonserialize.php                           30-Sep-2022 11:02                1784
ds-set.last.php                                    30-Sep-2022 11:02                3768
ds-set.merge.php                                   30-Sep-2022 11:02                4818
ds-set.reduce.php                                  30-Sep-2022 11:02                8631
ds-set.remove.php                                  30-Sep-2022 11:02                5228
ds-set.reverse.php                                 30-Sep-2022 11:02                3619
ds-set.reversed.php                                30-Sep-2022 11:02                3978
ds-set.slice.php                                   30-Sep-2022 11:02                7155
ds-set.sort.php                                    30-Sep-2022 11:02                7487
ds-set.sorted.php                                  30-Sep-2022 11:02                7542
ds-set.sum.php                                     30-Sep-2022 11:02                5074
ds-set.toarray.php                                 30-Sep-2022 11:02                3808
ds-set.union.php                                   30-Sep-2022 11:02                5071
ds-set.xor.php                                     30-Sep-2022 11:02                5043
ds-stack.allocate.php                              30-Sep-2022 11:02                2718
ds-stack.capacity.php                              30-Sep-2022 11:02                2079
ds-stack.clear.php                                 30-Sep-2022 11:02                3816
ds-stack.construct.php                             30-Sep-2022 11:02                4323
ds-stack.copy.php                                  30-Sep-2022 11:02                4362
ds-stack.count.php                                 30-Sep-2022 11:02                1529
ds-stack.isempty.php                               30-Sep-2022 11:02                4104
ds-stack.jsonserialize.php                         30-Sep-2022 11:02                1818
ds-stack.peek.php                                  30-Sep-2022 11:02                4351
ds-stack.pop.php                                   30-Sep-2022 11:02                4914
ds-stack.push.php                                  30-Sep-2022 11:02                4752
ds-stack.toarray.php                               30-Sep-2022 11:02                3849
ds-vector.allocate.php                             30-Sep-2022 11:02                4421
ds-vector.apply.php                                30-Sep-2022 11:02                5110
ds-vector.capacity.php                             30-Sep-2022 11:02                4383
ds-vector.clear.php                                30-Sep-2022 11:02                3847
ds-vector.construct.php                            30-Sep-2022 11:02                4391
ds-vector.contains.php                             30-Sep-2022 11:02                7545
ds-vector.copy.php                                 30-Sep-2022 11:02                4386
ds-vector.count.php                                30-Sep-2022 11:02                1546
ds-vector.filter.php                               30-Sep-2022 11:02                7552
ds-vector.find.php                                 30-Sep-2022 11:02                5506
ds-vector.first.php                                30-Sep-2022 11:02                3840
ds-vector.get.php                                  30-Sep-2022 11:02                6699
ds-vector.insert.php                               30-Sep-2022 11:02                7039
ds-vector.isempty.php                              30-Sep-2022 11:02                4112
ds-vector.join.php                                 30-Sep-2022 11:02                5784
ds-vector.jsonserialize.php                        30-Sep-2022 11:02                1826
ds-vector.last.php                                 30-Sep-2022 11:02                3827
ds-vector.map.php                                  30-Sep-2022 11:02                5493
ds-vector.merge.php                                30-Sep-2022 11:02                4923
ds-vector.pop.php                                  30-Sep-2022 11:02                4324
ds-vector.push.php                                 30-Sep-2022 11:02                4746
ds-vector.reduce.php                               30-Sep-2022 11:02                8713
ds-vector.remove.php                               30-Sep-2022 11:02                4893
ds-vector.reverse.php                              30-Sep-2022 11:02                3697
ds-vector.reversed.php                             30-Sep-2022 11:02                4070
ds-vector.rotate.php                               30-Sep-2022 11:02                5128
ds-vector.set.php                                  30-Sep-2022 11:02                6167
ds-vector.shift.php                                30-Sep-2022 11:02                4425
ds-vector.slice.php                                30-Sep-2022 11:02                7287
ds-vector.sort.php                                 30-Sep-2022 11:02                7583
ds-vector.sorted.php                               30-Sep-2022 11:02                7638
ds-vector.sum.php                                  30-Sep-2022 11:02                5164
ds-vector.toarray.php                              30-Sep-2022 11:02                3887
ds-vector.unshift.php                              30-Sep-2022 11:02                4827
ds.constants.php                                   30-Sep-2022 11:02                1134
ds.examples.php                                    30-Sep-2022 11:02                4891
ds.installation.php                                30-Sep-2022 11:02                2522
ds.requirements.php                                30-Sep-2022 11:02                1234
ds.setup.php                                       30-Sep-2022 11:02                1432
eio.configuration.php                              30-Sep-2022 11:02                1288
eio.constants.php                                  30-Sep-2022 11:02               16091
eio.examples.php                                   30-Sep-2022 11:02               29455
eio.installation.php                               30-Sep-2022 11:02                1737
eio.requirements.php                               30-Sep-2022 11:02                1354
eio.resources.php                                  30-Sep-2022 11:02                1261
eio.setup.php                                      30-Sep-2022 11:02                1618
emptyiterator.current.php                          30-Sep-2022 11:02                2657
emptyiterator.key.php                              30-Sep-2022 11:02                2621
emptyiterator.next.php                             30-Sep-2022 11:02                2332
emptyiterator.rewind.php                           30-Sep-2022 11:02                2354
emptyiterator.valid.php                            30-Sep-2022 11:02                2334
enchant.configuration.php                          30-Sep-2022 11:02                1318
enchant.constants.php                              30-Sep-2022 11:02                2544
enchant.examples.php                               30-Sep-2022 11:02                5870
enchant.installation.php                           30-Sep-2022 11:02                3274
enchant.requirements.php                           30-Sep-2022 11:02                1837
enchant.resources.php                              30-Sep-2022 11:02                1368
enchant.setup.php                                  30-Sep-2022 11:02                1663
error.clone.php                                    30-Sep-2022 11:01                2316
error.construct.php                                30-Sep-2022 11:01                3147
error.getcode.php                                  30-Sep-2022 11:01                4123
error.getfile.php                                  30-Sep-2022 11:01                3733
error.getline.php                                  30-Sep-2022 11:01                3991
error.getmessage.php                               30-Sep-2022 11:01                3829
error.getprevious.php                              30-Sep-2022 11:01                6812
error.gettrace.php                                 30-Sep-2022 11:01                4227
error.gettraceasstring.php                         30-Sep-2022 11:01                4123
error.tostring.php                                 30-Sep-2022 11:01                3822
errorexception.construct.php                       30-Sep-2022 11:01                4996
errorexception.getseverity.php                     30-Sep-2022 11:01                4342
errorfunc.configuration.php                        30-Sep-2022 11:02               24300
errorfunc.constants.php                            30-Sep-2022 11:02                9681
errorfunc.examples.php                             30-Sep-2022 11:02               24043
errorfunc.installation.php                         30-Sep-2022 11:02                1307
errorfunc.requirements.php                         30-Sep-2022 11:02                1275
errorfunc.resources.php                            30-Sep-2022 11:02                1259
errorfunc.setup.php                                30-Sep-2022 11:02                1687
ev.backend.php                                     30-Sep-2022 11:02                3401
ev.configuration.php                               30-Sep-2022 11:02                1283
ev.depth.php                                       30-Sep-2022 11:02                3179
ev.embeddablebackends.php                          30-Sep-2022 11:02                6938
ev.examples.php                                    30-Sep-2022 11:02               47776
ev.feedsignal.php                                  30-Sep-2022 11:02                3278
ev.feedsignalevent.php                             30-Sep-2022 11:02                3065
ev.global.constants.php                            30-Sep-2022 11:02                1278
ev.installation.php                                30-Sep-2022 11:02                1736
ev.iteration.php                                   30-Sep-2022 11:02                2553
ev.now.php                                         30-Sep-2022 11:02                3024
ev.nowupdate.php                                   30-Sep-2022 11:02                3155
ev.periodic-modes.php                              30-Sep-2022 11:02                7869
ev.recommendedbackends.php                         30-Sep-2022 11:02                7680
ev.requirements.php                                30-Sep-2022 11:02                1289
ev.resources.php                                   30-Sep-2022 11:02                1214
ev.resume.php                                      30-Sep-2022 11:02                3745
ev.run.php                                         30-Sep-2022 11:02                4772
ev.setup.php                                       30-Sep-2022 11:02                1573
ev.sleep.php                                       30-Sep-2022 11:02                2322
ev.stop.php                                        30-Sep-2022 11:02                2794
ev.supportedbackends.php                           30-Sep-2022 11:02                6920
ev.suspend.php                                     30-Sep-2022 11:02                3478
ev.time.php                                        30-Sep-2022 11:02                2598
ev.verify.php                                      30-Sep-2022 11:02                2220
ev.watcher-callbacks.php                           30-Sep-2022 11:02                4120
ev.watchers.php                                    30-Sep-2022 11:02                3461
evcheck.construct.php                              30-Sep-2022 11:02                3642
evcheck.createstopped.php                          30-Sep-2022 11:02                3512
evchild.construct.php                              30-Sep-2022 11:02                6426
evchild.createstopped.php                          30-Sep-2022 11:02                4952
evchild.set.php                                    30-Sep-2022 11:02                3059
evembed.construct.php                              30-Sep-2022 11:02                8481
evembed.createstopped.php                          30-Sep-2022 11:02                4682
evembed.set.php                                    30-Sep-2022 11:02                2444
evembed.sweep.php                                  30-Sep-2022 11:02                3026
event.add.php                                      30-Sep-2022 11:02               11069
event.addsignal.php                                30-Sep-2022 11:02                1642
event.addtimer.php                                 30-Sep-2022 11:02                1651
event.callbacks.php                                30-Sep-2022 11:02                5405
event.configuration.php                            30-Sep-2022 11:02                1304
event.construct.php                                30-Sep-2022 11:02                4750
event.constructing.signal.events.php               30-Sep-2022 11:02                6856
event.del.php                                      30-Sep-2022 11:02                2455
event.delsignal.php                                30-Sep-2022 11:02                1642
event.deltimer.php                                 30-Sep-2022 11:02                1639
event.examples.php                                 30-Sep-2022 11:02              198933
event.flags.php                                    30-Sep-2022 11:02                2322
event.free.php                                     30-Sep-2022 11:02                2929
event.getsupportedmethods.php                      30-Sep-2022 11:02                2595
event.installation.php                             30-Sep-2022 11:02                1763
event.pending.php                                  30-Sep-2022 11:02                2661
event.persistence.php                              30-Sep-2022 11:02                2755
event.requirements.php                             30-Sep-2022 11:02                1507
event.resources.php                                30-Sep-2022 11:02                1204
event.set.php                                      30-Sep-2022 11:02                4496
event.setpriority.php                              30-Sep-2022 11:02                2364
event.settimer.php                                 30-Sep-2022 11:02                4014
event.setup.php                                    30-Sep-2022 11:02                1612
event.signal.php                                   30-Sep-2022 11:02                4240
event.timer.php                                    30-Sep-2022 11:02                3569
eventbase.construct.php                            30-Sep-2022 11:02                2799
eventbase.dispatch.php                             30-Sep-2022 11:02                3198
eventbase.exit.php                                 30-Sep-2022 11:02                2878
eventbase.free.php                                 30-Sep-2022 11:02                3284
eventbase.getfeatures.php                          30-Sep-2022 11:02                5987
eventbase.getmethod.php                            30-Sep-2022 11:02                4601
eventbase.gettimeofdaycached.php                   30-Sep-2022 11:02                2634
eventbase.gotexit.php                              30-Sep-2022 11:02                3212
eventbase.gotstop.php                              30-Sep-2022 11:02                3184
eventbase.loop.php                                 30-Sep-2022 11:02                3436
eventbase.priorityinit.php                         30-Sep-2022 11:02                2855
eventbase.reinit.php                               30-Sep-2022 11:02                2224
eventbase.stop.php                                 30-Sep-2022 11:02                2723
eventbuffer.add.php                                30-Sep-2022 11:02                2854
eventbuffer.addbuffer.php                          30-Sep-2022 11:02                3266
eventbuffer.appendfrom.php                         30-Sep-2022 11:02                4868
eventbuffer.construct.php                          30-Sep-2022 11:02                2139
eventbuffer.copyout.php                            30-Sep-2022 11:02                3814
eventbuffer.drain.php                              30-Sep-2022 11:02                3346
eventbuffer.enablelocking.php                      30-Sep-2022 11:02                2864
eventbuffer.expand.php                             30-Sep-2022 11:02                2637
eventbuffer.freeze.php                             30-Sep-2022 11:02                2903
eventbuffer.lock.php                               30-Sep-2022 11:02                3006
eventbuffer.prepend.php                            30-Sep-2022 11:02                3359
eventbuffer.prependbuffer.php                      30-Sep-2022 11:02                3581
eventbuffer.pullup.php                             30-Sep-2022 11:02                4568
eventbuffer.read.php                               30-Sep-2022 11:02                4835
eventbuffer.readfrom.php                           30-Sep-2022 11:02                4321
eventbuffer.readline.php                           30-Sep-2022 11:02                4145
eventbuffer.search.php                             30-Sep-2022 11:02                8703
eventbuffer.searcheol.php                          30-Sep-2022 11:02                4647
eventbuffer.substr.php                             30-Sep-2022 11:02                3307
eventbuffer.unfreeze.php                           30-Sep-2022 11:02                2917
eventbuffer.unlock.php                             30-Sep-2022 11:02                2683
eventbuffer.write.php                              30-Sep-2022 11:02                3374
eventbufferevent.about.callbacks.php               30-Sep-2022 11:02                5615
eventbufferevent.close.php                         30-Sep-2022 11:02                2452
eventbufferevent.connect.php                       30-Sep-2022 11:02               27010
eventbufferevent.connecthost.php                   30-Sep-2022 11:02               18486
eventbufferevent.construct.php                     30-Sep-2022 11:02                6894
eventbufferevent.createpair.php                    30-Sep-2022 11:02                4035
eventbufferevent.disable.php                       30-Sep-2022 11:02                3153
eventbufferevent.enable.php                        30-Sep-2022 11:02                3417
eventbufferevent.free.php                          30-Sep-2022 11:02                2759
eventbufferevent.getdnserrorstring.php             30-Sep-2022 11:02                3063
eventbufferevent.getenabled.php                    30-Sep-2022 11:02                3029
eventbufferevent.getinput.php                      30-Sep-2022 11:02                5199
eventbufferevent.getoutput.php                     30-Sep-2022 11:02                8355
eventbufferevent.read.php                          30-Sep-2022 11:02                2975
eventbufferevent.readbuffer.php                    30-Sep-2022 11:02                3103
eventbufferevent.setcallbacks.php                  30-Sep-2022 11:02                4612
eventbufferevent.setpriority.php                   30-Sep-2022 11:02                2745
eventbufferevent.settimeouts.php                   30-Sep-2022 11:02                2917
eventbufferevent.setwatermark.php                  30-Sep-2022 11:02                3825
eventbufferevent.sslerror.php                      30-Sep-2022 11:02                6339
eventbufferevent.sslfilter.php                     30-Sep-2022 11:02               41029
eventbufferevent.sslgetcipherinfo.php              30-Sep-2022 11:02                2824
eventbufferevent.sslgetciphername.php              30-Sep-2022 11:02                2710
eventbufferevent.sslgetcipherversion.php           30-Sep-2022 11:02                2739
eventbufferevent.sslgetprotocol.php                30-Sep-2022 11:02                2668
eventbufferevent.sslrenegotiate.php                30-Sep-2022 11:02                2793
eventbufferevent.sslsocket.php                     30-Sep-2022 11:02                5513
eventbufferevent.write.php                         30-Sep-2022 11:02                3039
eventbufferevent.writebuffer.php                   30-Sep-2022 11:02                3221
eventconfig.avoidmethod.php                        30-Sep-2022 11:02                4276
eventconfig.construct.php                          30-Sep-2022 11:02                4519
eventconfig.requirefeatures.php                    30-Sep-2022 11:02                6070
eventconfig.setflags.php                           30-Sep-2022 11:02                3158
eventconfig.setmaxdispatchinterval.php             30-Sep-2022 11:02                4269
eventdnsbase.addnameserverip.php                   30-Sep-2022 11:02                2771
eventdnsbase.addsearch.php                         30-Sep-2022 11:02                2474
eventdnsbase.clearsearch.php                       30-Sep-2022 11:02                2795
eventdnsbase.construct.php                         30-Sep-2022 11:02                3224
eventdnsbase.countnameservers.php                  30-Sep-2022 11:02                2477
eventdnsbase.loadhosts.php                         30-Sep-2022 11:02                2644
eventdnsbase.parseresolvconf.php                   30-Sep-2022 11:02                4062
eventdnsbase.setoption.php                         30-Sep-2022 11:02                3162
eventdnsbase.setsearchndots.php                    30-Sep-2022 11:02                2708
eventhttp.accept.php                               30-Sep-2022 11:02               13253
eventhttp.addserveralias.php                       30-Sep-2022 11:02                6473
eventhttp.bind.php                                 30-Sep-2022 11:02                7855
eventhttp.construct.php                            30-Sep-2022 11:02               19927
eventhttp.removeserveralias.php                    30-Sep-2022 11:02                3049
eventhttp.setallowedmethods.php                    30-Sep-2022 11:02                3315
eventhttp.setcallback.php                          30-Sep-2022 11:02               19761
eventhttp.setdefaultcallback.php                   30-Sep-2022 11:02                7839
eventhttp.setmaxbodysize.php                       30-Sep-2022 11:02                2845
eventhttp.setmaxheaderssize.php                    30-Sep-2022 11:02                2757
eventhttp.settimeout.php                           30-Sep-2022 11:02                2429
eventhttpconnection.construct.php                  30-Sep-2022 11:02                5211
eventhttpconnection.getbase.php                    30-Sep-2022 11:02                2558
eventhttpconnection.getpeer.php                    30-Sep-2022 11:02                2889
eventhttpconnection.makerequest.php                30-Sep-2022 11:02               12557
eventhttpconnection.setclosecallback.php           30-Sep-2022 11:02               11810
eventhttpconnection.setlocaladdress.php            30-Sep-2022 11:02                3142
eventhttpconnection.setlocalport.php               30-Sep-2022 11:02                3031
eventhttpconnection.setmaxbodysize.php             30-Sep-2022 11:02                3067
eventhttpconnection.setmaxheaderssize.php          30-Sep-2022 11:02                3088
eventhttpconnection.setretries.php                 30-Sep-2022 11:02                2659
eventhttpconnection.settimeout.php                 30-Sep-2022 11:02                2556
eventhttprequest.addheader.php                     30-Sep-2022 11:02                3661
eventhttprequest.cancel.php                        30-Sep-2022 11:02                2813
eventhttprequest.clearheaders.php                  30-Sep-2022 11:02                2780
eventhttprequest.closeconnection.php               30-Sep-2022 11:02                2368
eventhttprequest.construct.php                     30-Sep-2022 11:02               12716
eventhttprequest.findheader.php                    30-Sep-2022 11:02                3364
eventhttprequest.free.php                          30-Sep-2022 11:02                2276
eventhttprequest.getbufferevent.php                30-Sep-2022 11:02                3683
eventhttprequest.getcommand.php                    30-Sep-2022 11:02                2649
eventhttprequest.getconnection.php                 30-Sep-2022 11:02                4452
eventhttprequest.gethost.php                       30-Sep-2022 11:02                2821
eventhttprequest.getinputbuffer.php                30-Sep-2022 11:02                2768
eventhttprequest.getinputheaders.php               30-Sep-2022 11:02                2801
eventhttprequest.getoutputbuffer.php               30-Sep-2022 11:02                2827
eventhttprequest.getoutputheaders.php              30-Sep-2022 11:02                2785
eventhttprequest.getresponsecode.php               30-Sep-2022 11:02                3118
eventhttprequest.geturi.php                        30-Sep-2022 11:02                3029
eventhttprequest.removeheader.php                  30-Sep-2022 11:02                3375
eventhttprequest.senderror.php                     30-Sep-2022 11:02                5699
eventhttprequest.sendreply.php                     30-Sep-2022 11:02                3943
eventhttprequest.sendreplychunk.php                30-Sep-2022 11:02                3425
eventhttprequest.sendreplyend.php                  30-Sep-2022 11:02                3028
eventhttprequest.sendreplystart.php                30-Sep-2022 11:02                4198
eventlistener.construct.php                        30-Sep-2022 11:02               27655
eventlistener.disable.php                          30-Sep-2022 11:02                2659
eventlistener.enable.php                           30-Sep-2022 11:02                2645
eventlistener.getbase.php                          30-Sep-2022 11:02                2288
eventlistener.getsocketname.php                    30-Sep-2022 11:02                3184
eventlistener.setcallback.php                      30-Sep-2022 11:02                5716
eventlistener.seterrorcallback.php                 30-Sep-2022 11:02                4243
eventsslcontext.construct.php                      30-Sep-2022 11:02                5822
eventutil.construct.php                            30-Sep-2022 11:02                2329
eventutil.getlastsocketerrno.php                   30-Sep-2022 11:02                3237
eventutil.getlastsocketerror.php                   30-Sep-2022 11:02                3102
eventutil.getsocketfd.php                          30-Sep-2022 11:02                3139
eventutil.getsocketname.php                        30-Sep-2022 11:02                3632
eventutil.setsocketoption.php                      30-Sep-2022 11:02                5510
eventutil.sslrandpoll.php                          30-Sep-2022 11:02                2318
evfork.construct.php                               30-Sep-2022 11:02                3617
evfork.createstopped.php                           30-Sep-2022 11:02                3714
evidle.construct.php                               30-Sep-2022 11:02                3672
evidle.createstopped.php                           30-Sep-2022 11:02                4030
evio.construct.php                                 30-Sep-2022 11:02                4720
evio.createstopped.php                             30-Sep-2022 11:02                5096
evio.set.php                                       30-Sep-2022 11:02                2786
evloop.backend.php                                 30-Sep-2022 11:02                2654
evloop.check.php                                   30-Sep-2022 11:02                3116
evloop.child.php                                   30-Sep-2022 11:02                3478
evloop.construct.php                               30-Sep-2022 11:02                3912
evloop.defaultloop.php                             30-Sep-2022 11:02                4509
evloop.embed.php                                   30-Sep-2022 11:02                3581
evloop.fork.php                                    30-Sep-2022 11:02                3310
evloop.idle.php                                    30-Sep-2022 11:02                3330
evloop.invokepending.php                           30-Sep-2022 11:02                2183
evloop.io.php                                      30-Sep-2022 11:02                3749
evloop.loopfork.php                                30-Sep-2022 11:02                2483
evloop.now.php                                     30-Sep-2022 11:02                2768
evloop.nowupdate.php                               30-Sep-2022 11:02                3132
evloop.periodic.php                                30-Sep-2022 11:02                3788
evloop.prepare.php                                 30-Sep-2022 11:02                3328
evloop.resume.php                                  30-Sep-2022 11:02                2792
evloop.run.php                                     30-Sep-2022 11:02                4738
evloop.signal.php                                  30-Sep-2022 11:02                3575
evloop.stat.php                                    30-Sep-2022 11:02                3696
evloop.stop.php                                    30-Sep-2022 11:02                2921
evloop.suspend.php                                 30-Sep-2022 11:02                2784
evloop.timer.php                                   30-Sep-2022 11:02                3715
evloop.verify.php                                  30-Sep-2022 11:02                2559
evperiodic.again.php                               30-Sep-2022 11:02                2532
evperiodic.at.php                                  30-Sep-2022 11:02                2556
evperiodic.construct.php                           30-Sep-2022 11:02               10167
evperiodic.createstopped.php                       30-Sep-2022 11:02                5652
evperiodic.set.php                                 30-Sep-2022 11:02                3044
evprepare.construct.php                            30-Sep-2022 11:02                3397
evprepare.createstopped.php                        30-Sep-2022 11:02                4262
evsignal.construct.php                             30-Sep-2022 11:02                5489
evsignal.createstopped.php                         30-Sep-2022 11:02                4750
evsignal.set.php                                   30-Sep-2022 11:02                2398
evstat.attr.php                                    30-Sep-2022 11:02                8667
evstat.construct.php                               30-Sep-2022 11:02                7411
evstat.createstopped.php                           30-Sep-2022 11:02                5046
evstat.prev.php                                    30-Sep-2022 11:02                2914
evstat.set.php                                     30-Sep-2022 11:02                2719
evstat.stat.php                                    30-Sep-2022 11:02                2834
evtimer.again.php                                  30-Sep-2022 11:02                3027
evtimer.construct.php                              30-Sep-2022 11:02               13505
evtimer.createstopped.php                          30-Sep-2022 11:02                8506
evtimer.set.php                                    30-Sep-2022 11:02                2861
evwatcher.clear.php                                30-Sep-2022 11:02                2745
evwatcher.construct.php                            30-Sep-2022 11:02                2081
evwatcher.feed.php                                 30-Sep-2022 11:02                2511
evwatcher.getloop.php                              30-Sep-2022 11:02                2287
evwatcher.invoke.php                               30-Sep-2022 11:02                2518
evwatcher.keepalive.php                            30-Sep-2022 11:02                5121
evwatcher.setcallback.php                          30-Sep-2022 11:02                2531
evwatcher.start.php                                30-Sep-2022 11:02                2474
evwatcher.stop.php                                 30-Sep-2022 11:02                2443
example.xml-external-entity.php                    30-Sep-2022 11:02               26039
example.xml-map-tags.php                           30-Sep-2022 11:02                9139
example.xml-structure.php                          30-Sep-2022 11:02                7166
example.xmlwriter-namespace.php                    30-Sep-2022 11:02                5456
example.xmlwriter-oop.php                          30-Sep-2022 11:02                3384
example.xmlwriter-simple.php                       30-Sep-2022 11:02                8906
exception.clone.php                                30-Sep-2022 11:01                2343
exception.construct.php                            30-Sep-2022 11:01                4013
exception.getcode.php                              30-Sep-2022 11:01                4630
exception.getfile.php                              30-Sep-2022 11:01                3848
exception.getline.php                              30-Sep-2022 11:01                4125
exception.getmessage.php                           30-Sep-2022 11:01                3931
exception.getprevious.php                          30-Sep-2022 11:01                6984
exception.gettrace.php                             30-Sep-2022 11:01                4318
exception.gettraceasstring.php                     30-Sep-2022 11:01                4214
exception.tostring.php                             30-Sep-2022 11:01                3969
exec.configuration.php                             30-Sep-2022 11:02                1300
exec.constants.php                                 30-Sep-2022 11:02                1208
exec.installation.php                              30-Sep-2022 11:02                1272
exec.requirements.php                              30-Sep-2022 11:02                1240
exec.resources.php                                 30-Sep-2022 11:02                1372
exec.setup.php                                     30-Sep-2022 11:02                1652
exif.configuration.php                             30-Sep-2022 11:02                6819
exif.constants.php                                 30-Sep-2022 11:02                1696
exif.installation.php                              30-Sep-2022 11:02                1718
exif.requirements.php                              30-Sep-2022 11:02                1439
exif.resources.php                                 30-Sep-2022 11:02                1224
exif.setup.php                                     30-Sep-2022 11:02                1633
expect.configuration.php                           30-Sep-2022 11:02                5144
expect.constants.php                               30-Sep-2022 11:02                3247
expect.examples-usage.php                          30-Sep-2022 11:02               17182
expect.examples.php                                30-Sep-2022 11:02                1357
expect.installation.php                            30-Sep-2022 11:02                2378
expect.requirements.php                            30-Sep-2022 11:02                1360
expect.resources.php                               30-Sep-2022 11:02                1445
expect.setup.php                                   30-Sep-2022 11:02                1656
ext-weakmap.construct.php                          30-Sep-2022 11:01                1848
extensions.alphabetical.php                        30-Sep-2022 11:02               20785
extensions.membership.php                          30-Sep-2022 11:02               20435
extensions.php                                     30-Sep-2022 11:02                1693
extensions.state.php                               30-Sep-2022 11:02                2620
fann.configuration.php                             30-Sep-2022 11:02                1297
fann.constants.php                                 30-Sep-2022 11:02               17661
fann.examples-1.php                                30-Sep-2022 11:02                9064
fann.examples.php                                  30-Sep-2022 11:02                1311
fann.installation.php                              30-Sep-2022 11:02                5081
fann.requirements.php                              30-Sep-2022 11:02                1215
fann.resources.php                                 30-Sep-2022 11:02                1182
fann.setup.php                                     30-Sep-2022 11:02                1603
fannconnection.construct.php                       30-Sep-2022 11:02                2814
fannconnection.getfromneuron.php                   30-Sep-2022 11:02                2282
fannconnection.gettoneuron.php                     30-Sep-2022 11:02                2270
fannconnection.getweight.php                       30-Sep-2022 11:02                2238
fannconnection.setweight.php                       30-Sep-2022 11:02                2831
faq.build.php                                      30-Sep-2022 11:02               24186
faq.com.php                                        30-Sep-2022 11:02               11911
faq.databases.php                                  30-Sep-2022 11:02                7887
faq.general.php                                    30-Sep-2022 11:02                4828
faq.html.php                                       30-Sep-2022 11:02               20789
faq.installation.php                               30-Sep-2022 11:02               26075
faq.mailinglist.php                                30-Sep-2022 11:02               11193
faq.misc.php                                       30-Sep-2022 11:02                4551
faq.obtaining.php                                  30-Sep-2022 11:02               10807
faq.passwords.php                                  30-Sep-2022 11:02                9842
faq.php                                            30-Sep-2022 11:02                2067
faq.using.php                                      30-Sep-2022 11:02               23619
fdf.configuration.php                              30-Sep-2022 11:02                1290
fdf.constants.php                                  30-Sep-2022 11:02                6361
fdf.examples.php                                   30-Sep-2022 11:02                6617
fdf.installation.php                               30-Sep-2022 11:02                3412
fdf.requirements.php                               30-Sep-2022 11:02                1552
fdf.resources.php                                  30-Sep-2022 11:02                1742
fdf.setup.php                                      30-Sep-2022 11:02                1611
features.commandline.differences.php               30-Sep-2022 11:01               12307
features.commandline.ini.php                       30-Sep-2022 11:01                2194
features.commandline.interactive.php               30-Sep-2022 11:01                9017
features.commandline.introduction.php              30-Sep-2022 11:01                6639
features.commandline.io-streams.php                30-Sep-2022 11:01                5953
features.commandline.options.php                   30-Sep-2022 11:01               26373
features.commandline.php                           30-Sep-2022 11:01                2101
features.commandline.usage.php                     30-Sep-2022 11:01               14543
features.commandline.webserver.php                 30-Sep-2022 11:01               13361
features.connection-handling.php                   30-Sep-2022 11:01                5581
features.cookies.php                               30-Sep-2022 11:01                3007
features.dtrace.dtrace.php                         30-Sep-2022 11:02               13926
features.dtrace.introduction.php                   30-Sep-2022 11:02                3316
features.dtrace.php                                30-Sep-2022 11:02                1609
features.dtrace.systemtap.php                      30-Sep-2022 11:02                8032
features.file-upload.common-pitfalls.php           30-Sep-2022 11:01                5778
features.file-upload.errors.php                    30-Sep-2022 11:01                3789
features.file-upload.errors.seealso.php            30-Sep-2022 11:01                1357
features.file-upload.multiple.php                  30-Sep-2022 11:01                6657
features.file-upload.php                           30-Sep-2022 11:01                1922
features.file-upload.post-method.php               30-Sep-2022 11:01               16832
features.file-upload.put-method.php                30-Sep-2022 11:01                6015
features.gc.collecting-cycles.php                  30-Sep-2022 11:02                7921
features.gc.performance-considerations.php         30-Sep-2022 11:02               14103
features.gc.php                                    30-Sep-2022 11:02                1723
features.gc.refcounting-basics.php                 30-Sep-2022 11:01               21298
features.http-auth.php                             30-Sep-2022 11:01               25175
features.persistent-connections.php                30-Sep-2022 11:01                8912
features.php                                       30-Sep-2022 11:02                4209
features.remote-files.php                          30-Sep-2022 11:01                8587
features.session.security.management.php           30-Sep-2022 11:02               25257
features.sessions.php                              30-Sep-2022 11:01                1388
features.xforms.php                                30-Sep-2022 11:01                5419
ffi-ctype.getalignment.php                         30-Sep-2022 11:02                2260
ffi-ctype.getarrayelementtype.php                  30-Sep-2022 11:02                2404
ffi-ctype.getarraylength.php                       30-Sep-2022 11:02                2303
ffi-ctype.getattributes.php                        30-Sep-2022 11:02                2279
ffi-ctype.getenumkind.php                          30-Sep-2022 11:02                2255
ffi-ctype.getfuncabi.php                           30-Sep-2022 11:02                2263
ffi-ctype.getfuncparametercount.php                30-Sep-2022 11:02                2369
ffi-ctype.getfuncparametertype.php                 30-Sep-2022 11:02                2613
ffi-ctype.getfuncreturntype.php                    30-Sep-2022 11:02                2386
ffi-ctype.getkind.php                              30-Sep-2022 11:02                2217
ffi-ctype.getname.php                              30-Sep-2022 11:02                2221
ffi-ctype.getpointertype.php                       30-Sep-2022 11:02                2330
ffi-ctype.getsize.php                              30-Sep-2022 11:02                2235
ffi-ctype.getstructfieldnames.php                  30-Sep-2022 11:02                2345
ffi-ctype.getstructfieldoffset.php                 30-Sep-2022 11:02                2549
ffi-ctype.getstructfieldtype.php                   30-Sep-2022 11:02                2569
ffi.addr.php                                       30-Sep-2022 11:02                2754
ffi.alignof.php                                    30-Sep-2022 11:02                2826
ffi.arraytype.php                                  30-Sep-2022 11:02                4445
ffi.cast.php                                       30-Sep-2022 11:02                4891
ffi.cdef.php                                       30-Sep-2022 11:02                4124
ffi.configuration.php                              30-Sep-2022 11:02                4146
ffi.constants.php                                  30-Sep-2022 11:02                1118
ffi.examples-basic.php                             30-Sep-2022 11:02               17165
ffi.examples-callback.php                          30-Sep-2022 11:02                5045
ffi.examples-complete.php                          30-Sep-2022 11:02                5824
ffi.examples.php                                   30-Sep-2022 11:02                1468
ffi.free.php                                       30-Sep-2022 11:02                2370
ffi.installation.php                               30-Sep-2022 11:02                1462
ffi.isnull.php                                     30-Sep-2022 11:02                2355
ffi.load.php                                       30-Sep-2022 11:02                4149
ffi.memcmp.php                                     30-Sep-2022 11:02                3745
ffi.memcpy.php                                     30-Sep-2022 11:02                3112
ffi.memset.php                                     30-Sep-2022 11:02                2954
ffi.new.php                                        30-Sep-2022 11:02                5276
ffi.requirements.php                               30-Sep-2022 11:02                1311
ffi.resources.php                                  30-Sep-2022 11:02                1214
ffi.scope.php                                      30-Sep-2022 11:02                3061
ffi.setup.php                                      30-Sep-2022 11:02                1601
ffi.sizeof.php                                     30-Sep-2022 11:02                2667
ffi.string.php                                     30-Sep-2022 11:02                3637
ffi.type.php                                       30-Sep-2022 11:02                3519
ffi.typeof.php                                     30-Sep-2022 11:02                2818
fiber.construct.php                                30-Sep-2022 11:01                2322
fiber.getcurrent.php                               30-Sep-2022 11:01                2368
fiber.getreturn.php                                30-Sep-2022 11:01                2589
fiber.isrunning.php                                30-Sep-2022 11:01                2534
fiber.isstarted.php                                30-Sep-2022 11:01                2148
fiber.issuspended.php                              30-Sep-2022 11:01                2163
fiber.isterminated.php                             30-Sep-2022 11:01                2220
fiber.resume.php                                   30-Sep-2022 11:01                3284
fiber.start.php                                    30-Sep-2022 11:01                3012
fiber.suspend.php                                  30-Sep-2022 11:01                4051
fiber.throw.php                                    30-Sep-2022 11:01                3154
fibererror.construct.php                           30-Sep-2022 11:01                2138
fileinfo.configuration.php                         30-Sep-2022 11:02                1325
fileinfo.constants.php                             30-Sep-2022 11:02                4757
fileinfo.installation.php                          30-Sep-2022 11:02                1732
fileinfo.requirements.php                          30-Sep-2022 11:02                1265
fileinfo.resources.php                             30-Sep-2022 11:02                1429
fileinfo.setup.php                                 30-Sep-2022 11:02                1676
filesystem.configuration.php                       30-Sep-2022 11:02                6944
filesystem.constants.php                           30-Sep-2022 11:02                4521
filesystem.installation.php                        30-Sep-2022 11:02                1314
filesystem.requirements.php                        30-Sep-2022 11:02                1282
filesystem.resources.php                           30-Sep-2022 11:02                1429
filesystem.setup.php                               30-Sep-2022 11:02                1705
filesystemiterator.construct.php                   30-Sep-2022 11:02                6963
filesystemiterator.current.php                     30-Sep-2022 11:02                5382
filesystemiterator.getflags.php                    30-Sep-2022 11:02                3138
filesystemiterator.key.php                         30-Sep-2022 11:02                5263
filesystemiterator.next.php                        30-Sep-2022 11:02                4521
filesystemiterator.rewind.php                      30-Sep-2022 11:02                5153
filesystemiterator.setflags.php                    30-Sep-2022 11:02                6693
filter.configuration.php                           30-Sep-2022 11:02                4949
filter.constants.php                               30-Sep-2022 11:02               13458
filter.examples.php                                30-Sep-2022 11:02                1418
filter.examples.sanitization.php                   30-Sep-2022 11:02                6070
filter.examples.validation.php                     30-Sep-2022 11:02               11102
filter.filters.flags.php                           30-Sep-2022 11:02               11624
filter.filters.misc.php                            30-Sep-2022 11:02                1874
filter.filters.php                                 30-Sep-2022 11:02                1614
filter.filters.sanitize.php                        30-Sep-2022 11:02                9880
filter.filters.validate.php                        30-Sep-2022 11:02                9791
filter.installation.php                            30-Sep-2022 11:02                1327
filter.requirements.php                            30-Sep-2022 11:02                1254
filter.resources.php                               30-Sep-2022 11:02                1221
filter.setup.php                                   30-Sep-2022 11:02                1643
filteriterator.accept.php                          30-Sep-2022 11:02                5458
filteriterator.construct.php                       30-Sep-2022 11:02                3041
filteriterator.current.php                         30-Sep-2022 11:02                3016
filteriterator.getinneriterator.php                30-Sep-2022 11:02                2454
filteriterator.key.php                             30-Sep-2022 11:02                2944
filteriterator.next.php                            30-Sep-2022 11:02                2774
filteriterator.rewind.php                          30-Sep-2022 11:02                3073
filteriterator.valid.php                           30-Sep-2022 11:02                2410
filters.compression.php                            30-Sep-2022 11:02               16612
filters.convert.php                                30-Sep-2022 11:02               12171
filters.encryption.php                             30-Sep-2022 11:02               46287
filters.php                                        30-Sep-2022 11:02                3427
filters.string.php                                 30-Sep-2022 11:02               10773
finfo.buffer.php                                   30-Sep-2022 11:02                2447
finfo.construct.php                                30-Sep-2022 11:02                2767
finfo.file.php                                     30-Sep-2022 11:02                2438
finfo.set-flags.php                                30-Sep-2022 11:02                1943
fpm.observability.php                              30-Sep-2022 11:02                1368
fpm.setup.php                                      30-Sep-2022 11:02                1290
fpm.status.php                                     30-Sep-2022 11:02                9938
ftp.configuration.php                              30-Sep-2022 11:02                1293
ftp.constants.php                                  30-Sep-2022 11:02                3507
ftp.examples-basic.php                             30-Sep-2022 11:02                5497
ftp.examples.php                                   30-Sep-2022 11:02                1288
ftp.installation.php                               30-Sep-2022 11:02                1581
ftp.requirements.php                               30-Sep-2022 11:02                1233
ftp.resources.php                                  30-Sep-2022 11:02                1494
ftp.setup.php                                      30-Sep-2022 11:02                1614
funchand.configuration.php                         30-Sep-2022 11:02                1328
funchand.constants.php                             30-Sep-2022 11:02                1268
funchand.installation.php                          30-Sep-2022 11:02                1300
funchand.requirements.php                          30-Sep-2022 11:02                1268
funchand.resources.php                             30-Sep-2022 11:02                1252
funchand.setup.php                                 30-Sep-2022 11:02                1714
funcref.php                                        30-Sep-2022 11:02               14629
function.abs.php                                   30-Sep-2022 11:02                4710
function.acos.php                                  30-Sep-2022 11:02                3506
function.acosh.php                                 30-Sep-2022 11:02                3353
function.addcslashes.php                           30-Sep-2022 11:02                8314
function.addslashes.php                            30-Sep-2022 11:02                7323
function.apache-child-terminate.php                30-Sep-2022 11:02                4141
function.apache-get-modules.php                    30-Sep-2022 11:02                3753
function.apache-get-version.php                    30-Sep-2022 11:02                3520
function.apache-getenv.php                         30-Sep-2022 11:02                4961
function.apache-lookup-uri.php                     30-Sep-2022 11:02                5782
function.apache-note.php                           30-Sep-2022 11:02                6299
function.apache-request-headers.php                30-Sep-2022 11:02                5642
function.apache-response-headers.php               30-Sep-2022 11:02                4152
function.apache-setenv.php                         30-Sep-2022 11:02                5408
function.apcu-add.php                              30-Sep-2022 11:02                8239
function.apcu-cache-info.php                       30-Sep-2022 11:02                6426
function.apcu-cas.php                              30-Sep-2022 11:02                8863
function.apcu-clear-cache.php                      30-Sep-2022 11:02                2491
function.apcu-dec.php                              30-Sep-2022 11:02                7997
function.apcu-delete.php                           30-Sep-2022 11:02                5941
function.apcu-enabled.php                          30-Sep-2022 11:02                2213
function.apcu-entry.php                            30-Sep-2022 11:02                8788
function.apcu-exists.php                           30-Sep-2022 11:02                7019
function.apcu-fetch.php                            30-Sep-2022 11:02                5671
function.apcu-inc.php                              30-Sep-2022 11:02                7981
function.apcu-key-info.php                         30-Sep-2022 11:02                4755
function.apcu-sma-info.php                         30-Sep-2022 11:02                4296
function.apcu-store.php                            30-Sep-2022 11:02                7015
function.array-change-key-case.php                 30-Sep-2022 11:02                5477
function.array-chunk.php                           30-Sep-2022 11:02                6465
function.array-column.php                          30-Sep-2022 11:02               18066
function.array-combine.php                         30-Sep-2022 11:02                6153
function.array-count-values.php                    30-Sep-2022 11:02                5485
function.array-diff-assoc.php                      30-Sep-2022 11:02               10716
function.array-diff-key.php                        30-Sep-2022 11:02               12886
function.array-diff-uassoc.php                     30-Sep-2022 11:02               12185
function.array-diff-ukey.php                       30-Sep-2022 11:02               12487
function.array-diff.php                            30-Sep-2022 11:02               12281
function.array-fill-keys.php                       30-Sep-2022 11:02                5276
function.array-fill.php                            30-Sep-2022 11:02                6898
function.array-filter.php                          30-Sep-2022 11:02               16973
function.array-flip.php                            30-Sep-2022 11:02                7120
function.array-intersect-assoc.php                 30-Sep-2022 11:02                8566
function.array-intersect-key.php                   30-Sep-2022 11:02               10111
function.array-intersect-uassoc.php                30-Sep-2022 11:02                8814
function.array-intersect-ukey.php                  30-Sep-2022 11:02               12264
function.array-intersect.php                       30-Sep-2022 11:02                6460
function.array-is-list.php                         30-Sep-2022 11:02                7026
function.array-key-exists.php                      30-Sep-2022 11:02                8653
function.array-key-first.php                       30-Sep-2022 11:02                7197
function.array-key-last.php                        30-Sep-2022 11:02                3120
function.array-keys.php                            30-Sep-2022 11:02                8444
function.array-map.php                             30-Sep-2022 11:02               28334
function.array-merge-recursive.php                 30-Sep-2022 11:02                6938
function.array-merge.php                           30-Sep-2022 11:02               12350
function.array-multisort.php                       30-Sep-2022 11:02               23610
function.array-pad.php                             30-Sep-2022 11:02                7130
function.array-pop.php                             30-Sep-2022 11:02                5912
function.array-product.php                         30-Sep-2022 11:02                4284
function.array-push.php                            30-Sep-2022 11:02                7146
function.array-rand.php                            30-Sep-2022 11:02                6670
function.array-reduce.php                          30-Sep-2022 11:02               10349
function.array-replace-recursive.php               30-Sep-2022 11:02               11284
function.array-replace.php                         30-Sep-2022 11:02                6747
function.array-reverse.php                         30-Sep-2022 11:02                5971
function.array-search.php                          30-Sep-2022 11:02                9004
function.array-shift.php                           30-Sep-2022 11:02                5683
function.array-slice.php                           30-Sep-2022 11:02               13828
function.array-splice.php                          30-Sep-2022 11:02               18036
function.array-sum.php                             30-Sep-2022 11:02                4962
function.array-udiff-assoc.php                     30-Sep-2022 11:02               15003
function.array-udiff-uassoc.php                    30-Sep-2022 11:02               16630
function.array-udiff.php                           30-Sep-2022 11:02               29973
function.array-uintersect-assoc.php                30-Sep-2022 11:02                8324
function.array-uintersect-uassoc.php               30-Sep-2022 11:02                8671
function.array-uintersect.php                      30-Sep-2022 11:02                7852
function.array-unique.php                          30-Sep-2022 11:02                9383
function.array-unshift.php                         30-Sep-2022 11:02                6187
function.array-values.php                          30-Sep-2022 11:02                4507
function.array-walk-recursive.php                  30-Sep-2022 11:02                7509
function.array-walk.php                            30-Sep-2022 11:02               14033
function.array.php                                 30-Sep-2022 11:02               12109
function.arsort.php                                30-Sep-2022 11:02                6434
function.asin.php                                  30-Sep-2022 11:02                3498
function.asinh.php                                 30-Sep-2022 11:02                3439
function.asort.php                                 30-Sep-2022 11:02                6401
function.assert-options.php                        30-Sep-2022 11:02                4512
function.assert.php                                30-Sep-2022 11:02               25000
function.atan.php                                  30-Sep-2022 11:02                3518
function.atan2.php                                 30-Sep-2022 11:02                3351
function.atanh.php                                 30-Sep-2022 11:02                3389
function.autoload.php                              30-Sep-2022 11:02                3158
function.base-convert.php                          30-Sep-2022 11:02                5778
function.base64-decode.php                         30-Sep-2022 11:02                4897
function.base64-encode.php                         30-Sep-2022 11:02                4710
function.basename.php                              30-Sep-2022 11:02                7395
function.bcadd.php                                 30-Sep-2022 11:02                5187
function.bccomp.php                                30-Sep-2022 11:02                5061
function.bcdiv.php                                 30-Sep-2022 11:02                4650
function.bcmod.php                                 30-Sep-2022 11:02                4259
function.bcmul.php                                 30-Sep-2022 11:02                4872
function.bcpow.php                                 30-Sep-2022 11:02                6240
function.bcpowmod.php                              30-Sep-2022 11:02                6435
function.bcscale.php                               30-Sep-2022 11:02                4078
function.bcsqrt.php                                30-Sep-2022 11:02                4233
function.bcsub.php                                 30-Sep-2022 11:02                5177
function.bin2hex.php                               30-Sep-2022 11:02                2986
function.bind-textdomain-codeset.php               30-Sep-2022 11:02                3098
function.bindec.php                                30-Sep-2022 11:02                5676
function.bindtextdomain.php                        30-Sep-2022 11:02                3929
function.boolval.php                               30-Sep-2022 11:02               10898
function.bzclose.php                               30-Sep-2022 11:02                2916
function.bzcompress.php                            30-Sep-2022 11:02                4250
function.bzdecompress.php                          30-Sep-2022 11:02                4572
function.bzerrno.php                               30-Sep-2022 11:02                2157
function.bzerror.php                               30-Sep-2022 11:02                4344
function.bzerrstr.php                              30-Sep-2022 11:02                3088
function.bzflush.php                               30-Sep-2022 11:02                3180
function.bzopen.php                                30-Sep-2022 11:02                4573
function.bzread.php                                30-Sep-2022 11:02                4165
function.bzwrite.php                               30-Sep-2022 11:02                4204
function.cal-days-in-month.php                     30-Sep-2022 11:02                4522
function.cal-from-jd.php                           30-Sep-2022 11:02                4505
function.cal-info.php                              30-Sep-2022 11:02                6396
function.cal-to-jd.php                             30-Sep-2022 11:02                5696
function.call-user-func-array.php                  30-Sep-2022 11:02               14265
function.call-user-func.php                        30-Sep-2022 11:02               11438
function.ceil.php                                  30-Sep-2022 11:02                4433
function.chdir.php                                 30-Sep-2022 11:02                4691
function.checkdate.php                             30-Sep-2022 11:02                5274
function.checkdnsrr.php                            30-Sep-2022 11:02                5574
function.chgrp.php                                 30-Sep-2022 11:02                4265
function.chmod.php                                 30-Sep-2022 11:02                8740
function.chop.php                                  30-Sep-2022 11:02                2047
function.chown.php                                 30-Sep-2022 11:02                3970
function.chr.php                                   30-Sep-2022 11:02                4652
function.chroot.php                                30-Sep-2022 11:02                2901
function.chunk-split.php                           30-Sep-2022 11:02                5192
function.class-alias.php                           30-Sep-2022 11:02                7317
function.class-exists.php                          30-Sep-2022 11:02                7180
function.class-implements.php                      30-Sep-2022 11:02                7204
function.class-parents.php                         30-Sep-2022 11:02                6888
function.class-uses.php                            30-Sep-2022 11:02                6034
function.clearstatcache.php                        30-Sep-2022 11:02                5786
function.cli-get-process-title.php                 30-Sep-2022 11:02                4311
function.cli-set-process-title.php                 30-Sep-2022 11:02                5681
function.closedir.php                              30-Sep-2022 11:02                4385
function.closelog.php                              30-Sep-2022 11:02                2843
function.com-create-guid.php                       30-Sep-2022 11:02                2736
function.com-event-sink.php                        30-Sep-2022 11:02               10454
function.com-get-active-object.php                 30-Sep-2022 11:02                5405
function.com-load-typelib.php                      30-Sep-2022 11:02                4880
function.com-message-pump.php                      30-Sep-2022 11:02                3787
function.com-print-typeinfo.php                    30-Sep-2022 11:02                4656
function.commonmark-parse.php                      30-Sep-2022 11:02                3543
function.commonmark-render-html.php                30-Sep-2022 11:02                3954
function.commonmark-render-latex.php               30-Sep-2022 11:02                4230
function.commonmark-render-man.php                 30-Sep-2022 11:02                4212
function.commonmark-render-xml.php                 30-Sep-2022 11:02                3911
function.commonmark-render.php                     30-Sep-2022 11:02                4158
function.compact.php                               30-Sep-2022 11:02                7663
function.connection-aborted.php                    30-Sep-2022 11:02                2876
function.connection-status.php                     30-Sep-2022 11:02                3138
function.constant.php                              30-Sep-2022 11:02                6362
function.convert-cyr-string.php                    30-Sep-2022 11:02                3975
function.convert-uudecode.php                      30-Sep-2022 11:02                3807
function.convert-uuencode.php                      30-Sep-2022 11:02                4161
function.copy.php                                  30-Sep-2022 11:02                6486
function.cos.php                                   30-Sep-2022 11:02                3975
function.cosh.php                                  30-Sep-2022 11:02                3111
function.count-chars.php                           30-Sep-2022 11:02                6999
function.count.php                                 30-Sep-2022 11:02               10834
function.crc32.php                                 30-Sep-2022 11:02                4696
function.create-function.php                       30-Sep-2022 11:02               18597
function.crypt.php                                 30-Sep-2022 11:02               12922
function.ctype-alnum.php                           30-Sep-2022 11:02                5673
function.ctype-alpha.php                           30-Sep-2022 11:02                5889
function.ctype-cntrl.php                           30-Sep-2022 11:02                5532
function.ctype-digit.php                           30-Sep-2022 11:02                5425
function.ctype-graph.php                           30-Sep-2022 11:02                6287
function.ctype-lower.php                           30-Sep-2022 11:02                5664
function.ctype-print.php                           30-Sep-2022 11:02                6350
function.ctype-punct.php                           30-Sep-2022 11:02                5572
function.ctype-space.php                           30-Sep-2022 11:02                6314
function.ctype-upper.php                           30-Sep-2022 11:02                5663
function.ctype-xdigit.php                          30-Sep-2022 11:02                5415
function.cubrid-affected-rows.php                  30-Sep-2022 11:02                9306
function.cubrid-bind.php                           30-Sep-2022 11:02               21464
function.cubrid-client-encoding.php                30-Sep-2022 11:02                5152
function.cubrid-close-prepare.php                  30-Sep-2022 11:02                6690
function.cubrid-close-request.php                  30-Sep-2022 11:02                6701
function.cubrid-close.php                          30-Sep-2022 11:02                6509
function.cubrid-col-get.php                        30-Sep-2022 11:02                8481
function.cubrid-col-size.php                       30-Sep-2022 11:02                8578
function.cubrid-column-names.php                   30-Sep-2022 11:02                8636
function.cubrid-column-types.php                   30-Sep-2022 11:02                8616
function.cubrid-commit.php                         30-Sep-2022 11:02               16182
function.cubrid-connect-with-url.php               30-Sep-2022 11:02               15534
function.cubrid-connect.php                        30-Sep-2022 11:02               12126
function.cubrid-current-oid.php                    30-Sep-2022 11:02                5877
function.cubrid-data-seek.php                      30-Sep-2022 11:02                7237
function.cubrid-db-name.php                        30-Sep-2022 11:02                6389
function.cubrid-disconnect.php                     30-Sep-2022 11:02                7468
function.cubrid-drop.php                           30-Sep-2022 11:02               11549
function.cubrid-errno.php                          30-Sep-2022 11:02                6935
function.cubrid-error-code-facility.php            30-Sep-2022 11:02                5963
function.cubrid-error-code.php                     30-Sep-2022 11:02                5898
function.cubrid-error-msg.php                      30-Sep-2022 11:02                5296
function.cubrid-error.php                          30-Sep-2022 11:02                6493
function.cubrid-execute.php                        30-Sep-2022 11:02               14277
function.cubrid-fetch-array.php                    30-Sep-2022 11:02                9929
function.cubrid-fetch-assoc.php                    30-Sep-2022 11:02                9139
function.cubrid-fetch-field.php                    30-Sep-2022 11:02               14182
function.cubrid-fetch-lengths.php                  30-Sep-2022 11:02                6010
function.cubrid-fetch-object.php                   30-Sep-2022 11:02               12258
function.cubrid-fetch-row.php                      30-Sep-2022 11:02                9023
function.cubrid-fetch.php                          30-Sep-2022 11:02               10212
function.cubrid-field-flags.php                    30-Sep-2022 11:02                7677
function.cubrid-field-len.php                      30-Sep-2022 11:02                8258
function.cubrid-field-name.php                     30-Sep-2022 11:02                7092
function.cubrid-field-seek.php                     30-Sep-2022 11:02               10832
function.cubrid-field-table.php                    30-Sep-2022 11:02                7315
function.cubrid-field-type.php                     30-Sep-2022 11:02                7377
function.cubrid-free-result.php                    30-Sep-2022 11:02                5665
function.cubrid-get-autocommit.php                 30-Sep-2022 11:02                3550
function.cubrid-get-charset.php                    30-Sep-2022 11:02                4879
function.cubrid-get-class-name.php                 30-Sep-2022 11:02                6178
function.cubrid-get-client-info.php                30-Sep-2022 11:02                8247
function.cubrid-get-db-parameter.php               30-Sep-2022 11:02               14370
function.cubrid-get-query-timeout.php              30-Sep-2022 11:02                6612
function.cubrid-get-server-info.php                30-Sep-2022 11:02                8479
function.cubrid-get.php                            30-Sep-2022 11:02               10031
function.cubrid-insert-id.php                      30-Sep-2022 11:02                7093
function.cubrid-is-instance.php                    30-Sep-2022 11:02                7348
function.cubrid-list-dbs.php                       30-Sep-2022 11:02                4360
function.cubrid-load-from-glo.php                  30-Sep-2022 11:02                6808
function.cubrid-lob-close.php                      30-Sep-2022 11:02                7258
function.cubrid-lob-export.php                     30-Sep-2022 11:02                7715
function.cubrid-lob-get.php                        30-Sep-2022 11:02                7624
function.cubrid-lob-send.php                       30-Sep-2022 11:02                6921
function.cubrid-lob-size.php                       30-Sep-2022 11:02                5760
function.cubrid-lob2-bind.php                      30-Sep-2022 11:02                9666
function.cubrid-lob2-close.php                     30-Sep-2022 11:02                3189
function.cubrid-lob2-export.php                    30-Sep-2022 11:02                8683
function.cubrid-lob2-import.php                    30-Sep-2022 11:02                8547
function.cubrid-lob2-new.php                       30-Sep-2022 11:02                3697
function.cubrid-lob2-read.php                      30-Sep-2022 11:02               14416
function.cubrid-lob2-seek.php                      30-Sep-2022 11:02               11237
function.cubrid-lob2-seek64.php                    30-Sep-2022 11:02               12775
function.cubrid-lob2-size.php                      30-Sep-2022 11:02                4230
function.cubrid-lob2-size64.php                    30-Sep-2022 11:02                4408
function.cubrid-lob2-tell.php                      30-Sep-2022 11:02                4249
function.cubrid-lob2-tell64.php                    30-Sep-2022 11:02                4445
function.cubrid-lob2-write.php                     30-Sep-2022 11:02               14334
function.cubrid-lock-read.php                      30-Sep-2022 11:02                9135
function.cubrid-lock-write.php                     30-Sep-2022 11:02                9553
function.cubrid-move-cursor.php                    30-Sep-2022 11:02                9280
function.cubrid-new-glo.php                        30-Sep-2022 11:02                6963
function.cubrid-next-result.php                    30-Sep-2022 11:02               17215
function.cubrid-num-cols.php                       30-Sep-2022 11:02                5904
function.cubrid-num-fields.php                     30-Sep-2022 11:02                5577
function.cubrid-num-rows.php                       30-Sep-2022 11:02                7103
function.cubrid-pconnect-with-url.php              30-Sep-2022 11:02               14973
function.cubrid-pconnect.php                       30-Sep-2022 11:02               12014
function.cubrid-ping.php                           30-Sep-2022 11:02                6246
function.cubrid-prepare.php                        30-Sep-2022 11:02               10312
function.cubrid-put.php                            30-Sep-2022 11:02               11445
function.cubrid-query.php                          30-Sep-2022 11:02               15237
function.cubrid-real-escape-string.php             30-Sep-2022 11:02                8102
function.cubrid-result.php                         30-Sep-2022 11:02                7302
function.cubrid-rollback.php                       30-Sep-2022 11:02               15462
function.cubrid-save-to-glo.php                    30-Sep-2022 11:02                6721
function.cubrid-schema.php                         30-Sep-2022 11:02               20211
function.cubrid-send-glo.php                       30-Sep-2022 11:02                6154
function.cubrid-seq-drop.php                       30-Sep-2022 11:02                9654
function.cubrid-seq-insert.php                     30-Sep-2022 11:02               10109
function.cubrid-seq-put.php                        30-Sep-2022 11:02               10036
function.cubrid-set-add.php                        30-Sep-2022 11:02                9409
function.cubrid-set-autocommit.php                 30-Sep-2022 11:02                3942
function.cubrid-set-db-parameter.php               30-Sep-2022 11:02                7934
function.cubrid-set-drop.php                       30-Sep-2022 11:02                9386
function.cubrid-set-query-timeout.php              30-Sep-2022 11:02                3286
function.cubrid-unbuffered-query.php               30-Sep-2022 11:02                7108
function.cubrid-version.php                        30-Sep-2022 11:02                8888
function.curl-close.php                            30-Sep-2022 11:02                5189
function.curl-copy-handle.php                      30-Sep-2022 11:02                5125
function.curl-errno.php                            30-Sep-2022 11:02                5425
function.curl-error.php                            30-Sep-2022 11:02                5345
function.curl-escape.php                           30-Sep-2022 11:02                6706
function.curl-exec.php                             30-Sep-2022 11:02                5456
function.curl-getinfo.php                          30-Sep-2022 11:02               13895
function.curl-init.php                             30-Sep-2022 11:02                6067
function.curl-multi-add-handle.php                 30-Sep-2022 11:02                8827
function.curl-multi-close.php                      30-Sep-2022 11:02                8126
function.curl-multi-errno.php                      30-Sep-2022 11:02                3642
function.curl-multi-exec.php                       30-Sep-2022 11:02               10632
function.curl-multi-getcontent.php                 30-Sep-2022 11:02                3163
function.curl-multi-info-read.php                  30-Sep-2022 11:02               11596
function.curl-multi-init.php                       30-Sep-2022 11:02                9380
function.curl-multi-remove-handle.php              30-Sep-2022 11:02                4140
function.curl-multi-select.php                     30-Sep-2022 11:02                3392
function.curl-multi-setopt.php                     30-Sep-2022 11:02                7853
function.curl-multi-strerror.php                   30-Sep-2022 11:02                7060
function.curl-pause.php                            30-Sep-2022 11:02                2822
function.curl-reset.php                            30-Sep-2022 11:02                5888
function.curl-setopt-array.php                     30-Sep-2022 11:02                9177
function.curl-setopt.php                           30-Sep-2022 11:02              121610
function.curl-share-close.php                      30-Sep-2022 11:02                7595
function.curl-share-errno.php                      30-Sep-2022 11:02                3698
function.curl-share-init.php                       30-Sep-2022 11:02                7495
function.curl-share-setopt.php                     30-Sep-2022 11:02                9839
function.curl-share-strerror.php                   30-Sep-2022 11:02                3211
function.curl-strerror.php                         30-Sep-2022 11:02                6275
function.curl-unescape.php                         30-Sep-2022 11:02                7129
function.curl-version.php                          30-Sep-2022 11:02                6762
function.curl_upkeep.php                           30-Sep-2022 11:02                6810
function.current.php                               30-Sep-2022 11:02               10617
function.date-add.php                              30-Sep-2022 11:02                1716
function.date-create-from-format.php               30-Sep-2022 11:02                1891
function.date-create-immutable-from-format.php     30-Sep-2022 11:02                2003
function.date-create-immutable.php                 30-Sep-2022 11:02                1895
function.date-create.php                           30-Sep-2022 11:02                1769
function.date-date-set.php                         30-Sep-2022 11:02                1775
function.date-default-timezone-get.php             30-Sep-2022 11:02                8528
function.date-default-timezone-set.php             30-Sep-2022 11:02                6896
function.date-diff.php                             30-Sep-2022 11:02                1735
function.date-format.php                           30-Sep-2022 11:02                1743
function.date-get-last-errors.php                  30-Sep-2022 11:02                1872
function.date-interval-create-from-date-string.php 30-Sep-2022 11:02                2019
function.date-interval-format.php                  30-Sep-2022 11:02                1870
function.date-isodate-set.php                      30-Sep-2022 11:02                1798
function.date-modify.php                           30-Sep-2022 11:02                1747
function.date-offset-get.php                       30-Sep-2022 11:02                1791
function.date-parse-from-format.php                30-Sep-2022 11:02                5185
function.date-parse.php                            30-Sep-2022 11:02                6168
function.date-sub.php                              30-Sep-2022 11:02                1698
function.date-sun-info.php                         30-Sep-2022 11:02                5817
function.date-sunrise.php                          30-Sep-2022 11:02                9320
function.date-sunset.php                           30-Sep-2022 11:02                9338
function.date-time-set.php                         30-Sep-2022 11:02                1761
function.date-timestamp-get.php                    30-Sep-2022 11:02                1820
function.date-timestamp-set.php                    30-Sep-2022 11:02                1828
function.date-timezone-get.php                     30-Sep-2022 11:02                1817
function.date-timezone-set.php                     30-Sep-2022 11:02                1789
function.date.php                                  30-Sep-2022 11:02               23107
function.db2-autocommit.php                        30-Sep-2022 11:02               10950
function.db2-bind-param.php                        30-Sep-2022 11:02               22695
function.db2-client-info.php                       30-Sep-2022 11:02               12155
function.db2-close.php                             30-Sep-2022 11:02                5510
function.db2-column-privileges.php                 30-Sep-2022 11:02                7940
function.db2-columns.php                           30-Sep-2022 11:02                9836
function.db2-commit.php                            30-Sep-2022 11:02                3511
function.db2-conn-error.php                        30-Sep-2022 11:02                6658
function.db2-conn-errormsg.php                     30-Sep-2022 11:02                6430
function.db2-connect.php                           30-Sep-2022 11:02               40543
function.db2-cursor-type.php                       30-Sep-2022 11:02                3072
function.db2-escape-string.php                     30-Sep-2022 11:02                7979
function.db2-exec.php                              30-Sep-2022 11:02               28756
function.db2-execute.php                           30-Sep-2022 11:02               27668
function.db2-fetch-array.php                       30-Sep-2022 11:02               11395
function.db2-fetch-assoc.php                       30-Sep-2022 11:02               11411
function.db2-fetch-both.php                        30-Sep-2022 11:02               11944
function.db2-fetch-object.php                      30-Sep-2022 11:02                9029
function.db2-fetch-row.php                         30-Sep-2022 11:02               16691
function.db2-field-display-size.php                30-Sep-2022 11:02                4825
function.db2-field-name.php                        30-Sep-2022 11:02                4711
function.db2-field-num.php                         30-Sep-2022 11:02                4721
function.db2-field-precision.php                   30-Sep-2022 11:02                4753
function.db2-field-scale.php                       30-Sep-2022 11:02                4715
function.db2-field-type.php                        30-Sep-2022 11:02                4716
function.db2-field-width.php                       30-Sep-2022 11:02                4923
function.db2-foreign-keys.php                      30-Sep-2022 11:02                8557
function.db2-free-result.php                       30-Sep-2022 11:02                3154
function.db2-free-stmt.php                         30-Sep-2022 11:02                3142
function.db2-get-option.php                        30-Sep-2022 11:02               24932
function.db2-last-insert-id.php                    30-Sep-2022 11:02                8576
function.db2-lob-read.php                          30-Sep-2022 11:02               17751
function.db2-next-result.php                       30-Sep-2022 11:02                8982
function.db2-num-fields.php                        30-Sep-2022 11:02                7168
function.db2-num-rows.php                          30-Sep-2022 11:02                4257
function.db2-pclose.php                            30-Sep-2022 11:02                5698
function.db2-pconnect.php                          30-Sep-2022 11:02               32527
function.db2-prepare.php                           30-Sep-2022 11:02               10595
function.db2-primary-keys.php                      30-Sep-2022 11:02                7191
function.db2-procedure-columns.php                 30-Sep-2022 11:02               11246
function.db2-procedures.php                        30-Sep-2022 11:02                7629
function.db2-result.php                            30-Sep-2022 11:02                7896
function.db2-rollback.php                          30-Sep-2022 11:02                9812
function.db2-server-info.php                       30-Sep-2022 11:02               24285
function.db2-set-option.php                        30-Sep-2022 11:02               70534
function.db2-special-columns.php                   30-Sep-2022 11:02                9776
function.db2-statistics.php                        30-Sep-2022 11:02               11912
function.db2-stmt-error.php                        30-Sep-2022 11:02                4330
function.db2-stmt-errormsg.php                     30-Sep-2022 11:02                3961
function.db2-table-privileges.php                  30-Sep-2022 11:02                7720
function.db2-tables.php                            30-Sep-2022 11:02                7750
function.dba-close.php                             30-Sep-2022 11:02                3121
function.dba-delete.php                            30-Sep-2022 11:02                3831
function.dba-exists.php                            30-Sep-2022 11:02                3862
function.dba-fetch.php                             30-Sep-2022 11:02                5232
function.dba-firstkey.php                          30-Sep-2022 11:02                3470
function.dba-handlers.php                          30-Sep-2022 11:02                5385
function.dba-insert.php                            30-Sep-2022 11:02                4413
function.dba-key-split.php                         30-Sep-2022 11:02                3595
function.dba-list.php                              30-Sep-2022 11:02                2151
function.dba-nextkey.php                           30-Sep-2022 11:02                3392
function.dba-open.php                              30-Sep-2022 11:02               11307
function.dba-optimize.php                          30-Sep-2022 11:02                2984
function.dba-popen.php                             30-Sep-2022 11:02                6307
function.dba-replace.php                           30-Sep-2022 11:02                4241
function.dba-sync.php                              30-Sep-2022 11:02                3004
function.dbase-add-record.php                      30-Sep-2022 11:02                6295
function.dbase-close.php                           30-Sep-2022 11:02                4526
function.dbase-create.php                          30-Sep-2022 11:02                6941
function.dbase-delete-record.php                   30-Sep-2022 11:02                4144
function.dbase-get-header-info.php                 30-Sep-2022 11:02                6294
function.dbase-get-record-with-names.php           30-Sep-2022 11:02                7561
function.dbase-get-record.php                      30-Sep-2022 11:02                4319
function.dbase-numfields.php                       30-Sep-2022 11:02                5242
function.dbase-numrecords.php                      30-Sep-2022 11:02                5290
function.dbase-open.php                            30-Sep-2022 11:02                5792
function.dbase-pack.php                            30-Sep-2022 11:02                5643
function.dbase-replace-record.php                  30-Sep-2022 11:02                7660
function.dcgettext.php                             30-Sep-2022 11:02                3249
function.dcngettext.php                            30-Sep-2022 11:02                2582
function.debug-backtrace.php                       30-Sep-2022 11:02                9172
function.debug-print-backtrace.php                 30-Sep-2022 11:02                5368
function.debug-zval-dump.php                       30-Sep-2022 11:02                9626
function.decbin.php                                30-Sep-2022 11:02                4534
function.dechex.php                                30-Sep-2022 11:02                4532
function.decoct.php                                30-Sep-2022 11:02                4523
function.define.php                                30-Sep-2022 11:02                5972
function.defined.php                               30-Sep-2022 11:02                5160
function.deflate-add.php                           30-Sep-2022 11:02                5028
function.deflate-init.php                          30-Sep-2022 11:02                7069
function.deg2rad.php                               30-Sep-2022 11:02                3999
function.delete.php                                30-Sep-2022 11:02                2465
function.dgettext.php                              30-Sep-2022 11:02                2052
function.die.php                                   30-Sep-2022 11:02                1787
function.dio-close.php                             30-Sep-2022 11:02                3928
function.dio-fcntl.php                             30-Sep-2022 11:02                8886
function.dio-open.php                              30-Sep-2022 11:02                7493
function.dio-read.php                              30-Sep-2022 11:02                3332
function.dio-seek.php                              30-Sep-2022 11:02                7391
function.dio-stat.php                              30-Sep-2022 11:02                4090
function.dio-tcsetattr.php                         30-Sep-2022 11:02                6942
function.dio-truncate.php                          30-Sep-2022 11:02                3446
function.dio-write.php                             30-Sep-2022 11:02                3608
function.dir.php                                   30-Sep-2022 11:02                6463
function.dirname.php                               30-Sep-2022 11:02                9639
function.disk-free-space.php                       30-Sep-2022 11:02                5403
function.disk-total-space.php                      30-Sep-2022 11:02                4935
function.diskfreespace.php                         30-Sep-2022 11:02                1781
function.dl.php                                    30-Sep-2022 11:02               11657
function.dngettext.php                             30-Sep-2022 11:02                2454
function.dns-check-record.php                      30-Sep-2022 11:02                1729
function.dns-get-mx.php                            30-Sep-2022 11:02                1702
function.dns-get-record.php                        30-Sep-2022 11:02               22338
function.dom-import-simplexml.php                  30-Sep-2022 11:02                7150
function.doubleval.php                             30-Sep-2022 11:02                1715
function.each.php                                  30-Sep-2022 11:02               10808
function.easter-date.php                           30-Sep-2022 11:02                5690
function.easter-days.php                           30-Sep-2022 11:02                5933
function.echo.php                                  30-Sep-2022 11:02               12655
function.eio-busy.php                              30-Sep-2022 11:02                4456
function.eio-cancel.php                            30-Sep-2022 11:02                7327
function.eio-chmod.php                             30-Sep-2022 11:02                5674
function.eio-chown.php                             30-Sep-2022 11:02                5821
function.eio-close.php                             30-Sep-2022 11:02                5249
function.eio-custom.php                            30-Sep-2022 11:02               10301
function.eio-dup2.php                              30-Sep-2022 11:02                5329
function.eio-event-loop.php                        30-Sep-2022 11:02                5820
function.eio-fallocate.php                         30-Sep-2022 11:02                6770
function.eio-fchmod.php                            30-Sep-2022 11:02                5722
function.eio-fchown.php                            30-Sep-2022 11:02                5970
function.eio-fdatasync.php                         30-Sep-2022 11:02                5148
function.eio-fstat.php                             30-Sep-2022 11:02               11583
function.eio-fstatvfs.php                          30-Sep-2022 11:02                5291
function.eio-fsync.php                             30-Sep-2022 11:02                5265
function.eio-ftruncate.php                         30-Sep-2022 11:02                5740
function.eio-futime.php                            30-Sep-2022 11:02                5992
function.eio-get-event-stream.php                  30-Sep-2022 11:02                8498
function.eio-get-last-error.php                    30-Sep-2022 11:02                2950
function.eio-grp-add.php                           30-Sep-2022 11:02               12105
function.eio-grp-cancel.php                        30-Sep-2022 11:02                3046
function.eio-grp-limit.php                         30-Sep-2022 11:02                2891
function.eio-grp.php                               30-Sep-2022 11:02               12132
function.eio-init.php                              30-Sep-2022 11:02                2537
function.eio-link.php                              30-Sep-2022 11:02               12547
function.eio-lstat.php                             30-Sep-2022 11:02                9614
function.eio-mkdir.php                             30-Sep-2022 11:02                8939
function.eio-mknod.php                             30-Sep-2022 11:02               10839
function.eio-nop.php                               30-Sep-2022 11:02                4877
function.eio-npending.php                          30-Sep-2022 11:02                2964
function.eio-nready.php                            30-Sep-2022 11:02                2712
function.eio-nreqs.php                             30-Sep-2022 11:02                5577
function.eio-nthreads.php                          30-Sep-2022 11:02                3431
function.eio-open.php                              30-Sep-2022 11:02               11524
function.eio-poll.php                              30-Sep-2022 11:02                5736
function.eio-read.php                              30-Sep-2022 11:02               12841
function.eio-readahead.php                         30-Sep-2022 11:02                5709
function.eio-readdir.php                           30-Sep-2022 11:02               15635
function.eio-readlink.php                          30-Sep-2022 11:02               12234
function.eio-realpath.php                          30-Sep-2022 11:02                5113
function.eio-rename.php                            30-Sep-2022 11:02                9047
function.eio-rmdir.php                             30-Sep-2022 11:02                7979
function.eio-seek.php                              30-Sep-2022 11:02                6402
function.eio-sendfile.php                          30-Sep-2022 11:02                5978
function.eio-set-max-idle.php                      30-Sep-2022 11:02                3070
function.eio-set-max-parallel.php                  30-Sep-2022 11:02                3119
function.eio-set-max-poll-reqs.php                 30-Sep-2022 11:02                2392
function.eio-set-max-poll-time.php                 30-Sep-2022 11:02                2462
function.eio-set-min-parallel.php                  30-Sep-2022 11:02                3108
function.eio-stat.php                              30-Sep-2022 11:02                9586
function.eio-statvfs.php                           30-Sep-2022 11:02                7942
function.eio-symlink.php                           30-Sep-2022 11:02               10667
function.eio-sync-file-range.php                   30-Sep-2022 11:02                6565
function.eio-sync.php                              30-Sep-2022 11:02                2728
function.eio-syncfs.php                            30-Sep-2022 11:02                4831
function.eio-truncate.php                          30-Sep-2022 11:02                5616
function.eio-unlink.php                            30-Sep-2022 11:02                4836
function.eio-utime.php                             30-Sep-2022 11:02                5600
function.eio-write.php                             30-Sep-2022 11:02                6363
function.empty.php                                 30-Sep-2022 11:02               11969
function.enchant-broker-describe.php               30-Sep-2022 11:02                5913
function.enchant-broker-dict-exists.php            30-Sep-2022 11:02                5601
function.enchant-broker-free-dict.php              30-Sep-2022 11:02                4670
function.enchant-broker-free.php                   30-Sep-2022 11:02                4207
function.enchant-broker-get-dict-path.php          30-Sep-2022 11:02                5013
function.enchant-broker-get-error.php              30-Sep-2022 11:02                3526
function.enchant-broker-init.php                   30-Sep-2022 11:02                3408
function.enchant-broker-list-dicts.php             30-Sep-2022 11:02                6764
function.enchant-broker-request-dict.php           30-Sep-2022 11:02                7022
function.enchant-broker-request-pwl-dict.php       30-Sep-2022 11:02                5265
function.enchant-broker-set-dict-path.php          30-Sep-2022 11:02                5222
function.enchant-broker-set-ordering.php           30-Sep-2022 11:02                4521
function.enchant-dict-add-to-personal.php          30-Sep-2022 11:02                2188
function.enchant-dict-add-to-session.php           30-Sep-2022 11:02                4362
function.enchant-dict-add.php                      30-Sep-2022 11:02                6252
function.enchant-dict-check.php                    30-Sep-2022 11:02                3924
function.enchant-dict-describe.php                 30-Sep-2022 11:02                6408
function.enchant-dict-get-error.php                30-Sep-2022 11:02                3729
function.enchant-dict-is-added.php                 30-Sep-2022 11:02                4273
function.enchant-dict-is-in-session.php            30-Sep-2022 11:02                2174
function.enchant-dict-quick-check.php              30-Sep-2022 11:02                7988
function.enchant-dict-store-replacement.php        30-Sep-2022 11:02                4466
function.enchant-dict-suggest.php                  30-Sep-2022 11:02                7687
function.end.php                                   30-Sep-2022 11:02                4724
function.enum-exists.php                           30-Sep-2022 11:02                5109
function.error-clear-last.php                      30-Sep-2022 11:02                4578
function.error-get-last.php                        30-Sep-2022 11:02                3988
function.error-log.php                             30-Sep-2022 11:02                8171
function.error-reporting.php                       30-Sep-2022 11:02               10571
function.escapeshellarg.php                        30-Sep-2022 11:02                5051
function.escapeshellcmd.php                        30-Sep-2022 11:02                6428
function.eval.php                                  30-Sep-2022 11:02                5701
function.exec.php                                  30-Sep-2022 11:02                8098
function.exif-imagetype.php                        30-Sep-2022 11:02                7156
function.exif-read-data.php                        30-Sep-2022 11:02               14356
function.exif-tagname.php                          30-Sep-2022 11:02                2915
function.exif-thumbnail.php                        30-Sep-2022 11:02                8070
function.exit.php                                  30-Sep-2022 11:02                5553
function.exp.php                                   30-Sep-2022 11:02                4208
function.expect-expectl.php                        30-Sep-2022 11:02               11476
function.expect-popen.php                          30-Sep-2022 11:02                4548
function.explode.php                               30-Sep-2022 11:02               11116
function.expm1.php                                 30-Sep-2022 11:02                3783
function.extension-loaded.php                      30-Sep-2022 11:02                6022
function.extract.php                               30-Sep-2022 11:02               12716
function.ezmlm-hash.php                            30-Sep-2022 11:02                4217
function.fann-cascadetrain-on-data.php             30-Sep-2022 11:02                6120
function.fann-cascadetrain-on-file.php             30-Sep-2022 11:02                5172
function.fann-clear-scaling-params.php             30-Sep-2022 11:02                2491
function.fann-copy.php                             30-Sep-2022 11:02                3069
function.fann-create-from-file.php                 30-Sep-2022 11:02                3088
function.fann-create-shortcut-array.php            30-Sep-2022 11:02                3957
function.fann-create-shortcut.php                  30-Sep-2022 11:02                4869
function.fann-create-sparse-array.php              30-Sep-2022 11:02                4542
function.fann-create-sparse.php                    30-Sep-2022 11:02                5192
function.fann-create-standard-array.php            30-Sep-2022 11:02                4270
function.fann-create-standard.php                  30-Sep-2022 11:02                4937
function.fann-create-train-from-callback.php       30-Sep-2022 11:02                9172
function.fann-create-train.php                     30-Sep-2022 11:02                4345
function.fann-descale-input.php                    30-Sep-2022 11:02                3527
function.fann-descale-output.php                   30-Sep-2022 11:02                3543
function.fann-descale-train.php                    30-Sep-2022 11:02                3493
function.fann-destroy-train.php                    30-Sep-2022 11:02                2451
function.fann-destroy.php                          30-Sep-2022 11:02                2478
function.fann-duplicate-train-data.php             30-Sep-2022 11:02                2619
function.fann-get-activation-function.php          30-Sep-2022 11:02                5035
function.fann-get-activation-steepness.php         30-Sep-2022 11:02                5448
function.fann-get-bias-array.php                   30-Sep-2022 11:02                2460
function.fann-get-bit-fail-limit.php               30-Sep-2022 11:02                3583
function.fann-get-bit-fail.php                     30-Sep-2022 11:02                4806
function.fann-get-cascade-activation-functions-..> 30-Sep-2022 11:02                3695
function.fann-get-cascade-activation-functions.php 30-Sep-2022 11:02                4151
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:02                3751
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:02                3902
function.fann-get-cascade-candidate-change-frac..> 30-Sep-2022 11:02                5023
function.fann-get-cascade-candidate-limit.php      30-Sep-2022 11:02                3383
function.fann-get-cascade-candidate-stagnation-..> 30-Sep-2022 11:02                4134
function.fann-get-cascade-max-cand-epochs.php      30-Sep-2022 11:02                3265
function.fann-get-cascade-max-out-epochs.php       30-Sep-2022 11:02                3186
function.fann-get-cascade-min-cand-epochs.php      30-Sep-2022 11:02                3570
function.fann-get-cascade-min-out-epochs.php       30-Sep-2022 11:02                3527
function.fann-get-cascade-num-candidate-groups.php 30-Sep-2022 11:02                3663
function.fann-get-cascade-num-candidates.php       30-Sep-2022 11:02                5857
function.fann-get-cascade-output-change-fractio..> 30-Sep-2022 11:02                4951
function.fann-get-cascade-output-stagnation-epo..> 30-Sep-2022 11:02                4077
function.fann-get-cascade-weight-multiplier.php    30-Sep-2022 11:02                3341
function.fann-get-connection-array.php             30-Sep-2022 11:02                2487
function.fann-get-connection-rate.php              30-Sep-2022 11:02                2558
function.fann-get-errno.php                        30-Sep-2022 11:02                2994
function.fann-get-errstr.php                       30-Sep-2022 11:02                2997
function.fann-get-layer-array.php                  30-Sep-2022 11:02                2561
function.fann-get-learning-momentum.php            30-Sep-2022 11:02                3578
function.fann-get-learning-rate.php                30-Sep-2022 11:02                3429
function.fann-get-mse.php                          30-Sep-2022 11:02                3046
function.fann-get-network-type.php                 30-Sep-2022 11:02                2528
function.fann-get-num-input.php                    30-Sep-2022 11:02                2415
function.fann-get-num-layers.php                   30-Sep-2022 11:02                2470
function.fann-get-num-output.php                   30-Sep-2022 11:02                2434
function.fann-get-quickprop-decay.php              30-Sep-2022 11:02                3198
function.fann-get-quickprop-mu.php                 30-Sep-2022 11:02                3091
function.fann-get-rprop-decrease-factor.php        30-Sep-2022 11:02                3152
function.fann-get-rprop-delta-max.php              30-Sep-2022 11:02                3229
function.fann-get-rprop-delta-min.php              30-Sep-2022 11:02                3025
function.fann-get-rprop-delta-zero.php             30-Sep-2022 11:02                3428
function.fann-get-rprop-increase-factor.php        30-Sep-2022 11:02                3177
function.fann-get-sarprop-step-error-shift.php     30-Sep-2022 11:02                3487
function.fann-get-sarprop-step-error-threshold-..> 30-Sep-2022 11:02                3639
function.fann-get-sarprop-temperature.php          30-Sep-2022 11:02                3401
function.fann-get-sarprop-weight-decay-shift.php   30-Sep-2022 11:02                3468
function.fann-get-total-connections.php            30-Sep-2022 11:02                2607
function.fann-get-total-neurons.php                30-Sep-2022 11:02                2654
function.fann-get-train-error-function.php         30-Sep-2022 11:02                3368
function.fann-get-train-stop-function.php          30-Sep-2022 11:02                3356
function.fann-get-training-algorithm.php           30-Sep-2022 11:02                3528
function.fann-init-weights.php                     30-Sep-2022 11:02                4144
function.fann-length-train-data.php                30-Sep-2022 11:02                2609
function.fann-merge-train-data.php                 30-Sep-2022 11:02                2859
function.fann-num-input-train-data.php             30-Sep-2022 11:02                3340
function.fann-num-output-train-data.php            30-Sep-2022 11:02                3338
function.fann-print-error.php                      30-Sep-2022 11:02                2820
function.fann-randomize-weights.php                30-Sep-2022 11:02                3648
function.fann-read-train-from-file.php             30-Sep-2022 11:02                4931
function.fann-reset-errno.php                      30-Sep-2022 11:02                3011
function.fann-reset-errstr.php                     30-Sep-2022 11:02                2992
function.fann-reset-mse.php                        30-Sep-2022 11:02                3277
function.fann-run.php                              30-Sep-2022 11:02                2670
function.fann-save-train.php                       30-Sep-2022 11:02                3257
function.fann-save.php                             30-Sep-2022 11:02                4063
function.fann-scale-input-train-data.php           30-Sep-2022 11:02                3847
function.fann-scale-input.php                      30-Sep-2022 11:02                3541
function.fann-scale-output-train-data.php          30-Sep-2022 11:02                3875
function.fann-scale-output.php                     30-Sep-2022 11:02                3545
function.fann-scale-train-data.php                 30-Sep-2022 11:02                3845
function.fann-scale-train.php                      30-Sep-2022 11:02                3511
function.fann-set-activation-function-hidden.php   30-Sep-2022 11:02                4266
function.fann-set-activation-function-layer.php    30-Sep-2022 11:02                4726
function.fann-set-activation-function-output.php   30-Sep-2022 11:02                4282
function.fann-set-activation-function.php          30-Sep-2022 11:02                5990
function.fann-set-activation-steepness-hidden.php  30-Sep-2022 11:02                4567
function.fann-set-activation-steepness-layer.php   30-Sep-2022 11:02                4978
function.fann-set-activation-steepness-output.php  30-Sep-2022 11:02                4548
function.fann-set-activation-steepness.php         30-Sep-2022 11:02                5820
function.fann-set-bit-fail-limit.php               30-Sep-2022 11:02                3210
function.fann-set-callback.php                     30-Sep-2022 11:02                5264
function.fann-set-cascade-activation-functions.php 30-Sep-2022 11:02                3881
function.fann-set-cascade-activation-steepnesse..> 30-Sep-2022 11:02                4094
function.fann-set-cascade-candidate-change-frac..> 30-Sep-2022 11:02                3561
function.fann-set-cascade-candidate-limit.php      30-Sep-2022 11:02                3368
function.fann-set-cascade-candidate-stagnation-..> 30-Sep-2022 11:02                3623
function.fann-set-cascade-max-cand-epochs.php      30-Sep-2022 11:02                3369
function.fann-set-cascade-max-out-epochs.php       30-Sep-2022 11:02                3320
function.fann-set-cascade-min-cand-epochs.php      30-Sep-2022 11:02                3679
function.fann-set-cascade-min-out-epochs.php       30-Sep-2022 11:02                3661
function.fann-set-cascade-num-candidate-groups.php 30-Sep-2022 11:02                3454
function.fann-set-cascade-output-change-fractio..> 30-Sep-2022 11:02                3518
function.fann-set-cascade-output-stagnation-epo..> 30-Sep-2022 11:02                3584
function.fann-set-cascade-weight-multiplier.php    30-Sep-2022 11:02                3353
function.fann-set-error-log.php                    30-Sep-2022 11:02                2770
function.fann-set-input-scaling-params.php         30-Sep-2022 11:02                4148
function.fann-set-learning-momentum.php            30-Sep-2022 11:02                3609
function.fann-set-learning-rate.php                30-Sep-2022 11:02                3535
function.fann-set-output-scaling-params.php        30-Sep-2022 11:02                4168
function.fann-set-quickprop-decay.php              30-Sep-2022 11:02                3281
function.fann-set-quickprop-mu.php                 30-Sep-2022 11:02                3136
function.fann-set-rprop-decrease-factor.php        30-Sep-2022 11:02                3338
function.fann-set-rprop-delta-max.php              30-Sep-2022 11:02                3465
function.fann-set-rprop-delta-min.php              30-Sep-2022 11:02                3256
function.fann-set-rprop-delta-zero.php             30-Sep-2022 11:02                3668
function.fann-set-rprop-increase-factor.php        30-Sep-2022 11:02                3364
function.fann-set-sarprop-step-error-shift.php     30-Sep-2022 11:02                3729
function.fann-set-sarprop-step-error-threshold-..> 30-Sep-2022 11:02                3923
function.fann-set-sarprop-temperature.php          30-Sep-2022 11:02                3640
function.fann-set-sarprop-weight-decay-shift.php   30-Sep-2022 11:02                3723
function.fann-set-scaling-params.php               30-Sep-2022 11:02                5092
function.fann-set-train-error-function.php         30-Sep-2022 11:02                3550
function.fann-set-train-stop-function.php          30-Sep-2022 11:02                3538
function.fann-set-training-algorithm.php           30-Sep-2022 11:02                3486
function.fann-set-weight-array.php                 30-Sep-2022 11:02                2979
function.fann-set-weight.php                       30-Sep-2022 11:02                3319
function.fann-shuffle-train-data.php               30-Sep-2022 11:02                2651
function.fann-subset-train-data.php                30-Sep-2022 11:02                3893
function.fann-test-data.php                        30-Sep-2022 11:02                3994
function.fann-test.php                             30-Sep-2022 11:02                4281
function.fann-train-epoch.php                      30-Sep-2022 11:02                4353
function.fann-train-on-data.php                    30-Sep-2022 11:02                6131
function.fann-train-on-file.php                    30-Sep-2022 11:02                6120
function.fann-train.php                            30-Sep-2022 11:02                4312
function.fastcgi-finish-request.php                30-Sep-2022 11:02                2250
function.fbird-add-user.php                        30-Sep-2022 11:02                2375
function.fbird-affected-rows.php                   30-Sep-2022 11:02                2373
function.fbird-backup.php                          30-Sep-2022 11:02                1752
function.fbird-blob-add.php                        30-Sep-2022 11:02                2725
function.fbird-blob-cancel.php                     30-Sep-2022 11:02                3525
function.fbird-blob-close.php                      30-Sep-2022 11:02                2756
function.fbird-blob-create.php                     30-Sep-2022 11:02                2756
function.fbird-blob-echo.php                       30-Sep-2022 11:02                2544
function.fbird-blob-get.php                        30-Sep-2022 11:02                2537
function.fbird-blob-import.php                     30-Sep-2022 11:02                2752
function.fbird-blob-info.php                       30-Sep-2022 11:02                1784
function.fbird-blob-open.php                       30-Sep-2022 11:02                2534
function.fbird-close.php                           30-Sep-2022 11:02                2296
function.fbird-commit-ret.php                      30-Sep-2022 11:02                1777
function.fbird-commit.php                          30-Sep-2022 11:02                1745
function.fbird-connect.php                         30-Sep-2022 11:02                2302
function.fbird-db-info.php                         30-Sep-2022 11:02                1758
function.fbird-delete-user.php                     30-Sep-2022 11:02                2370
function.fbird-drop-db.php                         30-Sep-2022 11:02                2318
function.fbird-errcode.php                         30-Sep-2022 11:02                2117
function.fbird-errmsg.php                          30-Sep-2022 11:02                2110
function.fbird-execute.php                         30-Sep-2022 11:02                2122
function.fbird-fetch-assoc.php                     30-Sep-2022 11:02                2386
function.fbird-fetch-object.php                    30-Sep-2022 11:02                2397
function.fbird-fetch-row.php                       30-Sep-2022 11:02                2374
function.fbird-field-info.php                      30-Sep-2022 11:02                2192
function.fbird-free-event-handler.php              30-Sep-2022 11:02                2296
function.fbird-free-query.php                      30-Sep-2022 11:02                1813
function.fbird-free-result.php                     30-Sep-2022 11:02                1798
function.fbird-gen-id.php                          30-Sep-2022 11:02                1755
function.fbird-maintain-db.php                     30-Sep-2022 11:02                1800
function.fbird-modify-user.php                     30-Sep-2022 11:02                2386
function.fbird-name-result.php                     30-Sep-2022 11:02                2369
function.fbird-num-fields.php                      30-Sep-2022 11:02                2181
function.fbird-num-params.php                      30-Sep-2022 11:02                2364
function.fbird-param-info.php                      30-Sep-2022 11:02                2369
function.fbird-pconnect.php                        30-Sep-2022 11:02                2319
function.fbird-prepare.php                         30-Sep-2022 11:02                1748
function.fbird-query.php                           30-Sep-2022 11:02                2683
function.fbird-restore.php                         30-Sep-2022 11:02                1755
function.fbird-rollback-ret.php                    30-Sep-2022 11:02                1807
function.fbird-rollback.php                        30-Sep-2022 11:02                1779
function.fbird-server-info.php                     30-Sep-2022 11:02                1810
function.fbird-service-attach.php                  30-Sep-2022 11:02                1849
function.fbird-service-detach.php                  30-Sep-2022 11:02                1861
function.fbird-set-event-handler.php               30-Sep-2022 11:02                2479
function.fbird-trans.php                           30-Sep-2022 11:02                1754
function.fbird-wait-event.php                      30-Sep-2022 11:02                2404
function.fclose.php                                30-Sep-2022 11:02                4283
function.fdatasync.php                             30-Sep-2022 11:02                5868
function.fdf-add-doc-javascript.php                30-Sep-2022 11:02                5213
function.fdf-add-template.php                      30-Sep-2022 11:02                2526
function.fdf-close.php                             30-Sep-2022 11:02                2986
function.fdf-create.php                            30-Sep-2022 11:02                5558
function.fdf-enum-values.php                       30-Sep-2022 11:02                2376
function.fdf-errno.php                             30-Sep-2022 11:02                2694
function.fdf-error.php                             30-Sep-2022 11:02                3079
function.fdf-get-ap.php                            30-Sep-2022 11:02                3849
function.fdf-get-attachment.php                    30-Sep-2022 11:02                5936
function.fdf-get-encoding.php                      30-Sep-2022 11:02                3255
function.fdf-get-file.php                          30-Sep-2022 11:02                3075
function.fdf-get-flags.php                         30-Sep-2022 11:02                2138
function.fdf-get-opt.php                           30-Sep-2022 11:02                2276
function.fdf-get-status.php                        30-Sep-2022 11:02                3094
function.fdf-get-value.php                         30-Sep-2022 11:02                4382
function.fdf-get-version.php                       30-Sep-2022 11:02                3454
function.fdf-header.php                            30-Sep-2022 11:02                2282
function.fdf-next-field-name.php                   30-Sep-2022 11:02                5332
function.fdf-open-string.php                       30-Sep-2022 11:02                4732
function.fdf-open.php                              30-Sep-2022 11:02                5838
function.fdf-remove-item.php                       30-Sep-2022 11:02                2150
function.fdf-save-string.php                       30-Sep-2022 11:02                5492
function.fdf-save.php                              30-Sep-2022 11:02                3835
function.fdf-set-ap.php                            30-Sep-2022 11:02                4022
function.fdf-set-encoding.php                      30-Sep-2022 11:02                3473
function.fdf-set-file.php                          30-Sep-2022 11:02                6708
function.fdf-set-flags.php                         30-Sep-2022 11:02                4003
function.fdf-set-javascript-action.php             30-Sep-2022 11:02                4198
function.fdf-set-on-import-javascript.php          30-Sep-2022 11:02                2956
function.fdf-set-opt.php                           30-Sep-2022 11:02                4228
function.fdf-set-status.php                        30-Sep-2022 11:02                3524
function.fdf-set-submit-form-action.php            30-Sep-2022 11:02                4443
function.fdf-set-target-frame.php                  30-Sep-2022 11:02                3524
function.fdf-set-value.php                         30-Sep-2022 11:02                4967
function.fdf-set-version.php                       30-Sep-2022 11:02                3748
function.fdiv.php                                  30-Sep-2022 11:02                5989
function.feof.php                                  30-Sep-2022 11:02                5389
function.fflush.php                                30-Sep-2022 11:02                2836
function.fgetc.php                                 30-Sep-2022 11:02                6380
function.fgetcsv.php                               30-Sep-2022 11:02               12064
function.fgets.php                                 30-Sep-2022 11:02                8731
function.fgetss.php                                30-Sep-2022 11:02                6085
function.file-exists.php                           30-Sep-2022 11:02                6857
function.file-get-contents.php                     30-Sep-2022 11:02               17842
function.file-put-contents.php                     30-Sep-2022 11:02               12816
function.file.php                                  30-Sep-2022 11:02               14123
function.fileatime.php                             30-Sep-2022 11:02                6363
function.filectime.php                             30-Sep-2022 11:02                6432
function.filegroup.php                             30-Sep-2022 11:02                5418
function.fileinode.php                             30-Sep-2022 11:02                3575
function.filemtime.php                             30-Sep-2022 11:02                6235
function.fileowner.php                             30-Sep-2022 11:02                3811
function.fileperms.php                             30-Sep-2022 11:02               17116
function.filesize.php                              30-Sep-2022 11:02                5470
function.filetype.php                              30-Sep-2022 11:02                6395
function.filter-has-var.php                        30-Sep-2022 11:02                2879
function.filter-id.php                             30-Sep-2022 11:02                2687
function.filter-input-array.php                    30-Sep-2022 11:02               12515
function.filter-input.php                          30-Sep-2022 11:02                7492
function.filter-list.php                           30-Sep-2022 11:02                3396
function.filter-var-array.php                      30-Sep-2022 11:02               13084
function.filter-var.php                            30-Sep-2022 11:02                6115
function.finfo-buffer.php                          30-Sep-2022 11:02                7643
function.finfo-close.php                           30-Sep-2022 11:02                3371
function.finfo-file.php                            30-Sep-2022 11:02                8302
function.finfo-open.php                            30-Sep-2022 11:02                9727
function.finfo-set-flags.php                       30-Sep-2022 11:02                4397
function.floatval.php                              30-Sep-2022 11:02                6217
function.flock.php                                 30-Sep-2022 11:02                8837
function.floor.php                                 30-Sep-2022 11:02                4431
function.flush.php                                 30-Sep-2022 11:02                3180
function.fmod.php                                  30-Sep-2022 11:02                4327
function.fnmatch.php                               30-Sep-2022 11:02                6380
function.fopen.php                                 30-Sep-2022 11:02               20269
function.forward-static-call-array.php             30-Sep-2022 11:02               10114
function.forward-static-call.php                   30-Sep-2022 11:02                9596
function.fpassthru.php                             30-Sep-2022 11:02                7590
function.fpm-get-status.php                        30-Sep-2022 11:02                2493
function.fprintf.php                               30-Sep-2022 11:02                9263
function.fputcsv.php                               30-Sep-2022 11:02                8878
function.fputs.php                                 30-Sep-2022 11:02                1658
function.fread.php                                 30-Sep-2022 11:02               13032
function.frenchtojd.php                            30-Sep-2022 11:02                2496
function.fscanf.php                                30-Sep-2022 11:02                7919
function.fseek.php                                 30-Sep-2022 11:02                7536
function.fsockopen.php                             30-Sep-2022 11:02               16057
function.fstat.php                                 30-Sep-2022 11:02                6020
function.fsync.php                                 30-Sep-2022 11:02                5630
function.ftell.php                                 30-Sep-2022 11:02                5704
function.ftok.php                                  30-Sep-2022 11:02                3515
function.ftp-alloc.php                             30-Sep-2022 11:02                7585
function.ftp-append.php                            30-Sep-2022 11:02                4119
function.ftp-cdup.php                              30-Sep-2022 11:02                6100
function.ftp-chdir.php                             30-Sep-2022 11:02                7027
function.ftp-chmod.php                             30-Sep-2022 11:02                6416
function.ftp-close.php                             30-Sep-2022 11:02                5388
function.ftp-connect.php                           30-Sep-2022 11:02                5561
function.ftp-delete.php                            30-Sep-2022 11:02                5713
function.ftp-exec.php                              30-Sep-2022 11:02                6047
function.ftp-fget.php                              30-Sep-2022 11:02                8902
function.ftp-fput.php                              30-Sep-2022 11:02                8242
function.ftp-get-option.php                        30-Sep-2022 11:02                5148
function.ftp-get.php                               30-Sep-2022 11:02                8165
function.ftp-login.php                             30-Sep-2022 11:02                6077
function.ftp-mdtm.php                              30-Sep-2022 11:02                6551
function.ftp-mkdir.php                             30-Sep-2022 11:02                5776
function.ftp-mlsd.php                              30-Sep-2022 11:02                9015
function.ftp-nb-continue.php                       30-Sep-2022 11:02                4746
function.ftp-nb-fget.php                           30-Sep-2022 11:02                9281
function.ftp-nb-fput.php                           30-Sep-2022 11:02                9062
function.ftp-nb-get.php                            30-Sep-2022 11:02               13434
function.ftp-nb-put.php                            30-Sep-2022 11:02               10676
function.ftp-nlist.php                             30-Sep-2022 11:02                5768
function.ftp-pasv.php                              30-Sep-2022 11:02                6538
function.ftp-put.php                               30-Sep-2022 11:02                7779
function.ftp-pwd.php                               30-Sep-2022 11:02                5229
function.ftp-quit.php                              30-Sep-2022 11:02                1653
function.ftp-raw.php                               30-Sep-2022 11:02                4666
function.ftp-rawlist.php                           30-Sep-2022 11:02                6786
function.ftp-rename.php                            30-Sep-2022 11:02                6247
function.ftp-rmdir.php                             30-Sep-2022 11:02                5815
function.ftp-set-option.php                        30-Sep-2022 11:02                5924
function.ftp-site.php                              30-Sep-2022 11:02                6046
function.ftp-size.php                              30-Sep-2022 11:02                6195
function.ftp-ssl-connect.php                       30-Sep-2022 11:02                7286
function.ftp-systype.php                           30-Sep-2022 11:02                4697
function.ftruncate.php                             30-Sep-2022 11:02                4872
function.func-get-arg.php                          30-Sep-2022 11:02                7341
function.func-get-args.php                         30-Sep-2022 11:02                7883
function.func-num-args.php                         30-Sep-2022 11:02                5793
function.function-exists.php                       30-Sep-2022 11:02                5632
function.fwrite.php                                30-Sep-2022 11:02               12349
function.gc-collect-cycles.php                     30-Sep-2022 11:02                2494
function.gc-disable.php                            30-Sep-2022 11:02                2561
function.gc-enable.php                             30-Sep-2022 11:02                2534
function.gc-enabled.php                            30-Sep-2022 11:02                3255
function.gc-mem-caches.php                         30-Sep-2022 11:02                2434
function.gc-status.php                             30-Sep-2022 11:02                5959
function.gd-info.php                               30-Sep-2022 11:02                7257
function.geoip-asnum-by-name.php                   30-Sep-2022 11:02                4107
function.geoip-continent-code-by-name.php          30-Sep-2022 11:02                5631
function.geoip-country-code-by-name.php            30-Sep-2022 11:02                5366
function.geoip-country-code3-by-name.php           30-Sep-2022 11:02                4931
function.geoip-country-name-by-name.php            30-Sep-2022 11:02                4896
function.geoip-database-info.php                   30-Sep-2022 11:02                4116
function.geoip-db-avail.php                        30-Sep-2022 11:02                4255
function.geoip-db-filename.php                     30-Sep-2022 11:02                3992
function.geoip-db-get-all-info.php                 30-Sep-2022 11:02                6739
function.geoip-domain-by-name.php                  30-Sep-2022 11:02                4324
function.geoip-id-by-name.php                      30-Sep-2022 11:02                5860
function.geoip-isp-by-name.php                     30-Sep-2022 11:02                4348
function.geoip-netspeedcell-by-name.php            30-Sep-2022 11:02                5071
function.geoip-org-by-name.php                     30-Sep-2022 11:02                4367
function.geoip-record-by-name.php                  30-Sep-2022 11:02                7527
function.geoip-region-by-name.php                  30-Sep-2022 11:02                4985
function.geoip-region-name-by-code.php             30-Sep-2022 11:02                7091
function.geoip-setup-custom-directory.php          30-Sep-2022 11:02                4118
function.geoip-time-zone-by-country-and-region.php 30-Sep-2022 11:02                7301
function.get-browser.php                           30-Sep-2022 11:02                7577
function.get-called-class.php                      30-Sep-2022 11:02                4755
function.get-cfg-var.php                           30-Sep-2022 11:02                2685
function.get-class-methods.php                     30-Sep-2022 11:02                7394
function.get-class-vars.php                        30-Sep-2022 11:02                7274
function.get-class.php                             30-Sep-2022 11:02                8359
function.get-current-user.php                      30-Sep-2022 11:02                3152
function.get-debug-type.php                        30-Sep-2022 11:02                9717
function.get-declared-classes.php                  30-Sep-2022 11:02                4940
function.get-declared-interfaces.php               30-Sep-2022 11:02                3849
function.get-declared-traits.php                   30-Sep-2022 11:02                2873
function.get-defined-constants.php                 30-Sep-2022 11:02                8096
function.get-defined-functions.php                 30-Sep-2022 11:02                5689
function.get-defined-vars.php                      30-Sep-2022 11:02                6317
function.get-extension-funcs.php                   30-Sep-2022 11:02                5261
function.get-headers.php                           30-Sep-2022 11:02                8792
function.get-html-translation-table.php            30-Sep-2022 11:02                7200
function.get-include-path.php                      30-Sep-2022 11:02                4306
function.get-included-files.php                    30-Sep-2022 11:02                6187
function.get-loaded-extensions.php                 30-Sep-2022 11:02                5502
function.get-magic-quotes-gpc.php                  30-Sep-2022 11:02                3930
function.get-magic-quotes-runtime.php              30-Sep-2022 11:02                2729
function.get-mangled-object-vars.php               30-Sep-2022 11:02                8281
function.get-meta-tags.php                         30-Sep-2022 11:02                6726
function.get-object-vars.php                       30-Sep-2022 11:02                6821
function.get-parent-class.php                      30-Sep-2022 11:02                7888
function.get-required-files.php                    30-Sep-2022 11:02                1865
function.get-resource-id.php                       30-Sep-2022 11:02                4613
function.get-resource-type.php                     30-Sep-2022 11:02                5284
function.get-resources.php                         30-Sep-2022 11:02                7606
function.getallheaders.php                         30-Sep-2022 11:02                4493
function.getcwd.php                                30-Sep-2022 11:02                4344
function.getdate.php                               30-Sep-2022 11:02                8566
function.getenv.php                                30-Sep-2022 11:02                3227
function.gethostbyaddr.php                         30-Sep-2022 11:02                4156
function.gethostbyname.php                         30-Sep-2022 11:02                4510
function.gethostbynamel.php                        30-Sep-2022 11:02                5028
function.gethostname.php                           30-Sep-2022 11:02                3970
function.getimagesize.php                          30-Sep-2022 11:02               13726
function.getimagesizefromstring.php                30-Sep-2022 11:02                5512
function.getlastmod.php                            30-Sep-2022 11:02                5042
function.getmxrr.php                               30-Sep-2022 11:02                5766
function.getmygid.php                              30-Sep-2022 11:02                3097
function.getmyinode.php                            30-Sep-2022 11:02                2229
function.getmypid.php                              30-Sep-2022 11:02                3453
function.getmyuid.php                              30-Sep-2022 11:02                3079
function.getopt.php                                30-Sep-2022 11:02                4838
function.getprotobyname.php                        30-Sep-2022 11:02                4621
function.getprotobynumber.php                      30-Sep-2022 11:02                3124
function.getrandmax.php                            30-Sep-2022 11:02                2862
function.getrusage.php                             30-Sep-2022 11:02                5045
function.getservbyname.php                         30-Sep-2022 11:02                6415
function.getservbyport.php                         30-Sep-2022 11:02                3578
function.gettext.php                               30-Sep-2022 11:02                4192
function.gettimeofday.php                          30-Sep-2022 11:02                5082
function.gettype.php                               30-Sep-2022 11:02                8788
function.glob.php                                  30-Sep-2022 11:02                8958
function.gmdate.php                                30-Sep-2022 11:02                7038
function.gmmktime.php                              30-Sep-2022 11:02                9964
function.gmp-abs.php                               30-Sep-2022 11:02                4234
function.gmp-add.php                               30-Sep-2022 11:02                4186
function.gmp-and.php                               30-Sep-2022 11:02                4640
function.gmp-binomial.php                          30-Sep-2022 11:02                3629
function.gmp-clrbit.php                            30-Sep-2022 11:02                5685
function.gmp-cmp.php                               30-Sep-2022 11:02                5169
function.gmp-com.php                               30-Sep-2022 11:02                3618
function.gmp-div-q.php                             30-Sep-2022 11:02                9501
function.gmp-div-qr.php                            30-Sep-2022 11:02                6045
function.gmp-div-r.php                             30-Sep-2022 11:02                5369
function.gmp-div.php                               30-Sep-2022 11:02                1699
function.gmp-divexact.php                          30-Sep-2022 11:02                5396
function.gmp-export.php                            30-Sep-2022 11:02                5235
function.gmp-fact.php                              30-Sep-2022 11:02                4743
function.gmp-gcd.php                               30-Sep-2022 11:02                4241
function.gmp-gcdext.php                            30-Sep-2022 11:02                9046
function.gmp-hamdist.php                           30-Sep-2022 11:02                5964
function.gmp-import.php                            30-Sep-2022 11:02                5697
function.gmp-init.php                              30-Sep-2022 11:02                5047
function.gmp-intval.php                            30-Sep-2022 11:02                5001
function.gmp-invert.php                            30-Sep-2022 11:02                4950
function.gmp-jacobi.php                            30-Sep-2022 11:02                4682
function.gmp-kronecker.php                         30-Sep-2022 11:02                3616
function.gmp-lcm.php                               30-Sep-2022 11:02                3479
function.gmp-legendre.php                          30-Sep-2022 11:02                4718
function.gmp-mod.php                               30-Sep-2022 11:02                4325
function.gmp-mul.php                               30-Sep-2022 11:02                4465
function.gmp-neg.php                               30-Sep-2022 11:02                4132
function.gmp-nextprime.php                         30-Sep-2022 11:02                4830
function.gmp-or.php                                30-Sep-2022 11:02                4937
function.gmp-perfect-power.php                     30-Sep-2022 11:02                3025
function.gmp-perfect-square.php                    30-Sep-2022 11:02                5352
function.gmp-popcount.php                          30-Sep-2022 11:02                4609
function.gmp-pow.php                               30-Sep-2022 11:02                5496
function.gmp-powm.php                              30-Sep-2022 11:02                4905
function.gmp-prob-prime.php                        30-Sep-2022 11:02                5399
function.gmp-random-bits.php                       30-Sep-2022 11:02                4540
function.gmp-random-range.php                      30-Sep-2022 11:02                5429
function.gmp-random-seed.php                       30-Sep-2022 11:02                6646
function.gmp-random.php                            30-Sep-2022 11:02                5037
function.gmp-root.php                              30-Sep-2022 11:02                2942
function.gmp-rootrem.php                           30-Sep-2022 11:02                3065
function.gmp-scan0.php                             30-Sep-2022 11:02                5360
function.gmp-scan1.php                             30-Sep-2022 11:02                5372
function.gmp-setbit.php                            30-Sep-2022 11:02               11908
function.gmp-sign.php                              30-Sep-2022 11:02                4403
function.gmp-sqrt.php                              30-Sep-2022 11:02                4717
function.gmp-sqrtrm.php                            30-Sep-2022 11:02                6158
function.gmp-strval.php                            30-Sep-2022 11:02                4369
function.gmp-sub.php                               30-Sep-2022 11:02                4544
function.gmp-testbit.php                           30-Sep-2022 11:02                5521
function.gmp-xor.php                               30-Sep-2022 11:02                5032
function.gmstrftime.php                            30-Sep-2022 11:02                6670
function.gnupg-adddecryptkey.php                   30-Sep-2022 11:02                5080
function.gnupg-addencryptkey.php                   30-Sep-2022 11:02                4670
function.gnupg-addsignkey.php                      30-Sep-2022 11:02                5087
function.gnupg-cleardecryptkeys.php                30-Sep-2022 11:02                4267
function.gnupg-clearencryptkeys.php                30-Sep-2022 11:02                4272
function.gnupg-clearsignkeys.php                   30-Sep-2022 11:02                4214
function.gnupg-decrypt.php                         30-Sep-2022 11:02                5841
function.gnupg-decryptverify.php                   30-Sep-2022 11:02                6949
function.gnupg-deletekey.php                       30-Sep-2022 11:02                4904
function.gnupg-encrypt.php                         30-Sep-2022 11:02                5769
function.gnupg-encryptsign.php                     30-Sep-2022 11:02                6669
function.gnupg-export.php                          30-Sep-2022 11:02                4940
function.gnupg-getengineinfo.php                   30-Sep-2022 11:02                5472
function.gnupg-geterror.php                        30-Sep-2022 11:02                4131
function.gnupg-geterrorinfo.php                    30-Sep-2022 11:02                5615
function.gnupg-getprotocol.php                     30-Sep-2022 11:02                4261
function.gnupg-gettrustlist.php                    30-Sep-2022 11:02                5005
function.gnupg-import.php                          30-Sep-2022 11:02                5194
function.gnupg-init.php                            30-Sep-2022 11:02                7024
function.gnupg-keyinfo.php                         30-Sep-2022 11:02                5126
function.gnupg-listsignatures.php                  30-Sep-2022 11:02                5234
function.gnupg-setarmor.php                        30-Sep-2022 11:02                5509
function.gnupg-seterrormode.php                    30-Sep-2022 11:02                5460
function.gnupg-setsignmode.php                     30-Sep-2022 11:02                5356
function.gnupg-sign.php                            30-Sep-2022 11:02                6011
function.gnupg-verify.php                          30-Sep-2022 11:02                8132
function.grapheme-extract.php                      30-Sep-2022 11:02                8723
function.grapheme-stripos.php                      30-Sep-2022 11:02                8229
function.grapheme-stristr.php                      30-Sep-2022 11:02                7786
function.grapheme-strlen.php                       30-Sep-2022 11:02                5532
function.grapheme-strpos.php                       30-Sep-2022 11:02                7836
function.grapheme-strripos.php                     30-Sep-2022 11:02                7684
function.grapheme-strrpos.php                      30-Sep-2022 11:02                7283
function.grapheme-strstr.php                       30-Sep-2022 11:02                7328
function.grapheme-substr.php                       30-Sep-2022 11:02                7871
function.gregoriantojd.php                         30-Sep-2022 11:02                5731
function.gzclose.php                               30-Sep-2022 11:02                4232
function.gzcompress.php                            30-Sep-2022 11:02                5385
function.gzdecode.php                              30-Sep-2022 11:02                3188
function.gzdeflate.php                             30-Sep-2022 11:02                5250
function.gzencode.php                              30-Sep-2022 11:02                7132
function.gzeof.php                                 30-Sep-2022 11:02                4065
function.gzfile.php                                30-Sep-2022 11:02                4630
function.gzgetc.php                                30-Sep-2022 11:02                4647
function.gzgets.php                                30-Sep-2022 11:02                5453
function.gzgetss.php                               30-Sep-2022 11:02                6503
function.gzinflate.php                             30-Sep-2022 11:02                5201
function.gzopen.php                                30-Sep-2022 11:02                4380
function.gzpassthru.php                            30-Sep-2022 11:02                2251
function.gzputs.php                                30-Sep-2022 11:02                1642
function.gzread.php                                30-Sep-2022 11:02                5948
function.gzrewind.php                              30-Sep-2022 11:02                3187
function.gzseek.php                                30-Sep-2022 11:02                5356
function.gztell.php                                30-Sep-2022 11:02                3329
function.gzuncompress.php                          30-Sep-2022 11:02                2924
function.gzwrite.php                               30-Sep-2022 11:02                5801
function.halt-compiler.php                         30-Sep-2022 11:02                5136
function.hash-algos.php                            30-Sep-2022 11:02                5720
function.hash-copy.php                             30-Sep-2022 11:02                5469
function.hash-equals.php                           30-Sep-2022 11:02                6440
function.hash-file.php                             30-Sep-2022 11:02                7168
function.hash-final.php                            30-Sep-2022 11:02                6089
function.hash-hkdf.php                             30-Sep-2022 11:02                8884
function.hash-hmac-algos.php                       30-Sep-2022 11:02                5246
function.hash-hmac-file.php                        30-Sep-2022 11:02                7166
function.hash-hmac.php                             30-Sep-2022 11:02                6974
function.hash-init.php                             30-Sep-2022 11:02                8259
function.hash-pbkdf2.php                           30-Sep-2022 11:02               12060
function.hash-update-file.php                      30-Sep-2022 11:02                5534
function.hash-update-stream.php                    30-Sep-2022 11:02                7058
function.hash-update.php                           30-Sep-2022 11:02                4289
function.hash.php                                  30-Sep-2022 11:02                6896
function.header-register-callback.php              30-Sep-2022 11:02                6896
function.header-remove.php                         30-Sep-2022 11:02                6047
function.header.php                                30-Sep-2022 11:02               18545
function.headers-list.php                          30-Sep-2022 11:02                6145
function.headers-sent.php                          30-Sep-2022 11:02                8153
function.hebrev.php                                30-Sep-2022 11:02                3227
function.hebrevc.php                               30-Sep-2022 11:02                3317
function.hex2bin.php                               30-Sep-2022 11:02                4788
function.hexdec.php                                30-Sep-2022 11:02                5957
function.highlight-file.php                        30-Sep-2022 11:02                5255
function.highlight-string.php                      30-Sep-2022 11:02                4873
function.hrtime.php                                30-Sep-2022 11:02                4698
function.html-entity-decode.php                    30-Sep-2022 11:02               13884
function.htmlentities.php                          30-Sep-2022 11:02               11394
function.htmlspecialchars-decode.php               30-Sep-2022 11:02                6621
function.htmlspecialchars.php                      30-Sep-2022 11:02                9054
function.http-build-query.php                      30-Sep-2022 11:02               17314
function.http-response-code.php                    30-Sep-2022 11:02                6925
function.hypot.php                                 30-Sep-2022 11:02                2963
function.ibase-add-user.php                        30-Sep-2022 11:02                4130
function.ibase-affected-rows.php                   30-Sep-2022 11:02                3416
function.ibase-backup.php                          30-Sep-2022 11:02               10022
function.ibase-blob-add.php                        30-Sep-2022 11:02                3998
function.ibase-blob-cancel.php                     30-Sep-2022 11:02                3530
function.ibase-blob-close.php                      30-Sep-2022 11:02                3733
function.ibase-blob-create.php                     30-Sep-2022 11:02                3815
function.ibase-blob-echo.php                       30-Sep-2022 11:02                3754
function.ibase-blob-get.php                        30-Sep-2022 11:02                6616
function.ibase-blob-import.php                     30-Sep-2022 11:02                8523
function.ibase-blob-info.php                       30-Sep-2022 11:02                3255
function.ibase-blob-open.php                       30-Sep-2022 11:02                3980
function.ibase-close.php                           30-Sep-2022 11:02                3567
function.ibase-commit-ret.php                      30-Sep-2022 11:02                2970
function.ibase-commit.php                          30-Sep-2022 11:02                2785
function.ibase-connect.php                         30-Sep-2022 11:02               10248
function.ibase-db-info.php                         30-Sep-2022 11:02                2414
function.ibase-delete-user.php                     30-Sep-2022 11:02                3368
function.ibase-drop-db.php                         30-Sep-2022 11:02                3465
function.ibase-errcode.php                         30-Sep-2022 11:02                2409
function.ibase-errmsg.php                          30-Sep-2022 11:02                2413
function.ibase-execute.php                         30-Sep-2022 11:02                7718
function.ibase-fetch-assoc.php                     30-Sep-2022 11:02                4593
function.ibase-fetch-object.php                    30-Sep-2022 11:02                6843
function.ibase-fetch-row.php                       30-Sep-2022 11:02                4390
function.ibase-field-info.php                      30-Sep-2022 11:02                7392
function.ibase-free-event-handler.php              30-Sep-2022 11:02                3390
function.ibase-free-query.php                      30-Sep-2022 11:02                2646
function.ibase-free-result.php                     30-Sep-2022 11:02                2761
function.ibase-gen-id.php                          30-Sep-2022 11:02                2639
function.ibase-maintain-db.php                     30-Sep-2022 11:02                2748
function.ibase-modify-user.php                     30-Sep-2022 11:02                4132
function.ibase-name-result.php                     30-Sep-2022 11:02                5911
function.ibase-num-fields.php                      30-Sep-2022 11:02                6999
function.ibase-num-params.php                      30-Sep-2022 11:02                3413
function.ibase-param-info.php                      30-Sep-2022 11:02                3653
function.ibase-pconnect.php                        30-Sep-2022 11:02                7565
function.ibase-prepare.php                         30-Sep-2022 11:02                3419
function.ibase-query.php                           30-Sep-2022 11:02                7136
function.ibase-restore.php                         30-Sep-2022 11:02               10101
function.ibase-rollback-ret.php                    30-Sep-2022 11:02                3035
function.ibase-rollback.php                        30-Sep-2022 11:02                2857
function.ibase-server-info.php                     30-Sep-2022 11:02               10813
function.ibase-service-attach.php                  30-Sep-2022 11:02               12727
function.ibase-service-detach.php                  30-Sep-2022 11:02                7012
function.ibase-set-event-handler.php               30-Sep-2022 11:02                8361
function.ibase-trans.php                           30-Sep-2022 11:02                5240
function.ibase-wait-event.php                      30-Sep-2022 11:02                4618
function.iconv-get-encoding.php                    30-Sep-2022 11:02                5520
function.iconv-mime-decode-headers.php             30-Sep-2022 11:02               10352
function.iconv-mime-decode.php                     30-Sep-2022 11:02                8144
function.iconv-mime-encode.php                     30-Sep-2022 11:02               11641
function.iconv-set-encoding.php                    30-Sep-2022 11:02                4807
function.iconv-strlen.php                          30-Sep-2022 11:02                4733
function.iconv-strpos.php                          30-Sep-2022 11:02                7023
function.iconv-strrpos.php                         30-Sep-2022 11:02                6311
function.iconv-substr.php                          30-Sep-2022 11:02                7914
function.iconv.php                                 30-Sep-2022 11:02                8657
function.idate.php                                 30-Sep-2022 11:02               10076
function.idn-to-ascii.php                          30-Sep-2022 11:02                6892
function.idn-to-utf8.php                           30-Sep-2022 11:02                6868
function.igbinary-serialize.php                    30-Sep-2022 11:02                9644
function.igbinary-unserialize.php                  30-Sep-2022 11:02                9054
function.ignore-user-abort.php                     30-Sep-2022 11:02                3803
function.image-type-to-extension.php               30-Sep-2022 11:02                5106
function.image-type-to-mime-type.php               30-Sep-2022 11:02                7995
function.image2wbmp.php                            30-Sep-2022 11:02                5645
function.imageaffine.php                           30-Sep-2022 11:02                4322
function.imageaffinematrixconcat.php               30-Sep-2022 11:02                6481
function.imageaffinematrixget.php                  30-Sep-2022 11:02                5940
function.imagealphablending.php                    30-Sep-2022 11:02                7291
function.imageantialias.php                        30-Sep-2022 11:02                2260
function.imagearc.php                              30-Sep-2022 11:02                7263
function.imageavif.php                             30-Sep-2022 11:02                5503
function.imagebmp.php                              30-Sep-2022 11:02                7449
function.imagechar.php                             30-Sep-2022 11:02                6213
function.imagecharup.php                           30-Sep-2022 11:02                6307
function.imagecolorallocate.php                    30-Sep-2022 11:02                6894
function.imagecolorallocatealpha.php               30-Sep-2022 11:02               12944
function.imagecolorat.php                          30-Sep-2022 11:02                6284
function.imagecolorclosest.php                     30-Sep-2022 11:02                3009
function.imagecolorclosestalpha.php                30-Sep-2022 11:02                2857
function.imagecolorclosesthwb.php                  30-Sep-2022 11:02                6280
function.imagecolordeallocate.php                  30-Sep-2022 11:02                3641
function.imagecolorexact.php                       30-Sep-2022 11:02                2785
function.imagecolorexactalpha.php                  30-Sep-2022 11:02                2829
function.imagecolormatch.php                       30-Sep-2022 11:02                2810
function.imagecolorresolve.php                     30-Sep-2022 11:02                2886
function.imagecolorresolvealpha.php                30-Sep-2022 11:02                2901
function.imagecolorset.php                         30-Sep-2022 11:02                8468
function.imagecolorsforindex.php                   30-Sep-2022 11:02                6212
function.imagecolorstotal.php                      30-Sep-2022 11:02                3433
function.imagecolortransparent.php                 30-Sep-2022 11:02                3969
function.imageconvolution.php                      30-Sep-2022 11:02               11690
function.imagecopy.php                             30-Sep-2022 11:02                3172
function.imagecopymerge.php                        30-Sep-2022 11:02                3965
function.imagecopymergegray.php                    30-Sep-2022 11:02                9723
function.imagecopyresampled.php                    30-Sep-2022 11:02               19041
function.imagecopyresized.php                      30-Sep-2022 11:02               13643
function.imagecreate.php                           30-Sep-2022 11:02                7024
function.imagecreatefromavif.php                   30-Sep-2022 11:02                2735
function.imagecreatefrombmp.php                    30-Sep-2022 11:02                5417
function.imagecreatefromgd.php                     30-Sep-2022 11:02                3073
function.imagecreatefromgd2.php                    30-Sep-2022 11:02                3044
function.imagecreatefromgd2part.php                30-Sep-2022 11:02                3280
function.imagecreatefromgif.php                    30-Sep-2022 11:02                9247
function.imagecreatefromjpeg.php                   30-Sep-2022 11:02                9140
function.imagecreatefrompng.php                    30-Sep-2022 11:02                9130
function.imagecreatefromstring.php                 30-Sep-2022 11:02                2091
function.imagecreatefromtga.php                    30-Sep-2022 11:02                3361
function.imagecreatefromwbmp.php                   30-Sep-2022 11:02                8261
function.imagecreatefromwebp.php                   30-Sep-2022 11:02                5574
function.imagecreatefromxbm.php                    30-Sep-2022 11:02                3283
function.imagecreatefromxpm.php                    30-Sep-2022 11:02                3426
function.imagecreatetruecolor.php                  30-Sep-2022 11:02                5230
function.imagecrop.php                             30-Sep-2022 11:02                7559
function.imagecropauto.php                         30-Sep-2022 11:02               10484
function.imagedashedline.php                       30-Sep-2022 11:02                2748
function.imagedestroy.php                          30-Sep-2022 11:02                2663
function.imageellipse.php                          30-Sep-2022 11:02                6703
function.imagefill.php                             30-Sep-2022 11:02                7269
function.imagefilledarc.php                        30-Sep-2022 11:02               18336
function.imagefilledellipse.php                    30-Sep-2022 11:02                6807
function.imagefilledpolygon.php                    30-Sep-2022 11:02                9291
function.imagefilledrectangle.php                  30-Sep-2022 11:02                3082
function.imagefilltoborder.php                     30-Sep-2022 11:02               11069
function.imagefilter.php                           30-Sep-2022 11:02               33628
function.imageflip.php                             30-Sep-2022 11:02                9292
function.imagefontheight.php                       30-Sep-2022 11:02                3185
function.imagefontwidth.php                        30-Sep-2022 11:02                3171
function.imageftbbox.php                           30-Sep-2022 11:02               14329
function.imagefttext.php                           30-Sep-2022 11:02                5915
function.imagegammacorrect.php                     30-Sep-2022 11:02                5646
function.imagegd.php                               30-Sep-2022 11:02                2119
function.imagegd2.php                              30-Sep-2022 11:02                2968
function.imagegetclip.php                          30-Sep-2022 11:02                5885
function.imagegetinterpolation.php                 30-Sep-2022 11:02                3508
function.imagegif.php                              30-Sep-2022 11:02               10656
function.imagegrabscreen.php                       30-Sep-2022 11:02                4660
function.imagegrabwindow.php                       30-Sep-2022 11:02                9625
function.imageinterlace.php                        30-Sep-2022 11:02                3168
function.imageistruecolor.php                      30-Sep-2022 11:02                3284
function.imagejpeg.php                             30-Sep-2022 11:02                5356
function.imagelayereffect.php                      30-Sep-2022 11:02               11413
function.imageline.php                             30-Sep-2022 11:02               13898
function.imageloadfont.php                         30-Sep-2022 11:02                8070
function.imageopenpolygon.php                      30-Sep-2022 11:02               10205
function.imagepalettecopy.php                      30-Sep-2022 11:02                2880
function.imagepalettetotruecolor.php               30-Sep-2022 11:02               10181
function.imagepng.php                              30-Sep-2022 11:02                7950
function.imagepolygon.php                          30-Sep-2022 11:02                6988
function.imagerectangle.php                        30-Sep-2022 11:02                2823
function.imageresolution.php                       30-Sep-2022 11:02                7159
function.imagerotate.php                           30-Sep-2022 11:02                2245
function.imagesavealpha.php                        30-Sep-2022 11:02                2869
function.imagescale.php                            30-Sep-2022 11:02                5993
function.imagesetbrush.php                         30-Sep-2022 11:02                9123
function.imagesetclip.php                          30-Sep-2022 11:02                4750
function.imagesetinterpolation.php                 30-Sep-2022 11:02               10122
function.imagesetpixel.php                         30-Sep-2022 11:02                2788
function.imagesetstyle.php                         30-Sep-2022 11:02               12335
function.imagesetthickness.php                     30-Sep-2022 11:02                3149
function.imagesettile.php                          30-Sep-2022 11:02                8194
function.imagestring.php                           30-Sep-2022 11:02                8654
function.imagestringup.php                         30-Sep-2022 11:02                3045
function.imagesx.php                               30-Sep-2022 11:02                4485
function.imagesy.php                               30-Sep-2022 11:02                4489
function.imagetruecolortopalette.php               30-Sep-2022 11:02                4210
function.imagettfbbox.php                          30-Sep-2022 11:02                5638
function.imagettftext.php                          30-Sep-2022 11:02                9106
function.imagetypes.php                            30-Sep-2022 11:02                3199
function.imagewbmp.php                             30-Sep-2022 11:02                5108
function.imagewebp.php                             30-Sep-2022 11:02                7006
function.imagexbm.php                              30-Sep-2022 11:02               11649
function.imap-8bit.php                             30-Sep-2022 11:02                2979
function.imap-alerts.php                           30-Sep-2022 11:02                3122
function.imap-append.php                           30-Sep-2022 11:02                9833
function.imap-base64.php                           30-Sep-2022 11:02                3371
function.imap-binary.php                           30-Sep-2022 11:02                2930
function.imap-body.php                             30-Sep-2022 11:02                5177
function.imap-bodystruct.php                       30-Sep-2022 11:02                4484
function.imap-check.php                            30-Sep-2022 11:02                5896
function.imap-clearflag-full.php                   30-Sep-2022 11:02                5453
function.imap-close.php                            30-Sep-2022 11:02                4085
function.imap-create.php                           30-Sep-2022 11:02                1740
function.imap-createmailbox.php                    30-Sep-2022 11:02               15556
function.imap-delete.php                           30-Sep-2022 11:02                9643
function.imap-deletemailbox.php                    30-Sep-2022 11:02                4748
function.imap-errors.php                           30-Sep-2022 11:02                3324
function.imap-expunge.php                          30-Sep-2022 11:02                3458
function.imap-fetch-overview.php                   30-Sep-2022 11:02               11212
function.imap-fetchbody.php                        30-Sep-2022 11:02                5751
function.imap-fetchheader.php                      30-Sep-2022 11:02                5435
function.imap-fetchmime.php                        30-Sep-2022 11:02                5955
function.imap-fetchstructure.php                   30-Sep-2022 11:02                9148
function.imap-fetchtext.php                        30-Sep-2022 11:02                1721
function.imap-gc.php                               30-Sep-2022 11:02                4865
function.imap-get-quota.php                        30-Sep-2022 11:02               12645
function.imap-get-quotaroot.php                    30-Sep-2022 11:02                9389
function.imap-getacl.php                           30-Sep-2022 11:02                5676
function.imap-getmailboxes.php                     30-Sep-2022 11:02               12102
function.imap-getsubscribed.php                    30-Sep-2022 11:02                7332
function.imap-header.php                           30-Sep-2022 11:02                1955
function.imap-headerinfo.php                       30-Sep-2022 11:02               11495
function.imap-headers.php                          30-Sep-2022 11:02                3326
function.imap-last-error.php                       30-Sep-2022 11:02                3036
function.imap-list.php                             30-Sep-2022 11:02                8846
function.imap-listmailbox.php                      30-Sep-2022 11:02                1726
function.imap-listscan.php                         30-Sep-2022 11:02                6775
function.imap-listsubscribed.php                   30-Sep-2022 11:02                1747
function.imap-lsub.php                             30-Sep-2022 11:02                5867
function.imap-mail-compose.php                     30-Sep-2022 11:02               14685
function.imap-mail-copy.php                        30-Sep-2022 11:02                5837
function.imap-mail-move.php                        30-Sep-2022 11:02                6284
function.imap-mail.php                             30-Sep-2022 11:02                6535
function.imap-mailboxmsginfo.php                   30-Sep-2022 11:02               10086
function.imap-mime-header-decode.php               30-Sep-2022 11:02                6381
function.imap-msgno.php                            30-Sep-2022 11:02                4048
function.imap-mutf7-to-utf8.php                    30-Sep-2022 11:02                3152
function.imap-num-msg.php                          30-Sep-2022 11:02                3896
function.imap-num-recent.php                       30-Sep-2022 11:02                3781
function.imap-open.php                             30-Sep-2022 11:02               22015
function.imap-ping.php                             30-Sep-2022 11:02                4814
function.imap-qprint.php                           30-Sep-2022 11:02                2976
function.imap-rename.php                           30-Sep-2022 11:02                1743
function.imap-renamemailbox.php                    30-Sep-2022 11:02                5333
function.imap-reopen.php                           30-Sep-2022 11:02                8239
function.imap-rfc822-parse-adrlist.php             30-Sep-2022 11:02                8149
function.imap-rfc822-parse-headers.php             30-Sep-2022 11:02                3590
function.imap-rfc822-write-address.php             30-Sep-2022 11:02                5087
function.imap-savebody.php                         30-Sep-2022 11:02                5928
function.imap-scan.php                             30-Sep-2022 11:02                1708
function.imap-scanmailbox.php                      30-Sep-2022 11:02                1738
function.imap-search.php                           30-Sep-2022 11:02               13268
function.imap-set-quota.php                        30-Sep-2022 11:02                6587
function.imap-setacl.php                           30-Sep-2022 11:02                5162
function.imap-setflag-full.php                     30-Sep-2022 11:02                7755
function.imap-sort.php                             30-Sep-2022 11:02                7393
function.imap-status.php                           30-Sep-2022 11:02               10733
function.imap-subscribe.php                        30-Sep-2022 11:02                4226
function.imap-thread.php                           30-Sep-2022 11:02                7939
function.imap-timeout.php                          30-Sep-2022 11:02                4254
function.imap-uid.php                              30-Sep-2022 11:02                4432
function.imap-undelete.php                         30-Sep-2022 11:02                4768
function.imap-unsubscribe.php                      30-Sep-2022 11:02                4303
function.imap-utf7-decode.php                      30-Sep-2022 11:02                3558
function.imap-utf7-encode.php                      30-Sep-2022 11:02                3153
function.imap-utf8-to-mutf7.php                    30-Sep-2022 11:02                3155
function.imap-utf8.php                             30-Sep-2022 11:02                4130
function.implode.php                               30-Sep-2022 11:02                4430
function.in-array.php                              30-Sep-2022 11:02               11355
function.include-once.php                          30-Sep-2022 11:01                2259
function.include.php                               30-Sep-2022 11:01               21040
function.inet-ntop.php                             30-Sep-2022 11:02                6282
function.inet-pton.php                             30-Sep-2022 11:02                4744
function.inflate-add.php                           30-Sep-2022 11:02                5332
function.inflate-get-read-len.php                  30-Sep-2022 11:02                3222
function.inflate-get-status.php                    30-Sep-2022 11:02                3124
function.inflate-init.php                          30-Sep-2022 11:02                6381
function.ini-alter.php                             30-Sep-2022 11:02                1721
function.ini-get-all.php                           30-Sep-2022 11:02                4872
function.ini-get.php                               30-Sep-2022 11:02                5992
function.ini-restore.php                           30-Sep-2022 11:02                3262
function.ini-set.php                               30-Sep-2022 11:02                4350
function.inotify-add-watch.php                     30-Sep-2022 11:02                3952
function.inotify-init.php                          30-Sep-2022 11:02                9318
function.inotify-queue-len.php                     30-Sep-2022 11:02                3746
function.inotify-read.php                          30-Sep-2022 11:02                4367
function.inotify-rm-watch.php                      30-Sep-2022 11:02                3417
function.intdiv.php                                30-Sep-2022 11:02                6770
function.interface-exists.php                      30-Sep-2022 11:02                4673
function.intl-error-name.php                       30-Sep-2022 11:02                5065
function.intl-get-error-code.php                   30-Sep-2022 11:02                4609
function.intl-get-error-message.php                30-Sep-2022 11:02                4608
function.intl-is-failure.php                       30-Sep-2022 11:02                5499
function.intval.php                                30-Sep-2022 11:02               11439
function.ip2long.php                               30-Sep-2022 11:02                9505
function.iptcembed.php                             30-Sep-2022 11:02                2837
function.iptcparse.php                             30-Sep-2022 11:02                2907
function.is-a.php                                  30-Sep-2022 11:02                6684
function.is-array.php                              30-Sep-2022 11:02                5693
function.is-bool.php                               30-Sep-2022 11:02                5859
function.is-callable.php                           30-Sep-2022 11:02                8597
function.is-countable.php                          30-Sep-2022 11:02                6356
function.is-dir.php                                30-Sep-2022 11:02                6559
function.is-double.php                             30-Sep-2022 11:02                1726
function.is-executable.php                         30-Sep-2022 11:02                5470
function.is-file.php                               30-Sep-2022 11:02                5715
function.is-finite.php                             30-Sep-2022 11:02                3120
function.is-float.php                              30-Sep-2022 11:02                6957
function.is-infinite.php                           30-Sep-2022 11:02                3229
function.is-int.php                                30-Sep-2022 11:02                6610
function.is-integer.php                            30-Sep-2022 11:02                1708
function.is-iterable.php                           30-Sep-2022 11:02                5837
function.is-link.php                               30-Sep-2022 11:02                4055
function.is-long.php                               30-Sep-2022 11:02                1701
function.is-nan.php                                30-Sep-2022 11:02                4503
function.is-null.php                               30-Sep-2022 11:02                4514
function.is-numeric.php                            30-Sep-2022 11:02                4697
function.is-object.php                             30-Sep-2022 11:02                4356
function.is-readable.php                           30-Sep-2022 11:02                6265
function.is-real.php                               30-Sep-2022 11:02                1713
function.is-resource.php                           30-Sep-2022 11:02                5044
function.is-scalar.php                             30-Sep-2022 11:02                7971
function.is-soap-fault.php                         30-Sep-2022 11:02                8279
function.is-string.php                             30-Sep-2022 11:02                5975
function.is-subclass-of.php                        30-Sep-2022 11:02                8372
function.is-tainted.php                            30-Sep-2022 11:02                2252
function.is-uploaded-file.php                      30-Sep-2022 11:02                6638
function.is-writable.php                           30-Sep-2022 11:02                6034
function.is-writeable.php                          30-Sep-2022 11:02                1737
function.isset.php                                 30-Sep-2022 11:02               12226
function.iterator-apply.php                        30-Sep-2022 11:02                6608
function.iterator-count.php                        30-Sep-2022 11:02                2658
function.iterator-to-array.php                     30-Sep-2022 11:02                7253
function.jddayofweek.php                           30-Sep-2022 11:02                3628
function.jdmonthname.php                           30-Sep-2022 11:02                4215
function.jdtofrench.php                            30-Sep-2022 11:02                3223
function.jdtogregorian.php                         30-Sep-2022 11:02                3194
function.jdtojewish.php                            30-Sep-2022 11:02                4238
function.jdtojulian.php                            30-Sep-2022 11:02                3229
function.jdtounix.php                              30-Sep-2022 11:02                3148
function.jewishtojd.php                            30-Sep-2022 11:02                3882
function.join.php                                  30-Sep-2022 11:02                1648
function.jpeg2wbmp.php                             30-Sep-2022 11:02                4123
function.json-decode.php                           30-Sep-2022 11:02                7130
function.json-encode.php                           30-Sep-2022 11:02               25135
function.json-last-error-msg.php                   30-Sep-2022 11:02                2662
function.json-last-error.php                       30-Sep-2022 11:02               11756
function.juliantojd.php                            30-Sep-2022 11:02                4503
function.key-exists.php                            30-Sep-2022 11:02                1711
function.key.php                                   30-Sep-2022 11:02                6039
function.krsort.php                                30-Sep-2022 11:02                6551
function.ksort.php                                 30-Sep-2022 11:02                6820
function.lcfirst.php                               30-Sep-2022 11:02                5616
function.lcg-value.php                             30-Sep-2022 11:02                3278
function.lchgrp.php                                30-Sep-2022 11:02                6202
function.lchown.php                                30-Sep-2022 11:02                6062
function.ldap-8859-to-t61.php                      30-Sep-2022 11:02                3201
function.ldap-add-ext.php                          30-Sep-2022 11:02                5414
function.ldap-add.php                              30-Sep-2022 11:02               10534
function.ldap-bind-ext.php                         30-Sep-2022 11:02                5451
function.ldap-bind.php                             30-Sep-2022 11:02                9947
function.ldap-close.php                            30-Sep-2022 11:02                1691
function.ldap-compare.php                          30-Sep-2022 11:02               10875
function.ldap-connect.php                          30-Sep-2022 11:02                9587
function.ldap-control-paged-result-response.php    30-Sep-2022 11:02                5556
function.ldap-control-paged-result.php             30-Sep-2022 11:02               15686
function.ldap-count-entries.php                    30-Sep-2022 11:02                5850
function.ldap-count-references.php                 30-Sep-2022 11:02                4632
function.ldap-delete-ext.php                       30-Sep-2022 11:02                5018
function.ldap-delete.php                           30-Sep-2022 11:02                4974
function.ldap-dn2ufn.php                           30-Sep-2022 11:02                2555
function.ldap-err2str.php                          30-Sep-2022 11:02                4645
function.ldap-errno.php                            30-Sep-2022 11:02                7827
function.ldap-error.php                            30-Sep-2022 11:02                4454
function.ldap-escape.php                           30-Sep-2022 11:02                6358
function.ldap-exop-passwd.php                      30-Sep-2022 11:02               10677
function.ldap-exop-refresh.php                     30-Sep-2022 11:02                4903
function.ldap-exop-whoami.php                      30-Sep-2022 11:02                3787
function.ldap-exop.php                             30-Sep-2022 11:02               12485
function.ldap-explode-dn.php                       30-Sep-2022 11:02                3409
function.ldap-first-attribute.php                  30-Sep-2022 11:02                5968
function.ldap-first-entry.php                      30-Sep-2022 11:02                5710
function.ldap-first-reference.php                  30-Sep-2022 11:02                2372
function.ldap-free-result.php                      30-Sep-2022 11:02                3916
function.ldap-get-attributes.php                   30-Sep-2022 11:02                8517
function.ldap-get-dn.php                           30-Sep-2022 11:02                4138
function.ldap-get-entries.php                      30-Sep-2022 11:02                5951
function.ldap-get-option.php                       30-Sep-2022 11:02               12713
function.ldap-get-values-len.php                   30-Sep-2022 11:02                5302
function.ldap-get-values.php                       30-Sep-2022 11:02                8859
function.ldap-list.php                             30-Sep-2022 11:02               14445
function.ldap-mod-add.php                          30-Sep-2022 11:02                6433
function.ldap-mod-del.php                          30-Sep-2022 11:02                5998
function.ldap-mod-replace.php                      30-Sep-2022 11:02                6378
function.ldap-mod_add-ext.php                      30-Sep-2022 11:02                5429
function.ldap-mod_del-ext.php                      30-Sep-2022 11:02                5445
function.ldap-mod_replace-ext.php                  30-Sep-2022 11:02                5507
function.ldap-modify-batch.php                     30-Sep-2022 11:02               20698
function.ldap-modify.php                           30-Sep-2022 11:02                2112
function.ldap-next-attribute.php                   30-Sep-2022 11:02                5428
function.ldap-next-entry.php                       30-Sep-2022 11:02                5760
function.ldap-next-reference.php                   30-Sep-2022 11:02                2342
function.ldap-parse-exop.php                       30-Sep-2022 11:02                5556
function.ldap-parse-reference.php                  30-Sep-2022 11:02                2350
function.ldap-parse-result.php                     30-Sep-2022 11:02                9225
function.ldap-read.php                             30-Sep-2022 11:02               11558
function.ldap-rename-ext.php                       30-Sep-2022 11:02                5658
function.ldap-rename.php                           30-Sep-2022 11:02                6657
function.ldap-sasl-bind.php                        30-Sep-2022 11:02                5900
function.ldap-search.php                           30-Sep-2022 11:02               14652
function.ldap-set-option.php                       30-Sep-2022 11:02               15661
function.ldap-set-rebind-proc.php                  30-Sep-2022 11:02                3110
function.ldap-sort.php                             30-Sep-2022 11:02                7456
function.ldap-start-tls.php                        30-Sep-2022 11:02                1979
function.ldap-t61-to-8859.php                      30-Sep-2022 11:02                2044
function.ldap-unbind.php                           30-Sep-2022 11:02                3677
function.levenshtein.php                           30-Sep-2022 11:02                7237
function.libxml-clear-errors.php                   30-Sep-2022 11:02                2695
function.libxml-disable-entity-loader.php          30-Sep-2022 11:02                4674
function.libxml-get-errors.php                     30-Sep-2022 11:02               11675
function.libxml-get-last-error.php                 30-Sep-2022 11:02                2861
function.libxml-set-external-entity-loader.php     30-Sep-2022 11:02                9960
function.libxml-set-streams-context.php            30-Sep-2022 11:02                5228
function.libxml-use-internal-errors.php            30-Sep-2022 11:02                5934
function.link.php                                  30-Sep-2022 11:02                5763
function.linkinfo.php                              30-Sep-2022 11:02                4567
function.list.php                                  30-Sep-2022 11:02               13880
function.localeconv.php                            30-Sep-2022 11:02               14082
function.localtime.php                             30-Sep-2022 11:02                8341
function.log.php                                   30-Sep-2022 11:02                3613
function.log10.php                                 30-Sep-2022 11:02                2616
function.log1p.php                                 30-Sep-2022 11:02                4191
function.long2ip.php                               30-Sep-2022 11:02                4101
function.lstat.php                                 30-Sep-2022 11:02                6175
function.ltrim.php                                 30-Sep-2022 11:02                9689
function.lzf-compress.php                          30-Sep-2022 11:02                2847
function.lzf-decompress.php                        30-Sep-2022 11:02                2912
function.lzf-optimized-for.php                     30-Sep-2022 11:02                2005
function.mail.php                                  30-Sep-2022 11:02               27282
function.mailparse-determine-best-xfer-encoding..> 30-Sep-2022 11:02                4197
function.mailparse-msg-create.php                  30-Sep-2022 11:02                3346
function.mailparse-msg-extract-part-file.php       30-Sep-2022 11:02                5052
function.mailparse-msg-extract-part.php            30-Sep-2022 11:02                4014
function.mailparse-msg-extract-whole-part-file.php 30-Sep-2022 11:02                4002
function.mailparse-msg-free.php                    30-Sep-2022 11:02                3453
function.mailparse-msg-get-part-data.php           30-Sep-2022 11:02                2464
function.mailparse-msg-get-part.php                30-Sep-2022 11:02                2685
function.mailparse-msg-get-structure.php           30-Sep-2022 11:02                2484
function.mailparse-msg-parse-file.php              30-Sep-2022 11:02                4107
function.mailparse-msg-parse.php                   30-Sep-2022 11:02                3282
function.mailparse-rfc822-parse-addresses.php      30-Sep-2022 11:02                5468
function.mailparse-stream-encode.php               30-Sep-2022 11:02                5666
function.mailparse-uudecode-all.php                30-Sep-2022 11:02                6911
function.max.php                                   30-Sep-2022 11:02               13221
function.mb-check-encoding.php                     30-Sep-2022 11:02                4700
function.mb-chr.php                                30-Sep-2022 11:02                6795
function.mb-convert-case.php                       30-Sep-2022 11:02               11239
function.mb-convert-encoding.php                   30-Sep-2022 11:02               10466
function.mb-convert-kana.php                       30-Sep-2022 11:02                9111
function.mb-convert-variables.php                  30-Sep-2022 11:02                6390
function.mb-decode-mimeheader.php                  30-Sep-2022 11:02                3013
function.mb-decode-numericentity.php               30-Sep-2022 11:02               36140
function.mb-detect-encoding.php                    30-Sep-2022 11:02               15434
function.mb-detect-order.php                       30-Sep-2022 11:02                8615
function.mb-encode-mimeheader.php                  30-Sep-2022 11:02                9417
function.mb-encode-numericentity.php               30-Sep-2022 11:02               13116
function.mb-encoding-aliases.php                   30-Sep-2022 11:02                5639
function.mb-ereg-match.php                         30-Sep-2022 11:02                5209
function.mb-ereg-replace-callback.php              30-Sep-2022 11:02               12917
function.mb-ereg-replace.php                       30-Sep-2022 11:02                6654
function.mb-ereg-search-getpos.php                 30-Sep-2022 11:02                3883
function.mb-ereg-search-getregs.php                30-Sep-2022 11:02                4226
function.mb-ereg-search-init.php                   30-Sep-2022 11:02                5725
function.mb-ereg-search-pos.php                    30-Sep-2022 11:02                5609
function.mb-ereg-search-regs.php                   30-Sep-2022 11:02                5361
function.mb-ereg-search-setpos.php                 30-Sep-2022 11:02                4401
function.mb-ereg-search.php                        30-Sep-2022 11:02                5274
function.mb-ereg.php                               30-Sep-2022 11:02                6109
function.mb-eregi-replace.php                      30-Sep-2022 11:02                6538
function.mb-eregi.php                              30-Sep-2022 11:02                6153
function.mb-get-info.php                           30-Sep-2022 11:02                5889
function.mb-http-input.php                         30-Sep-2022 11:02                4690
function.mb-http-output.php                        30-Sep-2022 11:02                4659
function.mb-internal-encoding.php                  30-Sep-2022 11:02                6688
function.mb-language.php                           30-Sep-2022 11:02                6145
function.mb-list-encodings.php                     30-Sep-2022 11:02                5013
function.mb-ord.php                                30-Sep-2022 11:02                6419
function.mb-output-handler.php                     30-Sep-2022 11:02                5054
function.mb-parse-str.php                          30-Sep-2022 11:02                4333
function.mb-preferred-mime-name.php                30-Sep-2022 11:02                4285
function.mb-regex-encoding.php                     30-Sep-2022 11:02                4213
function.mb-regex-set-options.php                  30-Sep-2022 11:02                6940
function.mb-scrub.php                              30-Sep-2022 11:02                3154
function.mb-send-mail.php                          30-Sep-2022 11:02                9219
function.mb-split.php                              30-Sep-2022 11:02                4417
function.mb-str-split.php                          30-Sep-2022 11:02                4944
function.mb-strcut.php                             30-Sep-2022 11:02                7101
function.mb-strimwidth.php                         30-Sep-2022 11:02                7043
function.mb-stripos.php                            30-Sep-2022 11:02                6077
function.mb-stristr.php                            30-Sep-2022 11:02                6211
function.mb-strlen.php                             30-Sep-2022 11:02                4690
function.mb-strpos.php                             30-Sep-2022 11:02                5886
function.mb-strrchr.php                            30-Sep-2022 11:02                6028
function.mb-strrichr.php                           30-Sep-2022 11:02                6055
function.mb-strripos.php                           30-Sep-2022 11:02                6028
function.mb-strrpos.php                            30-Sep-2022 11:02                6182
function.mb-strstr.php                             30-Sep-2022 11:02                6016
function.mb-strtolower.php                         30-Sep-2022 11:02                7120
function.mb-strtoupper.php                         30-Sep-2022 11:02                7159
function.mb-strwidth.php                           30-Sep-2022 11:02                8843
function.mb-substitute-character.php               30-Sep-2022 11:02                6709
function.mb-substr-count.php                       30-Sep-2022 11:02                5660
function.mb-substr.php                             30-Sep-2022 11:02                6093
function.mcrypt-create-iv.php                      30-Sep-2022 11:02                6545
function.mcrypt-decrypt.php                        30-Sep-2022 11:02                5447
function.mcrypt-enc-get-algorithms-name.php        30-Sep-2022 11:02                5311
function.mcrypt-enc-get-block-size.php             30-Sep-2022 11:02                2946
function.mcrypt-enc-get-iv-size.php                30-Sep-2022 11:02                3071
function.mcrypt-enc-get-key-size.php               30-Sep-2022 11:02                2950
function.mcrypt-enc-get-modes-name.php             30-Sep-2022 11:02                5223
function.mcrypt-enc-get-supported-key-sizes.php    30-Sep-2022 11:02                4992
function.mcrypt-enc-is-block-algorithm-mode.php    30-Sep-2022 11:02                3313
function.mcrypt-enc-is-block-algorithm.php         30-Sep-2022 11:02                3137
function.mcrypt-enc-is-block-mode.php              30-Sep-2022 11:02                3141
function.mcrypt-enc-self-test.php                  30-Sep-2022 11:02                2974
function.mcrypt-encrypt.php                        30-Sep-2022 11:02               15748
function.mcrypt-generic-deinit.php                 30-Sep-2022 11:02                3903
function.mcrypt-generic-init.php                   30-Sep-2022 11:02                5026
function.mcrypt-generic.php                        30-Sep-2022 11:02                5800
function.mcrypt-get-block-size.php                 30-Sep-2022 11:02                6384
function.mcrypt-get-cipher-name.php                30-Sep-2022 11:02                4783
function.mcrypt-get-iv-size.php                    30-Sep-2022 11:02                6427
function.mcrypt-get-key-size.php                   30-Sep-2022 11:02                6525
function.mcrypt-list-algorithms.php                30-Sep-2022 11:02                4714
function.mcrypt-list-modes.php                     30-Sep-2022 11:02                4742
function.mcrypt-module-close.php                   30-Sep-2022 11:02                3324
function.mcrypt-module-get-algo-block-size.php     30-Sep-2022 11:02                3410
function.mcrypt-module-get-algo-key-size.php       30-Sep-2022 11:02                3477
function.mcrypt-module-get-supported-key-sizes.php 30-Sep-2022 11:02                4564
function.mcrypt-module-is-block-algorithm-mode.php 30-Sep-2022 11:02                3990
function.mcrypt-module-is-block-algorithm.php      30-Sep-2022 11:02                3737
function.mcrypt-module-is-block-mode.php           30-Sep-2022 11:02                4006
function.mcrypt-module-open.php                    30-Sep-2022 11:02               14866
function.mcrypt-module-self-test.php               30-Sep-2022 11:02                4831
function.md5-file.php                              30-Sep-2022 11:02                4523
function.md5.php                                   30-Sep-2022 11:02                5383
function.mdecrypt-generic.php                      30-Sep-2022 11:02               11900
function.memcache-debug.php                        30-Sep-2022 11:02                3226
function.memory-get-peak-usage.php                 30-Sep-2022 11:02                3510
function.memory-get-usage.php                      30-Sep-2022 11:02                6093
function.memory-reset-peak-usage.php               30-Sep-2022 11:02                4997
function.metaphone.php                             30-Sep-2022 11:02                2537
function.method-exists.php                         30-Sep-2022 11:02                5984
function.mhash-count.php                           30-Sep-2022 11:02                3770
function.mhash-get-block-size.php                  30-Sep-2022 11:02                3442
function.mhash-get-hash-name.php                   30-Sep-2022 11:02                3329
function.mhash-keygen-s2k.php                      30-Sep-2022 11:02                4437
function.mhash.php                                 30-Sep-2022 11:02                3362
function.microtime.php                             30-Sep-2022 11:02                7896
function.mime-content-type.php                     30-Sep-2022 11:02                4376
function.min.php                                   30-Sep-2022 11:02               13854
function.mkdir.php                                 30-Sep-2022 11:02                6887
function.mktime.php                                30-Sep-2022 11:02               21566
function.money-format.php                          30-Sep-2022 11:02               19498
function.mongodb.bson-fromjson.php                 30-Sep-2022 11:02                5858
function.mongodb.bson-fromphp.php                  30-Sep-2022 11:02                5829
function.mongodb.bson-tocanonicalextendedjson.php  30-Sep-2022 11:02               16229
function.mongodb.bson-tojson.php                   30-Sep-2022 11:02               17713
function.mongodb.bson-tophp.php                    30-Sep-2022 11:02                8738
function.mongodb.bson-torelaxedextendedjson.php    30-Sep-2022 11:02               15928
function.mongodb.driver.monitoring.addsubscribe..> 30-Sep-2022 11:02                5153
function.mongodb.driver.monitoring.removesubscr..> 30-Sep-2022 11:02                4998
function.move-uploaded-file.php                    30-Sep-2022 11:02                5421
function.mqseries-back.php                         30-Sep-2022 11:02                6486
function.mqseries-begin.php                        30-Sep-2022 11:02                7948
function.mqseries-close.php                        30-Sep-2022 11:02                6558
function.mqseries-cmit.php                         30-Sep-2022 11:02                6421
function.mqseries-conn.php                         30-Sep-2022 11:02                5946
function.mqseries-connx.php                        30-Sep-2022 11:02               14379
function.mqseries-disc.php                         30-Sep-2022 11:02                5674
function.mqseries-get.php                          30-Sep-2022 11:02               13160
function.mqseries-inq.php                          30-Sep-2022 11:02                9199
function.mqseries-open.php                         30-Sep-2022 11:02                7670
function.mqseries-put.php                          30-Sep-2022 11:02               14137
function.mqseries-put1.php                         30-Sep-2022 11:02                5931
function.mqseries-set.php                          30-Sep-2022 11:02                5668
function.mqseries-strerror.php                     30-Sep-2022 11:02                4318
function.msg-get-queue.php                         30-Sep-2022 11:02                5471
function.msg-queue-exists.php                      30-Sep-2022 11:02                3250
function.msg-receive.php                           30-Sep-2022 11:02               10532
function.msg-remove-queue.php                      30-Sep-2022 11:02                4451
function.msg-send.php                              30-Sep-2022 11:02                8314
function.msg-set-queue.php                         30-Sep-2022 11:02                5055
function.msg-stat-queue.php                        30-Sep-2022 11:02                6507
function.mt-getrandmax.php                         30-Sep-2022 11:02                5299
function.mt-rand.php                               30-Sep-2022 11:02                7549
function.mt-srand.php                              30-Sep-2022 11:02                6304
function.mysql-affected-rows.php                   30-Sep-2022 11:02               12359
function.mysql-client-encoding.php                 30-Sep-2022 11:02                5243
function.mysql-close.php                           30-Sep-2022 11:02                7175
function.mysql-connect.php                         30-Sep-2022 11:02               15082
function.mysql-create-db.php                       30-Sep-2022 11:02                8371
function.mysql-data-seek.php                       30-Sep-2022 11:02               12327
function.mysql-db-name.php                         30-Sep-2022 11:02                8426
function.mysql-db-query.php                        30-Sep-2022 11:02                8977
function.mysql-drop-db.php                         30-Sep-2022 11:02                7659
function.mysql-errno.php                           30-Sep-2022 11:02                8172
function.mysql-error.php                           30-Sep-2022 11:02                8083
function.mysql-escape-string.php                   30-Sep-2022 11:02                5895
function.mysql-fetch-array.php                     30-Sep-2022 11:02               14765
function.mysql-fetch-assoc.php                     30-Sep-2022 11:02               12114
function.mysql-fetch-field.php                     30-Sep-2022 11:02               12604
function.mysql-fetch-lengths.php                   30-Sep-2022 11:02                7456
function.mysql-fetch-object.php                    30-Sep-2022 11:02               11612
function.mysql-fetch-row.php                       30-Sep-2022 11:02                7668
function.mysql-field-flags.php                     30-Sep-2022 11:02                6858
function.mysql-field-len.php                       30-Sep-2022 11:02                6832
function.mysql-field-name.php                      30-Sep-2022 11:02                9018
function.mysql-field-seek.php                      30-Sep-2022 11:02                4790
function.mysql-field-table.php                     30-Sep-2022 11:02                7705
function.mysql-field-type.php                      30-Sep-2022 11:02               11917
function.mysql-free-result.php                     30-Sep-2022 11:02                6867
function.mysql-get-client-info.php                 30-Sep-2022 11:02                4853
function.mysql-get-host-info.php                   30-Sep-2022 11:02                6673
function.mysql-get-proto-info.php                  30-Sep-2022 11:02                6416
function.mysql-get-server-info.php                 30-Sep-2022 11:02                6786
function.mysql-info.php                            30-Sep-2022 11:02                6128
function.mysql-insert-id.php                       30-Sep-2022 11:02                8181
function.mysql-list-dbs.php                        30-Sep-2022 11:02                8724
function.mysql-list-fields.php                     30-Sep-2022 11:02                8745
function.mysql-list-processes.php                  30-Sep-2022 11:02                7327
function.mysql-list-tables.php                     30-Sep-2022 11:02                8241
function.mysql-num-fields.php                      30-Sep-2022 11:02                6523
function.mysql-num-rows.php                        30-Sep-2022 11:02                8014
function.mysql-pconnect.php                        30-Sep-2022 11:02                7153
function.mysql-ping.php                            30-Sep-2022 11:02                8007
function.mysql-query.php                           30-Sep-2022 11:02               13588
function.mysql-real-escape-string.php              30-Sep-2022 11:02                5377
function.mysql-result.php                          30-Sep-2022 11:02                6317
function.mysql-select-db.php                       30-Sep-2022 11:02                5501
function.mysql-set-charset.php                     30-Sep-2022 11:02                5570
function.mysql-stat.php                            30-Sep-2022 11:02                4264
function.mysql-tablename.php                       30-Sep-2022 11:02                5039
function.mysql-thread-id.php                       30-Sep-2022 11:02                4369
function.mysql-unbuffered-query.php                30-Sep-2022 11:02                3792
function.mysql-xdevapi-expression.php              30-Sep-2022 11:02                4804
function.mysql-xdevapi-getsession.php              30-Sep-2022 11:02               13199
function.mysqli-connect.php                        30-Sep-2022 11:02                2296
function.mysqli-escape-string.php                  30-Sep-2022 11:02                2321
function.mysqli-execute.php                        30-Sep-2022 11:02                2500
function.mysqli-get-client-stats.php               30-Sep-2022 11:02                8275
function.mysqli-get-links-stats.php                30-Sep-2022 11:02                3167
function.mysqli-report.php                         30-Sep-2022 11:02                1737
function.mysqli-set-opt.php                        30-Sep-2022 11:02                1824
function.natcasesort.php                           30-Sep-2022 11:02                6888
function.natsort.php                               30-Sep-2022 11:02                5193
function.net-get-interfaces.php                    30-Sep-2022 11:02                4487
function.next.php                                  30-Sep-2022 11:02                7913
function.ngettext.php                              30-Sep-2022 11:02                5502
function.nl-langinfo.php                           30-Sep-2022 11:02                1994
function.nl2br.php                                 30-Sep-2022 11:02                4421
function.number-format.php                         30-Sep-2022 11:02                7363
function.oauth-get-sbs.php                         30-Sep-2022 11:02                2931
function.oauth-urlencode.php                       30-Sep-2022 11:02                2470
function.ob-clean.php                              30-Sep-2022 11:02                2988
function.ob-end-clean.php                          30-Sep-2022 11:02                4099
function.ob-end-flush.php                          30-Sep-2022 11:02                4597
function.ob-flush.php                              30-Sep-2022 11:02                3591
function.ob-get-clean.php                          30-Sep-2022 11:02                4019
function.ob-get-contents.php                       30-Sep-2022 11:02                4417
function.ob-get-flush.php                          30-Sep-2022 11:02                5724
function.ob-get-length.php                         30-Sep-2022 11:02                4397
function.ob-get-level.php                          30-Sep-2022 11:02                2170
function.ob-get-status.php                         30-Sep-2022 11:02                2540
function.ob-gzhandler.php                          30-Sep-2022 11:02                4590
function.ob-iconv-handler.php                      30-Sep-2022 11:02                5034
function.ob-implicit-flush.php                     30-Sep-2022 11:02                3093
function.ob-list-handlers.php                      30-Sep-2022 11:02                5896
function.ob-start.php                              30-Sep-2022 11:02               19469
function.ob-tidyhandler.php                        30-Sep-2022 11:02                4247
function.oci-bind-array-by-name.php                30-Sep-2022 11:02               13861
function.oci-bind-by-name.php                      30-Sep-2022 11:02               84191
function.oci-cancel.php                            30-Sep-2022 11:02                2481
function.oci-client-version.php                    30-Sep-2022 11:02                3990
function.oci-close.php                             30-Sep-2022 11:02               20393
function.oci-commit.php                            30-Sep-2022 11:02               11450
function.oci-connect.php                           30-Sep-2022 11:02               38283
function.oci-define-by-name.php                    30-Sep-2022 11:02               25610
function.oci-error.php                             30-Sep-2022 11:02               11907
function.oci-execute.php                           30-Sep-2022 11:02               21977
function.oci-fetch-all.php                         30-Sep-2022 11:02               26866
function.oci-fetch-array.php                       30-Sep-2022 11:02               71471
function.oci-fetch-assoc.php                       30-Sep-2022 11:02                8833
function.oci-fetch-object.php                      30-Sep-2022 11:02               19710
function.oci-fetch-row.php                         30-Sep-2022 11:02                8776
function.oci-fetch.php                             30-Sep-2022 11:02               14137
function.oci-field-is-null.php                     30-Sep-2022 11:02                8507
function.oci-field-name.php                        30-Sep-2022 11:02               11016
function.oci-field-precision.php                   30-Sep-2022 11:02                9666
function.oci-field-scale.php                       30-Sep-2022 11:02                9628
function.oci-field-size.php                        30-Sep-2022 11:02               11730
function.oci-field-type-raw.php                    30-Sep-2022 11:02                8781
function.oci-field-type.php                        30-Sep-2022 11:02               11969
function.oci-free-descriptor.php                   30-Sep-2022 11:02                3389
function.oci-free-statement.php                    30-Sep-2022 11:02                2761
function.oci-get-implicit-resultset.php            30-Sep-2022 11:02               32390
function.oci-internal-debug.php                    30-Sep-2022 11:02                3621
function.oci-lob-copy.php                          30-Sep-2022 11:02                4303
function.oci-lob-is-equal.php                      30-Sep-2022 11:02                3128
function.oci-new-collection.php                    30-Sep-2022 11:02                5197
function.oci-new-connect.php                       30-Sep-2022 11:02               16444
function.oci-new-cursor.php                        30-Sep-2022 11:02                8571
function.oci-new-descriptor.php                    30-Sep-2022 11:02               21322
function.oci-num-fields.php                        30-Sep-2022 11:02                7741
function.oci-num-rows.php                          30-Sep-2022 11:02                8489
function.oci-parse.php                             30-Sep-2022 11:02               13204
function.oci-password-change.php                   30-Sep-2022 11:02               14244
function.oci-pconnect.php                          30-Sep-2022 11:02               14410
function.oci-register-taf-callback.php             30-Sep-2022 11:02                5322
function.oci-result.php                            30-Sep-2022 11:02                9405
function.oci-rollback.php                          30-Sep-2022 11:02               15033
function.oci-server-version.php                    30-Sep-2022 11:02                5240
function.oci-set-action.php                        30-Sep-2022 11:02                8323
function.oci-set-call-timout.php                   30-Sep-2022 11:02                5736
function.oci-set-client-identifier.php             30-Sep-2022 11:02                8108
function.oci-set-client-info.php                   30-Sep-2022 11:02                8260
function.oci-set-db-operation.php                  30-Sep-2022 11:02                7697
function.oci-set-edition.php                       30-Sep-2022 11:02                9796
function.oci-set-module-name.php                   30-Sep-2022 11:02                8379
function.oci-set-prefetch-lob.php                  30-Sep-2022 11:02                8907
function.oci-set-prefetch.php                      30-Sep-2022 11:02               22884
function.oci-statement-type.php                    30-Sep-2022 11:02                7090
function.oci-unregister-taf-callback.php           30-Sep-2022 11:02                3438
function.ocibindbyname.php                         30-Sep-2022 11:02                2005
function.ocicancel.php                             30-Sep-2022 11:02                1947
function.ocicloselob.php                           30-Sep-2022 11:02                1886
function.ocicollappend.php                         30-Sep-2022 11:02                1935
function.ocicollassign.php                         30-Sep-2022 11:02                1940
function.ocicollassignelem.php                     30-Sep-2022 11:02                1977
function.ocicollgetelem.php                        30-Sep-2022 11:02                1950
function.ocicollmax.php                            30-Sep-2022 11:02                1910
function.ocicollsize.php                           30-Sep-2022 11:02                1911
function.ocicolltrim.php                           30-Sep-2022 11:02                1921
function.ocicolumnisnull.php                       30-Sep-2022 11:02                2017
function.ocicolumnname.php                         30-Sep-2022 11:02                2009
function.ocicolumnprecision.php                    30-Sep-2022 11:02                2052
function.ocicolumnscale.php                        30-Sep-2022 11:02                2016
function.ocicolumnsize.php                         30-Sep-2022 11:02                1997
function.ocicolumntype.php                         30-Sep-2022 11:02                2001
function.ocicolumntyperaw.php                      30-Sep-2022 11:02                2024
function.ocicommit.php                             30-Sep-2022 11:02                1961
function.ocidefinebyname.php                       30-Sep-2022 11:02                2007
function.ocierror.php                              30-Sep-2022 11:02                1938
function.ociexecute.php                            30-Sep-2022 11:02                1942
function.ocifetch.php                              30-Sep-2022 11:02                1932
function.ocifetchinto.php                          30-Sep-2022 11:02                2668
function.ocifetchstatement.php                     30-Sep-2022 11:02                2025
function.ocifreecollection.php                     30-Sep-2022 11:02                1971
function.ocifreecursor.php                         30-Sep-2022 11:02                2015
function.ocifreedesc.php                           30-Sep-2022 11:02                1901
function.ocifreestatement.php                      30-Sep-2022 11:02                2034
function.ociinternaldebug.php                      30-Sep-2022 11:02                2048
function.ociloadlob.php                            30-Sep-2022 11:02                1886
function.ocilogoff.php                             30-Sep-2022 11:02                1931
function.ocilogon.php                              30-Sep-2022 11:02                1946
function.ocinewcollection.php                      30-Sep-2022 11:02                2032
function.ocinewcursor.php                          30-Sep-2022 11:02                2000
function.ocinewdescriptor.php                      30-Sep-2022 11:02                2022
function.ocinlogon.php                             30-Sep-2022 11:02                1971
function.ocinumcols.php                            30-Sep-2022 11:02                1956
function.ociparse.php                              30-Sep-2022 11:02                1926
function.ociplogon.php                             30-Sep-2022 11:02                1941
function.ociresult.php                             30-Sep-2022 11:02                1939
function.ocirollback.php                           30-Sep-2022 11:02                1961
function.ocirowcount.php                           30-Sep-2022 11:02                1963
function.ocisavelob.php                            30-Sep-2022 11:02                1886
function.ocisavelobfile.php                        30-Sep-2022 11:02                1920
function.ociserverversion.php                      30-Sep-2022 11:02                2036
function.ocisetprefetch.php                        30-Sep-2022 11:02                2022
function.ocistatementtype.php                      30-Sep-2022 11:02                2042
function.ociwritelobtofile.php                     30-Sep-2022 11:02                1961
function.ociwritetemporarylob.php                  30-Sep-2022 11:02                2048
function.octdec.php                                30-Sep-2022 11:02                4968
function.odbc-autocommit.php                       30-Sep-2022 11:02                4093
function.odbc-binmode.php                          30-Sep-2022 11:02                5832
function.odbc-close-all.php                        30-Sep-2022 11:02                2373
function.odbc-close.php                            30-Sep-2022 11:02                2712
function.odbc-columnprivileges.php                 30-Sep-2022 11:02                5050
function.odbc-columns.php                          30-Sep-2022 11:02                5620
function.odbc-commit.php                           30-Sep-2022 11:02                2414
function.odbc-connect.php                          30-Sep-2022 11:02                4200
function.odbc-cursor.php                           30-Sep-2022 11:02                2333
function.odbc-data-source.php                      30-Sep-2022 11:02                3071
function.odbc-do.php                               30-Sep-2022 11:02                1661
function.odbc-error.php                            30-Sep-2022 11:02                3348
function.odbc-errormsg.php                         30-Sep-2022 11:02                3416
function.odbc-exec.php                             30-Sep-2022 11:02                3506
function.odbc-execute.php                          30-Sep-2022 11:02                6881
function.odbc-fetch-array.php                      30-Sep-2022 11:02                3919
function.odbc-fetch-into.php                       30-Sep-2022 11:02                8527
function.odbc-fetch-object.php                     30-Sep-2022 11:02                3919
function.odbc-fetch-row.php                        30-Sep-2022 11:02                4089
function.odbc-field-len.php                        30-Sep-2022 11:02                3220
function.odbc-field-name.php                       30-Sep-2022 11:02                2769
function.odbc-field-num.php                        30-Sep-2022 11:02                2782
function.odbc-field-precision.php                  30-Sep-2022 11:02                2234
function.odbc-field-scale.php                      30-Sep-2022 11:02                2801
function.odbc-field-type.php                       30-Sep-2022 11:02                2771
function.odbc-foreignkeys.php                      30-Sep-2022 11:02                5329
function.odbc-free-result.php                      30-Sep-2022 11:02                3281
function.odbc-gettypeinfo.php                      30-Sep-2022 11:02                3746
function.odbc-longreadlen.php                      30-Sep-2022 11:02                3288
function.odbc-next-result.php                      30-Sep-2022 11:02                9053
function.odbc-num-fields.php                       30-Sep-2022 11:02                2508
function.odbc-num-rows.php                         30-Sep-2022 11:02                3166
function.odbc-pconnect.php                         30-Sep-2022 11:02                3564
function.odbc-prepare.php                          30-Sep-2022 11:02                6179
function.odbc-primarykeys.php                      30-Sep-2022 11:02                3876
function.odbc-procedurecolumns.php                 30-Sep-2022 11:02                4287
function.odbc-procedures.php                       30-Sep-2022 11:02                3551
function.odbc-result-all.php                       30-Sep-2022 11:02                2898
function.odbc-result.php                           30-Sep-2022 11:02                4462
function.odbc-rollback.php                         30-Sep-2022 11:02                2429
function.odbc-setoption.php                        30-Sep-2022 11:02                6682
function.odbc-specialcolumns.php                   30-Sep-2022 11:02                4345
function.odbc-statistics.php                       30-Sep-2022 11:02                3974
function.odbc-tableprivileges.php                  30-Sep-2022 11:02                3588
function.odbc-tables.php                           30-Sep-2022 11:02                6275
function.opcache-compile-file.php                  30-Sep-2022 11:02                3603
function.opcache-get-configuration.php             30-Sep-2022 11:02                3210
function.opcache-get-status.php                    30-Sep-2022 11:02                3600
function.opcache-invalidate.php                    30-Sep-2022 11:02                3986
function.opcache-is-script-cached.php              30-Sep-2022 11:02                3235
function.opcache-reset.php                         30-Sep-2022 11:02                2896
function.openal-buffer-create.php                  30-Sep-2022 11:02                2798
function.openal-buffer-data.php                    30-Sep-2022 11:02                4400
function.openal-buffer-destroy.php                 30-Sep-2022 11:02                2990
function.openal-buffer-get.php                     30-Sep-2022 11:02                3538
function.openal-buffer-loadwav.php                 30-Sep-2022 11:02                3507
function.openal-context-create.php                 30-Sep-2022 11:02                3244
function.openal-context-current.php                30-Sep-2022 11:02                3045
function.openal-context-destroy.php                30-Sep-2022 11:02                3031
function.openal-context-process.php                30-Sep-2022 11:02                3449
function.openal-context-suspend.php                30-Sep-2022 11:02                3443
function.openal-device-close.php                   30-Sep-2022 11:02                2997
function.openal-device-open.php                    30-Sep-2022 11:02                3241
function.openal-listener-get.php                   30-Sep-2022 11:02                3153
function.openal-listener-set.php                   30-Sep-2022 11:02                3454
function.openal-source-create.php                  30-Sep-2022 11:02                2994
function.openal-source-destroy.php                 30-Sep-2022 11:02                2998
function.openal-source-get.php                     30-Sep-2022 11:02                4649
function.openal-source-pause.php                   30-Sep-2022 11:02                3329
function.openal-source-play.php                    30-Sep-2022 11:02                3328
function.openal-source-rewind.php                  30-Sep-2022 11:02                3338
function.openal-source-set.php                     30-Sep-2022 11:02                5181
function.openal-source-stop.php                    30-Sep-2022 11:02                3310
function.openal-stream.php                         30-Sep-2022 11:02                3922
function.opendir.php                               30-Sep-2022 11:02                8207
function.openlog.php                               30-Sep-2022 11:02                8396
function.openssl-cipher-iv-length.php              30-Sep-2022 11:02                4291
function.openssl-cipher-key-length.php             30-Sep-2022 11:02                4154
function.openssl-cms-decrypt.php                   30-Sep-2022 11:02                4579
function.openssl-cms-encrypt.php                   30-Sep-2022 11:02                5573
function.openssl-cms-read.php                      30-Sep-2022 11:02                2973
function.openssl-cms-sign.php                      30-Sep-2022 11:02                7249
function.openssl-cms-verify.php                    30-Sep-2022 11:02                6109
function.openssl-csr-export-to-file.php            30-Sep-2022 11:02                8255
function.openssl-csr-export.php                    30-Sep-2022 11:02                8036
function.openssl-csr-get-public-key.php            30-Sep-2022 11:02                8788
function.openssl-csr-get-subject.php               30-Sep-2022 11:02                9575
function.openssl-csr-new.php                       30-Sep-2022 11:02               21722
function.openssl-csr-sign.php                      30-Sep-2022 11:02               13213
function.openssl-decrypt.php                       30-Sep-2022 11:02                7096
function.openssl-dh-compute-key.php                30-Sep-2022 11:02               16426
function.openssl-digest.php                        30-Sep-2022 11:02                4189
function.openssl-encrypt.php                       30-Sep-2022 11:02               18024
function.openssl-error-string.php                  30-Sep-2022 11:02                3781
function.openssl-free-key.php                      30-Sep-2022 11:02                3761
function.openssl-get-cert-locations.php            30-Sep-2022 11:02                3982
function.openssl-get-cipher-methods.php            30-Sep-2022 11:02               14315
function.openssl-get-curve-names.php               30-Sep-2022 11:02                7004
function.openssl-get-md-methods.php                30-Sep-2022 11:02                6867
function.openssl-get-privatekey.php                30-Sep-2022 11:02                1895
function.openssl-get-publickey.php                 30-Sep-2022 11:02                1866
function.openssl-open.php                          30-Sep-2022 11:02                9994
function.openssl-pbkdf2.php                        30-Sep-2022 11:02                7251
function.openssl-pkcs12-export-to-file.php         30-Sep-2022 11:02                6746
function.openssl-pkcs12-export.php                 30-Sep-2022 11:02                6689
function.openssl-pkcs12-read.php                   30-Sep-2022 11:02                5412
function.openssl-pkcs7-decrypt.php                 30-Sep-2022 11:02                7482
function.openssl-pkcs7-encrypt.php                 30-Sep-2022 11:02               10635
function.openssl-pkcs7-read.php                    30-Sep-2022 11:02                6898
function.openssl-pkcs7-sign.php                    30-Sep-2022 11:02               11843
function.openssl-pkcs7-verify.php                  30-Sep-2022 11:02                7477
function.openssl-pkey-derive.php                   30-Sep-2022 11:02                7877
function.openssl-pkey-export-to-file.php           30-Sep-2022 11:02                5992
function.openssl-pkey-export.php                   30-Sep-2022 11:02                5855
function.openssl-pkey-free.php                     30-Sep-2022 11:02                3993
function.openssl-pkey-get-details.php              30-Sep-2022 11:02                9045
function.openssl-pkey-get-private.php              30-Sep-2022 11:02                5706
function.openssl-pkey-get-public.php               30-Sep-2022 11:02                5258
function.openssl-pkey-new.php                      30-Sep-2022 11:02                6878
function.openssl-private-decrypt.php               30-Sep-2022 11:02                6145
function.openssl-private-encrypt.php               30-Sep-2022 11:02                5974
function.openssl-public-decrypt.php                30-Sep-2022 11:02                6028
function.openssl-public-encrypt.php                30-Sep-2022 11:02                6229
function.openssl-random-pseudo-bytes.php           30-Sep-2022 11:02                9250
function.openssl-seal.php                          30-Sep-2022 11:02               11152
function.openssl-sign.php                          30-Sep-2022 11:02               12403
function.openssl-spki-export-challenge.php         30-Sep-2022 11:02                7599
function.openssl-spki-export.php                   30-Sep-2022 11:02                8227
function.openssl-spki-new.php                      30-Sep-2022 11:02                8981
function.openssl-spki-verify.php                   30-Sep-2022 11:02                7876
function.openssl-verify.php                        30-Sep-2022 11:02               13292
function.openssl-x509-check-private-key.php        30-Sep-2022 11:02                5497
function.openssl-x509-checkpurpose.php             30-Sep-2022 11:02                6936
function.openssl-x509-export-to-file.php           30-Sep-2022 11:02                4632
function.openssl-x509-export.php                   30-Sep-2022 11:02                4551
function.openssl-x509-fingerprint.php              30-Sep-2022 11:02                4923
function.openssl-x509-free.php                     30-Sep-2022 11:02                4018
function.openssl-x509-parse.php                    30-Sep-2022 11:02                4524
function.openssl-x509-read.php                     30-Sep-2022 11:02                4409
function.openssl-x509-verify.php                   30-Sep-2022 11:02               12889
function.ord.php                                   30-Sep-2022 11:02                4055
function.output-add-rewrite-var.php                30-Sep-2022 11:02                8183
function.output-reset-rewrite-vars.php             30-Sep-2022 11:02                6502
function.pack.php                                  30-Sep-2022 11:02               11987
function.parse-ini-file.php                        30-Sep-2022 11:02                9035
function.parse-ini-string.php                      30-Sep-2022 11:02                6534
function.parse-str.php                             30-Sep-2022 11:02                7701
function.parse-url.php                             30-Sep-2022 11:02               15077
function.passthru.php                              30-Sep-2022 11:02                6415
function.password-algos.php                        30-Sep-2022 11:02                3210
function.password-get-info.php                     30-Sep-2022 11:02                3464
function.password-hash.php                         30-Sep-2022 11:02               22662
function.password-needs-rehash.php                 30-Sep-2022 11:02                7053
function.password-verify.php                       30-Sep-2022 11:02                5608
function.pathinfo.php                              30-Sep-2022 11:02                7723
function.pclose.php                                30-Sep-2022 11:02                2969
function.pcntl-alarm.php                           30-Sep-2022 11:02                2813
function.pcntl-async-signals.php                   30-Sep-2022 11:02                3908
function.pcntl-errno.php                           30-Sep-2022 11:02                1758
function.pcntl-exec.php                            30-Sep-2022 11:02                3540
function.pcntl-fork.php                            30-Sep-2022 11:02                5262
function.pcntl-get-last-error.php                  30-Sep-2022 11:02                2727
function.pcntl-getpriority.php                     30-Sep-2022 11:02                5103
function.pcntl-rfork.php                           30-Sep-2022 11:02                7559
function.pcntl-setpriority.php                     30-Sep-2022 11:02                4960
function.pcntl-signal-dispatch.php                 30-Sep-2022 11:02                5658
function.pcntl-signal-get-handler.php              30-Sep-2022 11:02                6694
function.pcntl-signal.php                          30-Sep-2022 11:02               11889
function.pcntl-sigprocmask.php                     30-Sep-2022 11:02                5697
function.pcntl-sigtimedwait.php                    30-Sep-2022 11:02                4843
function.pcntl-sigwaitinfo.php                     30-Sep-2022 11:02                7262
function.pcntl-strerror.php                        30-Sep-2022 11:02                2874
function.pcntl-unshare.php                         30-Sep-2022 11:02                4257
function.pcntl-wait.php                            30-Sep-2022 11:02                7885
function.pcntl-waitpid.php                         30-Sep-2022 11:02                9212
function.pcntl-wexitstatus.php                     30-Sep-2022 11:02                3571
function.pcntl-wifexited.php                       30-Sep-2022 11:02                3318
function.pcntl-wifsignaled.php                     30-Sep-2022 11:02                3370
function.pcntl-wifstopped.php                      30-Sep-2022 11:02                3371
function.pcntl-wstopsig.php                        30-Sep-2022 11:02                3576
function.pcntl-wtermsig.php                        30-Sep-2022 11:02                3766
function.pfsockopen.php                            30-Sep-2022 11:02                5112
function.pg-affected-rows.php                      30-Sep-2022 11:02                4100
function.pg-cancel-query.php                       30-Sep-2022 11:02                2564
function.pg-client-encoding.php                    30-Sep-2022 11:02                3208
function.pg-close.php                              30-Sep-2022 11:02                4063
function.pg-connect-poll.php                       30-Sep-2022 11:02                3629
function.pg-connect.php                            30-Sep-2022 11:02                6831
function.pg-connection-busy.php                    30-Sep-2022 11:02                4378
function.pg-connection-reset.php                   30-Sep-2022 11:02                4348
function.pg-connection-status.php                  30-Sep-2022 11:02                4184
function.pg-consume-input.php                      30-Sep-2022 11:02                3395
function.pg-convert.php                            30-Sep-2022 11:02                3514
function.pg-copy-from.php                          30-Sep-2022 11:02                3015
function.pg-copy-to.php                            30-Sep-2022 11:02                2808
function.pg-dbname.php                             30-Sep-2022 11:02                3162
function.pg-delete.php                             30-Sep-2022 11:02                5287
function.pg-end-copy.php                           30-Sep-2022 11:02                2781
function.pg-escape-bytea.php                       30-Sep-2022 11:02                3329
function.pg-escape-identifier.php                  30-Sep-2022 11:02                7769
function.pg-escape-literal.php                     30-Sep-2022 11:02                8274
function.pg-escape-string.php                      30-Sep-2022 11:02                2504
function.pg-execute.php                            30-Sep-2022 11:02               10442
function.pg-fetch-all-columns.php                  30-Sep-2022 11:02                7032
function.pg-fetch-all.php                          30-Sep-2022 11:02                4622
function.pg-fetch-array.php                        30-Sep-2022 11:02                7973
function.pg-fetch-assoc.php                        30-Sep-2022 11:02                6250
function.pg-fetch-object.php                       30-Sep-2022 11:02                8718
function.pg-fetch-result.php                       30-Sep-2022 11:02                3660
function.pg-fetch-row.php                          30-Sep-2022 11:02                6277
function.pg-field-is-null.php                      30-Sep-2022 11:02                5870
function.pg-field-name.php                         30-Sep-2022 11:02                7534
function.pg-field-num.php                          30-Sep-2022 11:02                2945
function.pg-field-prtlen.php                       30-Sep-2022 11:02                3055
function.pg-field-size.php                         30-Sep-2022 11:02                3191
function.pg-field-table.php                        30-Sep-2022 11:02                8315
function.pg-field-type-oid.php                     30-Sep-2022 11:02                7468
function.pg-field-type.php                         30-Sep-2022 11:02                2878
function.pg-flush.php                              30-Sep-2022 11:02                3396
function.pg-free-result.php                        30-Sep-2022 11:02                2939
function.pg-get-notify.php                         30-Sep-2022 11:02                7038
function.pg-get-pid.php                            30-Sep-2022 11:02                5141
function.pg-get-result.php                         30-Sep-2022 11:02                2543
function.pg-host.php                               30-Sep-2022 11:02                2261
function.pg-insert.php                             30-Sep-2022 11:02                5525
function.pg-last-error.php                         30-Sep-2022 11:02                3132
function.pg-last-notice.php                        30-Sep-2022 11:02                4096
function.pg-last-oid.php                           30-Sep-2022 11:02                3394
function.pg-lo-close.php                           30-Sep-2022 11:02                3003
function.pg-lo-create.php                          30-Sep-2022 11:02                3057
function.pg-lo-export.php                          30-Sep-2022 11:02                3049
function.pg-lo-import.php                          30-Sep-2022 11:02                3883
function.pg-lo-open.php                            30-Sep-2022 11:02                3469
function.pg-lo-read-all.php                        30-Sep-2022 11:02                2931
function.pg-lo-read.php                            30-Sep-2022 11:02                3101
function.pg-lo-seek.php                            30-Sep-2022 11:02                2682
function.pg-lo-tell.php                            30-Sep-2022 11:02                2361
function.pg-lo-truncate.php                        30-Sep-2022 11:02                6627
function.pg-lo-unlink.php                          30-Sep-2022 11:02                2814
function.pg-lo-write.php                           30-Sep-2022 11:02                3029
function.pg-meta-data.php                          30-Sep-2022 11:02                5616
function.pg-num-fields.php                         30-Sep-2022 11:02                2735
function.pg-num-rows.php                           30-Sep-2022 11:02                3095
function.pg-options.php                            30-Sep-2022 11:02                2117
function.pg-parameter-status.php                   30-Sep-2022 11:02                8214
function.pg-pconnect.php                           30-Sep-2022 11:02                3537
function.pg-ping.php                               30-Sep-2022 11:02                3636
function.pg-port.php                               30-Sep-2022 11:02                2008
function.pg-prepare.php                            30-Sep-2022 11:02               10389
function.pg-put-line.php                           30-Sep-2022 11:02                5289
function.pg-query-params.php                       30-Sep-2022 11:02               10768
function.pg-query.php                              30-Sep-2022 11:02                5039
function.pg-result-error-field.php                 30-Sep-2022 11:02                8664
function.pg-result-error.php                       30-Sep-2022 11:02                2880
function.pg-result-seek.php                        30-Sep-2022 11:02                2824
function.pg-result-status.php                      30-Sep-2022 11:02                2400
function.pg-select.php                             30-Sep-2022 11:02                5479
function.pg-send-execute.php                       30-Sep-2022 11:02               10698
function.pg-send-prepare.php                       30-Sep-2022 11:02               11084
function.pg-send-query-params.php                  30-Sep-2022 11:02                8065
function.pg-send-query.php                         30-Sep-2022 11:02                8007
function.pg-set-client-encoding.php                30-Sep-2022 11:02                3312
function.pg-set-error-verbosity.php                30-Sep-2022 11:02                8475
function.pg-socket.php                             30-Sep-2022 11:02                3553
function.pg-trace.php                              30-Sep-2022 11:02                3684
function.pg-transaction-status.php                 30-Sep-2022 11:02                6472
function.pg-tty.php                                30-Sep-2022 11:02                2023
function.pg-unescape-bytea.php                     30-Sep-2022 11:02                3268
function.pg-untrace.php                            30-Sep-2022 11:02                2403
function.pg-update.php                             30-Sep-2022 11:02                5943
function.pg-version.php                            30-Sep-2022 11:02                6432
function.php-ini-loaded-file.php                   30-Sep-2022 11:02                4678
function.php-ini-scanned-files.php                 30-Sep-2022 11:02                5493
function.php-sapi-name.php                         30-Sep-2022 11:02                3984
function.php-strip-whitespace.php                  30-Sep-2022 11:02                4881
function.php-uname.php                             30-Sep-2022 11:02                6391
function.phpcredits.php                            30-Sep-2022 11:02                7663
function.phpdbg-break-file.php                     30-Sep-2022 11:02                3670
function.phpdbg-break-function.php                 30-Sep-2022 11:02                3448
function.phpdbg-break-method.php                   30-Sep-2022 11:02                3726
function.phpdbg-break-next.php                     30-Sep-2022 11:02                3146
function.phpdbg-clear.php                          30-Sep-2022 11:02                3413
function.phpdbg-color.php                          30-Sep-2022 11:02                3549
function.phpdbg-end-oplog.php                      30-Sep-2022 11:02                2452
function.phpdbg-exec.php                           30-Sep-2022 11:02                2775
function.phpdbg-get-executable.php                 30-Sep-2022 11:02                2451
function.phpdbg-prompt.php                         30-Sep-2022 11:02                2746
function.phpdbg-start-oplog.php                    30-Sep-2022 11:02                2245
function.phpinfo.php                               30-Sep-2022 11:02                8132
function.phpversion.php                            30-Sep-2022 11:02                5419
function.pi.php                                    30-Sep-2022 11:02                3059
function.png2wbmp.php                              30-Sep-2022 11:02                4101
function.popen.php                                 30-Sep-2022 11:02                8541
function.pos.php                                   30-Sep-2022 11:02                1613
function.posix-access.php                          30-Sep-2022 11:02                6215
function.posix-ctermid.php                         30-Sep-2022 11:02                4278
function.posix-errno.php                           30-Sep-2022 11:02                1774
function.posix-get-last-error.php                  30-Sep-2022 11:02                4172
function.posix-getcwd.php                          30-Sep-2022 11:02                4137
function.posix-getegid.php                         30-Sep-2022 11:02                5276
function.posix-geteuid.php                         30-Sep-2022 11:02                5217
function.posix-getgid.php                          30-Sep-2022 11:02                4722
function.posix-getgrgid.php                        30-Sep-2022 11:02                6280
function.posix-getgrnam.php                        30-Sep-2022 11:02                6152
function.posix-getgroups.php                       30-Sep-2022 11:02                4039
function.posix-getlogin.php                        30-Sep-2022 11:02                3481
function.posix-getpgid.php                         30-Sep-2022 11:02                4455
function.posix-getpgrp.php                         30-Sep-2022 11:02                2478
function.posix-getpid.php                          30-Sep-2022 11:02                3273
function.posix-getppid.php                         30-Sep-2022 11:02                2897
function.posix-getpwnam.php                        30-Sep-2022 11:02                6586
function.posix-getpwuid.php                        30-Sep-2022 11:02                6587
function.posix-getrlimit.php                       30-Sep-2022 11:02                7032
function.posix-getsid.php                          30-Sep-2022 11:02                4541
function.posix-getuid.php                          30-Sep-2022 11:02                3309
function.posix-initgroups.php                      30-Sep-2022 11:02                3042
function.posix-isatty.php                          30-Sep-2022 11:02                3583
function.posix-kill.php                            30-Sep-2022 11:02                3225
function.posix-mkfifo.php                          30-Sep-2022 11:02                3274
function.posix-mknod.php                           30-Sep-2022 11:02                7089
function.posix-setegid.php                         30-Sep-2022 11:02                5062
function.posix-seteuid.php                         30-Sep-2022 11:02                3358
function.posix-setgid.php                          30-Sep-2022 11:02                5265
function.posix-setpgid.php                         30-Sep-2022 11:02                3146
function.posix-setrlimit.php                       30-Sep-2022 11:02                4164
function.posix-setsid.php                          30-Sep-2022 11:02                2462
function.posix-setuid.php                          30-Sep-2022 11:02                5378
function.posix-strerror.php                        30-Sep-2022 11:02                4698
function.posix-times.php                           30-Sep-2022 11:02                4523
function.posix-ttyname.php                         30-Sep-2022 11:02                3139
function.posix-uname.php                           30-Sep-2022 11:02                4674
function.pow.php                                   30-Sep-2022 11:02                7000
function.preg-filter.php                           30-Sep-2022 11:02                9439
function.preg-grep.php                             30-Sep-2022 11:02                4317
function.preg-last-error-msg.php                   30-Sep-2022 11:02                4064
function.preg-last-error.php                       30-Sep-2022 11:02                4126
function.preg-match-all.php                        30-Sep-2022 11:02               25599
function.preg-match.php                            30-Sep-2022 11:02               23728
function.preg-quote.php                            30-Sep-2022 11:02                7136
function.preg-replace-callback-array.php           30-Sep-2022 11:02               10303
function.preg-replace-callback.php                 30-Sep-2022 11:02               16398
function.preg-replace.php                          30-Sep-2022 11:02               21539
function.preg-split.php                            30-Sep-2022 11:02               10773
function.prev.php                                  30-Sep-2022 11:02                7774
function.print-r.php                               30-Sep-2022 11:02                9374
function.print.php                                 30-Sep-2022 11:02                8095
function.printf.php                                30-Sep-2022 11:02                2841
function.proc-close.php                            30-Sep-2022 11:02                3473
function.proc-get-status.php                       30-Sep-2022 11:02                6026
function.proc-nice.php                             30-Sep-2022 11:02                4276
function.proc-open.php                             30-Sep-2022 11:02               16344
function.proc-terminate.php                        30-Sep-2022 11:02                4778
function.property-exists.php                       30-Sep-2022 11:02                6923
function.ps-add-bookmark.php                       30-Sep-2022 11:02                4888
function.ps-add-launchlink.php                     30-Sep-2022 11:02                5377
function.ps-add-locallink.php                      30-Sep-2022 11:02                6107
function.ps-add-note.php                           30-Sep-2022 11:02                6736
function.ps-add-pdflink.php                        30-Sep-2022 11:02                6424
function.ps-add-weblink.php                        30-Sep-2022 11:02                5463
function.ps-arc.php                                30-Sep-2022 11:02                4843
function.ps-arcn.php                               30-Sep-2022 11:02                4849
function.ps-begin-page.php                         30-Sep-2022 11:02                6696
function.ps-begin-pattern.php                      30-Sep-2022 11:02               13288
function.ps-begin-template.php                     30-Sep-2022 11:02               11365
function.ps-circle.php                             30-Sep-2022 11:02                4485
function.ps-clip.php                               30-Sep-2022 11:02                2911
function.ps-close-image.php                        30-Sep-2022 11:02                3769
function.ps-close.php                              30-Sep-2022 11:02                3564
function.ps-closepath-stroke.php                   30-Sep-2022 11:02                2984
function.ps-closepath.php                          30-Sep-2022 11:02                3160
function.ps-continue-text.php                      30-Sep-2022 11:02                3931
function.ps-curveto.php                            30-Sep-2022 11:02                4664
function.ps-delete.php                             30-Sep-2022 11:02                3428
function.ps-end-page.php                           30-Sep-2022 11:02                3154
function.ps-end-pattern.php                        30-Sep-2022 11:02                3085
function.ps-end-template.php                       30-Sep-2022 11:02                3092
function.ps-fill-stroke.php                        30-Sep-2022 11:02                3205
function.ps-fill.php                               30-Sep-2022 11:02                3138
function.ps-findfont.php                           30-Sep-2022 11:02                6849
function.ps-get-buffer.php                         30-Sep-2022 11:02                3147
function.ps-get-parameter.php                      30-Sep-2022 11:02                7574
function.ps-get-value.php                          30-Sep-2022 11:02                9330
function.ps-hyphenate.php                          30-Sep-2022 11:02                7153
function.ps-include-file.php                       30-Sep-2022 11:02                2925
function.ps-lineto.php                             30-Sep-2022 11:02                8180
function.ps-makespotcolor.php                      30-Sep-2022 11:02               10283
function.ps-moveto.php                             30-Sep-2022 11:02                3614
function.ps-new.php                                30-Sep-2022 11:02                2922
function.ps-open-file.php                          30-Sep-2022 11:02                3507
function.ps-open-image-file.php                    30-Sep-2022 11:02                4687
function.ps-open-image.php                         30-Sep-2022 11:02                6502
function.ps-open-memory-image.php                  30-Sep-2022 11:02                2708
function.ps-place-image.php                        30-Sep-2022 11:02                4922
function.ps-rect.php                               30-Sep-2022 11:02                4657
function.ps-restore.php                            30-Sep-2022 11:02                3267
function.ps-rotate.php                             30-Sep-2022 11:02               12350
function.ps-save.php                               30-Sep-2022 11:02                3014
function.ps-scale.php                              30-Sep-2022 11:02                3538
function.ps-set-border-color.php                   30-Sep-2022 11:02                4602
function.ps-set-border-dash.php                    30-Sep-2022 11:02                4244
function.ps-set-border-style.php                   30-Sep-2022 11:02                4306
function.ps-set-info.php                           30-Sep-2022 11:02                5776
function.ps-set-parameter.php                      30-Sep-2022 11:02                3714
function.ps-set-text-pos.php                       30-Sep-2022 11:02                9342
function.ps-set-value.php                          30-Sep-2022 11:02                4549
function.ps-setcolor.php                           30-Sep-2022 11:02                5481
function.ps-setdash.php                            30-Sep-2022 11:02                3410
function.ps-setflat.php                            30-Sep-2022 11:02                2914
function.ps-setfont.php                            30-Sep-2022 11:02                3843
function.ps-setgray.php                            30-Sep-2022 11:02                3137
function.ps-setlinecap.php                         30-Sep-2022 11:02                3693
function.ps-setlinejoin.php                        30-Sep-2022 11:02                3711
function.ps-setlinewidth.php                       30-Sep-2022 11:02                3575
function.ps-setmiterlimit.php                      30-Sep-2022 11:02                3995
function.ps-setoverprintmode.php                   30-Sep-2022 11:02                2951
function.ps-setpolydash.php                        30-Sep-2022 11:02                7745
function.ps-shading-pattern.php                    30-Sep-2022 11:02                4050
function.ps-shading.php                            30-Sep-2022 11:02                6527
function.ps-shfill.php                             30-Sep-2022 11:02                3801
function.ps-show-boxed.php                         30-Sep-2022 11:02               12104
function.ps-show-xy.php                            30-Sep-2022 11:02                3970
function.ps-show-xy2.php                           30-Sep-2022 11:02                2738
function.ps-show.php                               30-Sep-2022 11:02                5623
function.ps-show2.php                              30-Sep-2022 11:02                3059
function.ps-string-geometry.php                    30-Sep-2022 11:02                4677
function.ps-stringwidth.php                        30-Sep-2022 11:02                4139
function.ps-stroke.php                             30-Sep-2022 11:02                3350
function.ps-symbol-name.php                        30-Sep-2022 11:02                3736
function.ps-symbol-width.php                       30-Sep-2022 11:02                4228
function.ps-symbol.php                             30-Sep-2022 11:02                3547
function.ps-translate.php                          30-Sep-2022 11:02               14385
function.pspell-add-to-personal.php                30-Sep-2022 11:02                6282
function.pspell-add-to-session.php                 30-Sep-2022 11:02                3879
function.pspell-check.php                          30-Sep-2022 11:02                4926
function.pspell-clear-session.php                  30-Sep-2022 11:02                5778
function.pspell-config-create.php                  30-Sep-2022 11:02                7916
function.pspell-config-data-dir.php                30-Sep-2022 11:02                3182
function.pspell-config-dict-dir.php                30-Sep-2022 11:02                3181
function.pspell-config-ignore.php                  30-Sep-2022 11:02                5613
function.pspell-config-mode.php                    30-Sep-2022 11:02                6234
function.pspell-config-personal.php                30-Sep-2022 11:02                6353
function.pspell-config-repl.php                    30-Sep-2022 11:02                6661
function.pspell-config-runtogether.php             30-Sep-2022 11:02                6117
function.pspell-config-save-repl.php               30-Sep-2022 11:02                5010
function.pspell-new-config.php                     30-Sep-2022 11:02                6336
function.pspell-new-personal.php                   30-Sep-2022 11:02               10219
function.pspell-new.php                            30-Sep-2022 11:02                8863
function.pspell-save-wordlist.php                  30-Sep-2022 11:02                5931
function.pspell-store-replacement.php              30-Sep-2022 11:02                7504
function.pspell-suggest.php                        30-Sep-2022 11:02                5605
function.putenv.php                                30-Sep-2022 11:02                5054
function.quoted-printable-decode.php               30-Sep-2022 11:02                3500
function.quoted-printable-encode.php               30-Sep-2022 11:02                3450
function.quotemeta.php                             30-Sep-2022 11:02                4407
function.rad2deg.php                               30-Sep-2022 11:02                3536
function.radius-acct-open.php                      30-Sep-2022 11:02                3193
function.radius-add-server.php                     30-Sep-2022 11:02                7400
function.radius-auth-open.php                      30-Sep-2022 11:02                3190
function.radius-close.php                          30-Sep-2022 11:02                2445
function.radius-config.php                         30-Sep-2022 11:02                3824
function.radius-create-request.php                 30-Sep-2022 11:02                5004
function.radius-cvt-addr.php                       30-Sep-2022 11:02                6755
function.radius-cvt-int.php                        30-Sep-2022 11:02                5992
function.radius-cvt-string.php                     30-Sep-2022 11:02                6049
function.radius-demangle-mppe-key.php              30-Sep-2022 11:02                3001
function.radius-demangle.php                       30-Sep-2022 11:02                2732
function.radius-get-attr.php                       30-Sep-2022 11:02                6783
function.radius-get-tagged-attr-data.php           30-Sep-2022 11:02                6754
function.radius-get-tagged-attr-tag.php            30-Sep-2022 11:02                6809
function.radius-get-vendor-attr.php                30-Sep-2022 11:02                8847
function.radius-put-addr.php                       30-Sep-2022 11:02                4953
function.radius-put-attr.php                       30-Sep-2022 11:02                8381
function.radius-put-int.php                        30-Sep-2022 11:02                7050
function.radius-put-string.php                     30-Sep-2022 11:02                7438
function.radius-put-vendor-addr.php                30-Sep-2022 11:02                4962
function.radius-put-vendor-attr.php                30-Sep-2022 11:02                7219
function.radius-put-vendor-int.php                 30-Sep-2022 11:02                5641
function.radius-put-vendor-string.php              30-Sep-2022 11:02                6032
function.radius-request-authenticator.php          30-Sep-2022 11:02                3000
function.radius-salt-encrypt-attr.php              30-Sep-2022 11:02                3984
function.radius-send-request.php                   30-Sep-2022 11:02                3620
function.radius-server-secret.php                  30-Sep-2022 11:02                2516
function.radius-strerror.php                       30-Sep-2022 11:02                2485
function.rand.php                                  30-Sep-2022 11:02                7271
function.random-bytes.php                          30-Sep-2022 11:02                7544
function.random-int.php                            30-Sep-2022 11:02                7628
function.range.php                                 30-Sep-2022 11:02                7801
function.rar-wrapper-cache-stats.php               30-Sep-2022 11:02                2295
function.rawurldecode.php                          30-Sep-2022 11:02                4492
function.rawurlencode.php                          30-Sep-2022 11:02                7356
function.read-exif-data.php                        30-Sep-2022 11:02                1730
function.readdir.php                               30-Sep-2022 11:02                9685
function.readfile.php                              30-Sep-2022 11:02                5959
function.readgzfile.php                            30-Sep-2022 11:02                4172
function.readline-add-history.php                  30-Sep-2022 11:02                2607
function.readline-callback-handler-install.php     30-Sep-2022 11:02                9982
function.readline-callback-handler-remove.php      30-Sep-2022 11:02                3756
function.readline-callback-read-char.php           30-Sep-2022 11:02                3812
function.readline-clear-history.php                30-Sep-2022 11:02                2157
function.readline-completion-function.php          30-Sep-2022 11:02                2914
function.readline-info.php                         30-Sep-2022 11:02                3282
function.readline-list-history.php                 30-Sep-2022 11:02                2099
function.readline-on-new-line.php                  30-Sep-2022 11:02                2639
function.readline-read-history.php                 30-Sep-2022 11:02                2632
function.readline-redisplay.php                    30-Sep-2022 11:02                2216
function.readline-write-history.php                30-Sep-2022 11:02                2585
function.readline.php                              30-Sep-2022 11:02                4829
function.readlink.php                              30-Sep-2022 11:02                4595
function.realpath-cache-get.php                    30-Sep-2022 11:02                4033
function.realpath-cache-size.php                   30-Sep-2022 11:02                3536
function.realpath.php                              30-Sep-2022 11:02                5954
function.recode-file.php                           30-Sep-2022 11:02                5466
function.recode-string.php                         30-Sep-2022 11:02                4946
function.recode.php                                30-Sep-2022 11:02                1723
function.register-shutdown-function.php            30-Sep-2022 11:02                4273
function.register-tick-function.php                30-Sep-2022 11:02                6174
function.rename.php                                30-Sep-2022 11:02                6075
function.require-once.php                          30-Sep-2022 11:01                1789
function.require.php                               30-Sep-2022 11:01                1869
function.reset.php                                 30-Sep-2022 11:02                6847
function.restore-error-handler.php                 30-Sep-2022 11:02                6227
function.restore-exception-handler.php             30-Sep-2022 11:02                3525
function.restore-include-path.php                  30-Sep-2022 11:02                5028
function.return.php                                30-Sep-2022 11:01                4247
function.rewind.php                                30-Sep-2022 11:02                3552
function.rewinddir.php                             30-Sep-2022 11:02                2402
function.rmdir.php                                 30-Sep-2022 11:02                4714
function.round.php                                 30-Sep-2022 11:02               24137
function.rpmaddtag.php                             30-Sep-2022 11:02                3144
function.rpmdbinfo.php                             30-Sep-2022 11:02                4706
function.rpmdbsearch.php                           30-Sep-2022 11:02                5491
function.rpminfo.php                               30-Sep-2022 11:02                4890
function.rpmvercmp.php                             30-Sep-2022 11:02                2556
function.rrd-create.php                            30-Sep-2022 11:02                2664
function.rrd-error.php                             30-Sep-2022 11:02                2018
function.rrd-fetch.php                             30-Sep-2022 11:02                2748
function.rrd-first.php                             30-Sep-2022 11:02                2673
function.rrd-graph.php                             30-Sep-2022 11:02                2925
function.rrd-info.php                              30-Sep-2022 11:02                2312
function.rrd-last.php                              30-Sep-2022 11:02                2315
function.rrd-lastupdate.php                        30-Sep-2022 11:02                2442
function.rrd-restore.php                           30-Sep-2022 11:02                2982
function.rrd-tune.php                              30-Sep-2022 11:02                2720
function.rrd-update.php                            30-Sep-2022 11:02                2793
function.rrd-version.php                           30-Sep-2022 11:02                2112
function.rrd-xport.php                             30-Sep-2022 11:02                2488
function.rrdc-disconnect.php                       30-Sep-2022 11:02                2501
function.rsort.php                                 30-Sep-2022 11:02                6739
function.rtrim.php                                 30-Sep-2022 11:02                9676
function.runkit7-constant-add.php                  30-Sep-2022 11:02                4226
function.runkit7-constant-redefine.php             30-Sep-2022 11:02                4094
function.runkit7-constant-remove.php               30-Sep-2022 11:02                3430
function.runkit7-function-add.php                  30-Sep-2022 11:02                8832
function.runkit7-function-copy.php                 30-Sep-2022 11:02                5266
function.runkit7-function-redefine.php             30-Sep-2022 11:02                9221
function.runkit7-function-remove.php               30-Sep-2022 11:02                3915
function.runkit7-function-rename.php               30-Sep-2022 11:02                4136
function.runkit7-import.php                        30-Sep-2022 11:02                3546
function.runkit7-method-add.php                    30-Sep-2022 11:02               10713
function.runkit7-method-copy.php                   30-Sep-2022 11:02                7051
function.runkit7-method-redefine.php               30-Sep-2022 11:02               11179
function.runkit7-method-remove.php                 30-Sep-2022 11:02                6458
function.runkit7-method-rename.php                 30-Sep-2022 11:02                6509
function.runkit7-object-id.php                     30-Sep-2022 11:02                3624
function.runkit7-superglobals.php                  30-Sep-2022 11:02                2564
function.runkit7-zval-inspect.php                  30-Sep-2022 11:02                5052
function.sapi-windows-cp-conv.php                  30-Sep-2022 11:02                4272
function.sapi-windows-cp-get.php                   30-Sep-2022 11:02                3329
function.sapi-windows-cp-is-utf8.php               30-Sep-2022 11:02                2667
function.sapi-windows-cp-set.php                   30-Sep-2022 11:02                2842
function.sapi-windows-generate-ctrl-event.php      30-Sep-2022 11:02                7670
function.sapi-windows-set-ctrl-handler.php         30-Sep-2022 11:02                7420
function.sapi-windows-vt100-support.php            30-Sep-2022 11:02                9882
function.scandir.php                               30-Sep-2022 11:02                9978
function.scoutapm-get-calls.php                    30-Sep-2022 11:02                4368
function.scoutapm-list-instrumented-functions.php  30-Sep-2022 11:02                3693
function.seaslog-get-author.php                    30-Sep-2022 11:02                3023
function.seaslog-get-version.php                   30-Sep-2022 11:02                3009
function.sem-acquire.php                           30-Sep-2022 11:02                4853
function.sem-get.php                               30-Sep-2022 11:02                6619
function.sem-release.php                           30-Sep-2022 11:02                4079
function.sem-remove.php                            30-Sep-2022 11:02                4060
function.serialize.php                             30-Sep-2022 11:02               11127
function.session-abort.php                         30-Sep-2022 11:02                3262
function.session-cache-expire.php                  30-Sep-2022 11:02                6843
function.session-cache-limiter.php                 30-Sep-2022 11:02                8199
function.session-commit.php                        30-Sep-2022 11:02                1823
function.session-create-id.php                     30-Sep-2022 11:02               10994
function.session-decode.php                        30-Sep-2022 11:02                3668
function.session-destroy.php                       30-Sep-2022 11:02                9752
function.session-encode.php                        30-Sep-2022 11:02                3494
function.session-gc.php                            30-Sep-2022 11:02                8161
function.session-get-cookie-params.php             30-Sep-2022 11:02                4925
function.session-id.php                            30-Sep-2022 11:02                5182
function.session-module-name.php                   30-Sep-2022 11:02                2634
function.session-name.php                          30-Sep-2022 11:02                5626
function.session-regenerate-id.php                 30-Sep-2022 11:02               18990
function.session-register-shutdown.php             30-Sep-2022 11:02                2670
function.session-reset.php                         30-Sep-2022 11:02                3352
function.session-save-path.php                     30-Sep-2022 11:02                3761
function.session-set-cookie-params.php             30-Sep-2022 11:02                7080
function.session-set-save-handler.php              30-Sep-2022 11:02               31282
function.session-start.php                         30-Sep-2022 11:02               15057
function.session-status.php                        30-Sep-2022 11:02                2912
function.session-unset.php                         30-Sep-2022 11:02                3204
function.session-write-close.php                   30-Sep-2022 11:02                3116
function.set-error-handler.php                     30-Sep-2022 11:02               26354
function.set-exception-handler.php                 30-Sep-2022 11:02                5892
function.set-file-buffer.php                       30-Sep-2022 11:02                1790
function.set-include-path.php                      30-Sep-2022 11:02                5169
function.set-time-limit.php                        30-Sep-2022 11:02                4135
function.setcookie.php                             30-Sep-2022 11:02               25899
function.setlocale.php                             30-Sep-2022 11:02               12593
function.setrawcookie.php                          30-Sep-2022 11:02                5414
function.settype.php                               30-Sep-2022 11:02                6580
function.sha1-file.php                             30-Sep-2022 11:02                3705
function.sha1.php                                  30-Sep-2022 11:02                4043
function.shell-exec.php                            30-Sep-2022 11:02                3927
function.shm-attach.php                            30-Sep-2022 11:02                5625
function.shm-detach.php                            30-Sep-2022 11:02                4321
function.shm-get-var.php                           30-Sep-2022 11:02                4283
function.shm-has-var.php                           30-Sep-2022 11:02                4103
function.shm-put-var.php                           30-Sep-2022 11:02                5145
function.shm-remove-var.php                        30-Sep-2022 11:02                3980
function.shm-remove.php                            30-Sep-2022 11:02                3761
function.shmop-close.php                           30-Sep-2022 11:02                3798
function.shmop-delete.php                          30-Sep-2022 11:02                3460
function.shmop-open.php                            30-Sep-2022 11:02                6244
function.shmop-read.php                            30-Sep-2022 11:02                3498
function.shmop-size.php                            30-Sep-2022 11:02                3595
function.shmop-write.php                           30-Sep-2022 11:02                3727
function.show-source.php                           30-Sep-2022 11:02                1734
function.shuffle.php                               30-Sep-2022 11:02                6228
function.similar-text.php                          30-Sep-2022 11:02                4051
function.simplexml-import-dom.php                  30-Sep-2022 11:02                6736
function.simplexml-load-file.php                   30-Sep-2022 11:02                9973
function.simplexml-load-string.php                 30-Sep-2022 11:02                9265
function.sin.php                                   30-Sep-2022 11:02                4693
function.sinh.php                                  30-Sep-2022 11:02                3178
function.sizeof.php                                30-Sep-2022 11:02                1632
function.sleep.php                                 30-Sep-2022 11:02                4864
function.snmp-get-quick-print.php                  30-Sep-2022 11:02                3559
function.snmp-get-valueretrieval.php               30-Sep-2022 11:02                4403
function.snmp-read-mib.php                         30-Sep-2022 11:02                4688
function.snmp-set-enum-print.php                   30-Sep-2022 11:02                4598
function.snmp-set-oid-numeric-print.php            30-Sep-2022 11:02                2323
function.snmp-set-oid-output-format.php            30-Sep-2022 11:02                6672
function.snmp-set-quick-print.php                  30-Sep-2022 11:02                6436
function.snmp-set-valueretrieval.php               30-Sep-2022 11:02                9163
function.snmp2-get.php                             30-Sep-2022 11:02                5474
function.snmp2-getnext.php                         30-Sep-2022 11:02                5857
function.snmp2-real-walk.php                       30-Sep-2022 11:02                6128
function.snmp2-set.php                             30-Sep-2022 11:02               10360
function.snmp2-walk.php                            30-Sep-2022 11:02                6635
function.snmp3-get.php                             30-Sep-2022 11:02                8315
function.snmp3-getnext.php                         30-Sep-2022 11:02                8658
function.snmp3-real-walk.php                       30-Sep-2022 11:02                9171
function.snmp3-set.php                             30-Sep-2022 11:02               12915
function.snmp3-walk.php                            30-Sep-2022 11:02                9591
function.snmpget.php                               30-Sep-2022 11:02                5468
function.snmpgetnext.php                           30-Sep-2022 11:02                5732
function.snmprealwalk.php                          30-Sep-2022 11:02                6003
function.snmpset.php                               30-Sep-2022 11:02               10391
function.snmpwalk.php                              30-Sep-2022 11:02                6661
function.snmpwalkoid.php                           30-Sep-2022 11:02                7341
function.socket-accept.php                         30-Sep-2022 11:02                5629
function.socket-addrinfo-bind.php                  30-Sep-2022 11:02                5131
function.socket-addrinfo-connect.php               30-Sep-2022 11:02                4915
function.socket-addrinfo-explain.php               30-Sep-2022 11:02                4318
function.socket-addrinfo-lookup.php                30-Sep-2022 11:02                5504
function.socket-bind.php                           30-Sep-2022 11:02                4798
function.socket-clear-error.php                    30-Sep-2022 11:02                3565
function.socket-close.php                          30-Sep-2022 11:02                3666
function.socket-cmsg-space.php                     30-Sep-2022 11:02                3497
function.socket-connect.php                        30-Sep-2022 11:02                4417
function.socket-create-listen.php                  30-Sep-2022 11:02                4976
function.socket-create-pair.php                    30-Sep-2022 11:02                2821
function.socket-create.php                         30-Sep-2022 11:02                9595
function.socket-export-stream.php                  30-Sep-2022 11:02                3273
function.socket-get-option.php                     30-Sep-2022 11:02                2897
function.socket-get-status.php                     30-Sep-2022 11:02                1810
function.socket-getopt.php                         30-Sep-2022 11:02                1793
function.socket-getpeername.php                    30-Sep-2022 11:02                5110
function.socket-getsockname.php                    30-Sep-2022 11:02                5143
function.socket-import-stream.php                  30-Sep-2022 11:02                4980
function.socket-last-error.php                     30-Sep-2022 11:02                4961
function.socket-listen.php                         30-Sep-2022 11:02                5186
function.socket-read.php                           30-Sep-2022 11:02                5339
function.socket-recv.php                           30-Sep-2022 11:02                2398
function.socket-recvfrom.php                       30-Sep-2022 11:02                3048
function.socket-recvmsg.php                        30-Sep-2022 11:02                4159
function.socket-select.php                         30-Sep-2022 11:02               14041
function.socket-send.php                           30-Sep-2022 11:02                4150
function.socket-sendmsg.php                        30-Sep-2022 11:02                4235
function.socket-sendto.php                         30-Sep-2022 11:02                7511
function.socket-set-block.php                      30-Sep-2022 11:02                2497
function.socket-set-blocking.php                   30-Sep-2022 11:02                1830
function.socket-set-nonblock.php                   30-Sep-2022 11:02                2409
function.socket-set-option.php                     30-Sep-2022 11:02                3152
function.socket-set-timeout.php                    30-Sep-2022 11:02                1798
function.socket-setopt.php                         30-Sep-2022 11:02                1787
function.socket-shutdown.php                       30-Sep-2022 11:02                3280
function.socket-strerror.php                       30-Sep-2022 11:02                6213
function.socket-write.php                          30-Sep-2022 11:02                5087
function.socket-wsaprotocol-info-export.php        30-Sep-2022 11:02                4781
function.socket-wsaprotocol-info-import.php        30-Sep-2022 11:02                4205
function.socket-wsaprotocol-info-release.php       30-Sep-2022 11:02                3416
function.sodium-add.php                            30-Sep-2022 11:02                3038
function.sodium-base642bin.php                     30-Sep-2022 11:02                4217
function.sodium-bin2base64.php                     30-Sep-2022 11:02                3863
function.sodium-bin2hex.php                        30-Sep-2022 11:02                2554
function.sodium-compare.php                        30-Sep-2022 11:02                3027
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-Sep-2022 11:02                4255
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-Sep-2022 11:02                4042
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-Sep-2022 11:02                2652
function.sodium-crypto-aead-aes256gcm-keygen.php   30-Sep-2022 11:02                2744
function.sodium-crypto-aead-chacha20poly1305-de..> 30-Sep-2022 11:02                4171
function.sodium-crypto-aead-chacha20poly1305-en..> 30-Sep-2022 11:02                3916
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:02                4401
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:02                4082
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:02                2938
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-Sep-2022 11:02                2873
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:02                4579
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:02                4300
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:02                2914
function.sodium-crypto-auth-keygen.php             30-Sep-2022 11:02                2565
function.sodium-crypto-auth-verify.php             30-Sep-2022 11:02                3530
function.sodium-crypto-auth.php                    30-Sep-2022 11:02                3154
function.sodium-crypto-box-keypair-from-secretk..> 30-Sep-2022 11:02                3233
function.sodium-crypto-box-keypair.php             30-Sep-2022 11:02                2846
function.sodium-crypto-box-open.php                30-Sep-2022 11:02                3662
function.sodium-crypto-box-publickey-from-secre..> 30-Sep-2022 11:02                3120
function.sodium-crypto-box-publickey.php           30-Sep-2022 11:02                2833
function.sodium-crypto-box-seal-open.php           30-Sep-2022 11:02                5906
function.sodium-crypto-box-seal.php                30-Sep-2022 11:02                7086
function.sodium-crypto-box-secretkey.php           30-Sep-2022 11:02                2800
function.sodium-crypto-box-seed-keypair.php        30-Sep-2022 11:02                2859
function.sodium-crypto-box.php                     30-Sep-2022 11:02                3967
function.sodium-crypto-core-ristretto255-add.php   30-Sep-2022 11:02                5937
function.sodium-crypto-core-ristretto255-from-h..> 30-Sep-2022 11:02                5368
function.sodium-crypto-core-ristretto255-is-val..> 30-Sep-2022 11:02                5442
function.sodium-crypto-core-ristretto255-random..> 30-Sep-2022 11:02                5559
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:02                6205
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:02                3456
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:02                5318
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:02                3659
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:02                5302
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:02                5719
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:02                3400
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:02                6196
function.sodium-crypto-core-ristretto255-sub.php   30-Sep-2022 11:02                5974
function.sodium-crypto-generichash-final.php       30-Sep-2022 11:02                6729
function.sodium-crypto-generichash-init.php        30-Sep-2022 11:02                6678
function.sodium-crypto-generichash-keygen.php      30-Sep-2022 11:02                2375
function.sodium-crypto-generichash-update.php      30-Sep-2022 11:02                6494
function.sodium-crypto-generichash.php             30-Sep-2022 11:02                3429
function.sodium-crypto-kdf-derive-from-key.php     30-Sep-2022 11:02                3662
function.sodium-crypto-kdf-keygen.php              30-Sep-2022 11:02                2477
function.sodium-crypto-kx-client-session-keys.php  30-Sep-2022 11:02                3188
function.sodium-crypto-kx-keypair.php              30-Sep-2022 11:02                4972
function.sodium-crypto-kx-publickey.php            30-Sep-2022 11:02                2652
function.sodium-crypto-kx-secretkey.php            30-Sep-2022 11:02                2663
function.sodium-crypto-kx-seed-keypair.php         30-Sep-2022 11:02                2601
function.sodium-crypto-kx-server-session-keys.php  30-Sep-2022 11:02                3254
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:02                3151
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:02                3301
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:02                5570
function.sodium-crypto-pwhash-str-needs-rehash.php 30-Sep-2022 11:02                3672
function.sodium-crypto-pwhash-str-verify.php       30-Sep-2022 11:02                4524
function.sodium-crypto-pwhash-str.php              30-Sep-2022 11:02                7929
function.sodium-crypto-pwhash.php                  30-Sep-2022 11:02                9423
function.sodium-crypto-scalarmult-base.php         30-Sep-2022 11:02                2035
function.sodium-crypto-scalarmult-ristretto255-..> 30-Sep-2022 11:02                3369
function.sodium-crypto-scalarmult-ristretto255.php 30-Sep-2022 11:02                3662
function.sodium-crypto-scalarmult.php              30-Sep-2022 11:02                2875
function.sodium-crypto-secretbox-keygen.php        30-Sep-2022 11:02                6292
function.sodium-crypto-secretbox-open.php          30-Sep-2022 11:02                8576
function.sodium-crypto-secretbox.php               30-Sep-2022 11:02                8506
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:02               11643
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:02               10795
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:02                2641
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:02                5510
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:02                5609
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:02                2877
function.sodium-crypto-shorthash-keygen.php        30-Sep-2022 11:02                2625
function.sodium-crypto-shorthash.php               30-Sep-2022 11:02                2987
function.sodium-crypto-sign-detached.php           30-Sep-2022 11:02                2980
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-Sep-2022 11:02                2820
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-Sep-2022 11:02                2876
function.sodium-crypto-sign-keypair-from-secret..> 30-Sep-2022 11:02                3059
function.sodium-crypto-sign-keypair.php            30-Sep-2022 11:02                2363
function.sodium-crypto-sign-open.php               30-Sep-2022 11:02                3084
function.sodium-crypto-sign-publickey-from-secr..> 30-Sep-2022 11:02                2678
function.sodium-crypto-sign-publickey.php          30-Sep-2022 11:02                2688
function.sodium-crypto-sign-secretkey.php          30-Sep-2022 11:02                2664
function.sodium-crypto-sign-seed-keypair.php       30-Sep-2022 11:02                2897
function.sodium-crypto-sign-verify-detached.php    30-Sep-2022 11:02                3307
function.sodium-crypto-sign.php                    30-Sep-2022 11:02                3058
function.sodium-crypto-stream-keygen.php           30-Sep-2022 11:02                2546
function.sodium-crypto-stream-xchacha20-keygen.php 30-Sep-2022 11:02                2704
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-Sep-2022 11:02                9455
function.sodium-crypto-stream-xchacha20-xor.php    30-Sep-2022 11:02                4463
function.sodium-crypto-stream-xchacha20.php        30-Sep-2022 11:02                3460
function.sodium-crypto-stream-xor.php              30-Sep-2022 11:02                3244
function.sodium-crypto-stream.php                  30-Sep-2022 11:02                3179
function.sodium-hex2bin.php                        30-Sep-2022 11:02                3106
function.sodium-increment.php                      30-Sep-2022 11:02                2417
function.sodium-memcmp.php                         30-Sep-2022 11:02                3214
function.sodium-memzero.php                        30-Sep-2022 11:02                2412
function.sodium-pad.php                            30-Sep-2022 11:02                2557
function.sodium-unpad.php                          30-Sep-2022 11:02                2512
function.solr-get-version.php                      30-Sep-2022 11:02                3816
function.sort.php                                  30-Sep-2022 11:02               11205
function.soundex.php                               30-Sep-2022 11:02                6694
function.spl-autoload-call.php                     30-Sep-2022 11:02                2593
function.spl-autoload-extensions.php               30-Sep-2022 11:02                2433
function.spl-autoload-functions.php                30-Sep-2022 11:02                2014
function.spl-autoload-register.php                 30-Sep-2022 11:02                2615
function.spl-autoload-unregister.php               30-Sep-2022 11:02                2399
function.spl-autoload.php                          30-Sep-2022 11:02                2399
function.spl-classes.php                           30-Sep-2022 11:02                3659
function.spl-object-hash.php                       30-Sep-2022 11:02                3587
function.spl-object-id.php                         30-Sep-2022 11:02                4059
function.sprintf.php                               30-Sep-2022 11:02               27040
function.sqlsrv-begin-transaction.php              30-Sep-2022 11:02               12071
function.sqlsrv-cancel.php                         30-Sep-2022 11:02               10743
function.sqlsrv-client-info.php                    30-Sep-2022 11:02                6919
function.sqlsrv-close.php                          30-Sep-2022 11:02                5563
function.sqlsrv-commit.php                         30-Sep-2022 11:02               11908
function.sqlsrv-configure.php                      30-Sep-2022 11:02                4477
function.sqlsrv-connect.php                        30-Sep-2022 11:02               12739
function.sqlsrv-errors.php                         30-Sep-2022 11:02               10676
function.sqlsrv-execute.php                        30-Sep-2022 11:02               10861
function.sqlsrv-fetch-array.php                    30-Sep-2022 11:02               15242
function.sqlsrv-fetch-object.php                   30-Sep-2022 11:02               12468
function.sqlsrv-fetch.php                          30-Sep-2022 11:02               11197
function.sqlsrv-field-metadata.php                 30-Sep-2022 11:02                9011
function.sqlsrv-free-stmt.php                      30-Sep-2022 11:02                7768
function.sqlsrv-get-config.php                     30-Sep-2022 11:02                3273
function.sqlsrv-get-field.php                      30-Sep-2022 11:02               10715
function.sqlsrv-has-rows.php                       30-Sep-2022 11:02                6476
function.sqlsrv-next-result.php                    30-Sep-2022 11:02                9639
function.sqlsrv-num-fields.php                     30-Sep-2022 11:02                8596
function.sqlsrv-num-rows.php                       30-Sep-2022 11:02                8111
function.sqlsrv-prepare.php                        30-Sep-2022 11:02               14963
function.sqlsrv-query.php                          30-Sep-2022 11:02               11701
function.sqlsrv-rollback.php                       30-Sep-2022 11:02               11378
function.sqlsrv-rows-affected.php                  30-Sep-2022 11:02                8228
function.sqlsrv-send-stream-data.php               30-Sep-2022 11:02                8981
function.sqlsrv-server-info.php                    30-Sep-2022 11:02                6357
function.sqrt.php                                  30-Sep-2022 11:02                3816
function.srand.php                                 30-Sep-2022 11:02                5431
function.sscanf.php                                30-Sep-2022 11:02                9644
function.ssdeep-fuzzy-compare.php                  30-Sep-2022 11:02                3054
function.ssdeep-fuzzy-hash-filename.php            30-Sep-2022 11:02                2818
function.ssdeep-fuzzy-hash.php                     30-Sep-2022 11:02                2660
function.ssh2-auth-agent.php                       30-Sep-2022 11:02                4574
function.ssh2-auth-hostbased-file.php              30-Sep-2022 11:02                7738
function.ssh2-auth-none.php                        30-Sep-2022 11:02                4821
function.ssh2-auth-password.php                    30-Sep-2022 11:02                4773
function.ssh2-auth-pubkey-file.php                 30-Sep-2022 11:02                7161
function.ssh2-connect.php                          30-Sep-2022 11:02               15845
function.ssh2-disconnect.php                       30-Sep-2022 11:02                2887
function.ssh2-exec.php                             30-Sep-2022 11:02                7064
function.ssh2-fetch-stream.php                     30-Sep-2022 11:02                5401
function.ssh2-fingerprint.php                      30-Sep-2022 11:02                5311
function.ssh2-forward-accept.php                   30-Sep-2022 11:02                2860
function.ssh2-forward-listen.php                   30-Sep-2022 11:02                4156
function.ssh2-methods-negotiated.php               30-Sep-2022 11:02                8150
function.ssh2-poll.php                             30-Sep-2022 11:02                3381
function.ssh2-publickey-add.php                    30-Sep-2022 11:02                8055
function.ssh2-publickey-init.php                   30-Sep-2022 11:02                4454
function.ssh2-publickey-list.php                   30-Sep-2022 11:02                8883
function.ssh2-publickey-remove.php                 30-Sep-2022 11:02                4418
function.ssh2-scp-recv.php                         30-Sep-2022 11:02                5207
function.ssh2-scp-send.php                         30-Sep-2022 11:02                5769
function.ssh2-send-eof.php                         30-Sep-2022 11:02                3240
function.ssh2-sftp-chmod.php                       30-Sep-2022 11:02                5765
function.ssh2-sftp-lstat.php                       30-Sep-2022 11:02                7345
function.ssh2-sftp-mkdir.php                       30-Sep-2022 11:02                6470
function.ssh2-sftp-readlink.php                    30-Sep-2022 11:02                5288
function.ssh2-sftp-realpath.php                    30-Sep-2022 11:02                5515
function.ssh2-sftp-rename.php                      30-Sep-2022 11:02                5312
function.ssh2-sftp-rmdir.php                       30-Sep-2022 11:02                5387
function.ssh2-sftp-stat.php                        30-Sep-2022 11:02                7243
function.ssh2-sftp-symlink.php                     30-Sep-2022 11:02                5519
function.ssh2-sftp-unlink.php                      30-Sep-2022 11:02                4822
function.ssh2-sftp.php                             30-Sep-2022 11:02                5375
function.ssh2-shell.php                            30-Sep-2022 11:02                7518
function.ssh2-tunnel.php                           30-Sep-2022 11:02                5205
function.stat.php                                  30-Sep-2022 11:02                6833
function.stats-absolute-deviation.php              30-Sep-2022 11:02                2670
function.stats-cdf-beta.php                        30-Sep-2022 11:02                4912
function.stats-cdf-binomial.php                    30-Sep-2022 11:02                4897
function.stats-cdf-cauchy.php                      30-Sep-2022 11:02                4932
function.stats-cdf-chisquare.php                   30-Sep-2022 11:02                4305
function.stats-cdf-exponential.php                 30-Sep-2022 11:02                4336
function.stats-cdf-f.php                           30-Sep-2022 11:02                4837
function.stats-cdf-gamma.php                       30-Sep-2022 11:02                4896
function.stats-cdf-laplace.php                     30-Sep-2022 11:02                4917
function.stats-cdf-logistic.php                    30-Sep-2022 11:02                4952
function.stats-cdf-negative-binomial.php           30-Sep-2022 11:02                5040
function.stats-cdf-noncentral-chisquare.php        30-Sep-2022 11:02                5142
function.stats-cdf-noncentral-f.php                30-Sep-2022 11:02                5662
function.stats-cdf-noncentral-t.php                30-Sep-2022 11:02                5002
function.stats-cdf-normal.php                      30-Sep-2022 11:02                4934
function.stats-cdf-poisson.php                     30-Sep-2022 11:02                4270
function.stats-cdf-t.php                           30-Sep-2022 11:02                4198
function.stats-cdf-uniform.php                     30-Sep-2022 11:02                4897
function.stats-cdf-weibull.php                     30-Sep-2022 11:02                4934
function.stats-covariance.php                      30-Sep-2022 11:02                2801
function.stats-dens-beta.php                       30-Sep-2022 11:02                3233
function.stats-dens-cauchy.php                     30-Sep-2022 11:02                3291
function.stats-dens-chisquare.php                  30-Sep-2022 11:02                3015
function.stats-dens-exponential.php                30-Sep-2022 11:02                3005
function.stats-dens-f.php                          30-Sep-2022 11:02                3231
function.stats-dens-gamma.php                      30-Sep-2022 11:02                3284
function.stats-dens-laplace.php                    30-Sep-2022 11:02                3318
function.stats-dens-logistic.php                   30-Sep-2022 11:02                3330
function.stats-dens-normal.php                     30-Sep-2022 11:02                3301
function.stats-dens-pmf-binomial.php               30-Sep-2022 11:02                3355
function.stats-dens-pmf-hypergeometric.php         30-Sep-2022 11:02                3953
function.stats-dens-pmf-negative-binomial.php      30-Sep-2022 11:02                3484
function.stats-dens-pmf-poisson.php                30-Sep-2022 11:02                3006
function.stats-dens-t.php                          30-Sep-2022 11:02                2919
function.stats-dens-uniform.php                    30-Sep-2022 11:02                3266
function.stats-dens-weibull.php                    30-Sep-2022 11:02                3298
function.stats-harmonic-mean.php                   30-Sep-2022 11:02                2645
function.stats-kurtosis.php                        30-Sep-2022 11:02                2562
function.stats-rand-gen-beta.php                   30-Sep-2022 11:02                2866
function.stats-rand-gen-chisquare.php              30-Sep-2022 11:02                2593
function.stats-rand-gen-exponential.php            30-Sep-2022 11:02                2591
function.stats-rand-gen-f.php                      30-Sep-2022 11:02                2920
function.stats-rand-gen-funiform.php               30-Sep-2022 11:02                2847
function.stats-rand-gen-gamma.php                  30-Sep-2022 11:02                2933
function.stats-rand-gen-ibinomial-negative.php     30-Sep-2022 11:02                3013
function.stats-rand-gen-ibinomial.php              30-Sep-2022 11:02                2937
function.stats-rand-gen-int.php                    30-Sep-2022 11:02                2218
function.stats-rand-gen-ipoisson.php               30-Sep-2022 11:02                2566
function.stats-rand-gen-iuniform.php               30-Sep-2022 11:02                2914
function.stats-rand-gen-noncentral-chisquare.php   30-Sep-2022 11:02                3055
function.stats-rand-gen-noncentral-f.php           30-Sep-2022 11:02                3354
function.stats-rand-gen-noncentral-t.php           30-Sep-2022 11:02                2968
function.stats-rand-gen-normal.php                 30-Sep-2022 11:02                2881
function.stats-rand-gen-t.php                      30-Sep-2022 11:02                2485
function.stats-rand-get-seeds.php                  30-Sep-2022 11:02                2261
function.stats-rand-phrase-to-seeds.php            30-Sep-2022 11:02                2572
function.stats-rand-ranf.php                       30-Sep-2022 11:02                2262
function.stats-rand-setall.php                     30-Sep-2022 11:02                2822
function.stats-skew.php                            30-Sep-2022 11:02                2528
function.stats-standard-deviation.php              30-Sep-2022 11:02                3412
function.stats-stat-binomial-coef.php              30-Sep-2022 11:02                2826
function.stats-stat-correlation.php                30-Sep-2022 11:02                2981
function.stats-stat-factorial.php                  30-Sep-2022 11:02                2453
function.stats-stat-independent-t.php              30-Sep-2022 11:02                3099
function.stats-stat-innerproduct.php               30-Sep-2022 11:02                2923
function.stats-stat-paired-t.php                   30-Sep-2022 11:02                2860
function.stats-stat-percentile.php                 30-Sep-2022 11:02                2778
function.stats-stat-powersum.php                   30-Sep-2022 11:02                2770
function.stats-variance.php                        30-Sep-2022 11:02                2982
function.stomp-connect-error.php                   30-Sep-2022 11:02                3631
function.stomp-version.php                         30-Sep-2022 11:02                3043
function.str-contains.php                          30-Sep-2022 11:02                8520
function.str-ends-with.php                         30-Sep-2022 11:02                8395
function.str-getcsv.php                            30-Sep-2022 11:02                5975
function.str-ireplace.php                          30-Sep-2022 11:02                6248
function.str-pad.php                               30-Sep-2022 11:02                6336
function.str-repeat.php                            30-Sep-2022 11:02                4610
function.str-replace.php                           30-Sep-2022 11:02               15434
function.str-rot13.php                             30-Sep-2022 11:02                3551
function.str-shuffle.php                           30-Sep-2022 11:02                4110
function.str-split.php                             30-Sep-2022 11:02                6581
function.str-starts-with.php                       30-Sep-2022 11:02                8425
function.str-word-count.php                        30-Sep-2022 11:02                8581
function.strcasecmp.php                            30-Sep-2022 11:02                4095
function.strchr.php                                30-Sep-2022 11:02                1651
function.strcmp.php                                30-Sep-2022 11:02                2876
function.strcoll.php                               30-Sep-2022 11:02                3809
function.strcspn.php                               30-Sep-2022 11:02                4055
function.stream-bucket-append.php                  30-Sep-2022 11:02                2138
function.stream-bucket-make-writeable.php          30-Sep-2022 11:02                4090
function.stream-bucket-new.php                     30-Sep-2022 11:02                2122
function.stream-bucket-prepend.php                 30-Sep-2022 11:02                6626
function.stream-context-create.php                 30-Sep-2022 11:02                7573
function.stream-context-get-default.php            30-Sep-2022 11:02                9188
function.stream-context-get-options.php            30-Sep-2022 11:02                4471
function.stream-context-get-params.php             30-Sep-2022 11:02                5325
function.stream-context-set-default.php            30-Sep-2022 11:02                6470
function.stream-context-set-option.php             30-Sep-2022 11:02                5054
function.stream-context-set-params.php             30-Sep-2022 11:02                4420
function.stream-copy-to-stream.php                 30-Sep-2022 11:02                7377
function.stream-filter-append.php                  30-Sep-2022 11:02               10889
function.stream-filter-prepend.php                 30-Sep-2022 11:02                7654
function.stream-filter-register.php                30-Sep-2022 11:02               19811
function.stream-filter-remove.php                  30-Sep-2022 11:02                6576
function.stream-get-contents.php                   30-Sep-2022 11:02                8307
function.stream-get-filters.php                    30-Sep-2022 11:02                4006
function.stream-get-line.php                       30-Sep-2022 11:02                4780
function.stream-get-meta-data.php                  30-Sep-2022 11:02               14937
function.stream-get-transports.php                 30-Sep-2022 11:02                3992
function.stream-get-wrappers.php                   30-Sep-2022 11:02                4891
function.stream-is-local.php                       30-Sep-2022 11:02                3897
function.stream-isatty.php                         30-Sep-2022 11:02                3773
function.stream-notification-callback.php          30-Sep-2022 11:02               25288
function.stream-register-wrapper.php               30-Sep-2022 11:02                1910
function.stream-resolve-include-path.php           30-Sep-2022 11:02                4086
function.stream-select.php                         30-Sep-2022 11:02               15867
function.stream-set-blocking.php                   30-Sep-2022 11:02                4454
function.stream-set-chunk-size.php                 30-Sep-2022 11:02                3184
function.stream-set-read-buffer.php                30-Sep-2022 11:02                3577
function.stream-set-timeout.php                    30-Sep-2022 11:02                8152
function.stream-set-write-buffer.php               30-Sep-2022 11:02                5852
function.stream-socket-accept.php                  30-Sep-2022 11:02                7312
function.stream-socket-client.php                  30-Sep-2022 11:02               17291
function.stream-socket-enable-crypto.php           30-Sep-2022 11:02               11233
function.stream-socket-get-name.php                30-Sep-2022 11:02                3549
function.stream-socket-pair.php                    30-Sep-2022 11:02                9098
function.stream-socket-recvfrom.php                30-Sep-2022 11:02               10740
function.stream-socket-sendto.php                  30-Sep-2022 11:02                7321
function.stream-socket-server.php                  30-Sep-2022 11:02               15222
function.stream-socket-shutdown.php                30-Sep-2022 11:02                6218
function.stream-supports-lock.php                  30-Sep-2022 11:02                3038
function.stream-wrapper-register.php               30-Sep-2022 11:02                9135
function.stream-wrapper-restore.php                30-Sep-2022 11:02                2706
function.stream-wrapper-unregister.php             30-Sep-2022 11:02                2907
function.strftime.php                              30-Sep-2022 11:02               59946
function.strip-tags.php                            30-Sep-2022 11:02                6802
function.stripcslashes.php                         30-Sep-2022 11:02                2957
function.stripos.php                               30-Sep-2022 11:02                7941
function.stripslashes.php                          30-Sep-2022 11:02                8130
function.stristr.php                               30-Sep-2022 11:02                9207
function.strlen.php                                30-Sep-2022 11:02                4325
function.strnatcasecmp.php                         30-Sep-2022 11:02                3717
function.strnatcmp.php                             30-Sep-2022 11:02                6377
function.strncasecmp.php                           30-Sep-2022 11:02                4721
function.strncmp.php                               30-Sep-2022 11:02                3516
function.strpbrk.php                               30-Sep-2022 11:02                4446
function.strpos.php                                30-Sep-2022 11:02                6854
function.strptime.php                              30-Sep-2022 11:02               10794
function.strrchr.php                               30-Sep-2022 11:02                4952
function.strrev.php                                30-Sep-2022 11:02                3101
function.strripos.php                              30-Sep-2022 11:02                8464
function.strrpos.php                               30-Sep-2022 11:02                7627
function.strspn.php                                30-Sep-2022 11:02                6068
function.strstr.php                                30-Sep-2022 11:02                7883
function.strtok.php                                30-Sep-2022 11:02                9800
function.strtolower.php                            30-Sep-2022 11:02                5059
function.strtotime.php                             30-Sep-2022 11:02               12867
function.strtoupper.php                            30-Sep-2022 11:02                5048
function.strtr.php                                 30-Sep-2022 11:02                7364
function.strval.php                                30-Sep-2022 11:02                6421
function.substr-compare.php                        30-Sep-2022 11:02               10333
function.substr-count.php                          30-Sep-2022 11:02                9221
function.substr-replace.php                        30-Sep-2022 11:02               10686
function.substr.php                                30-Sep-2022 11:02               22614
function.svn-add.php                               30-Sep-2022 11:02                5903
function.svn-auth-get-parameter.php                30-Sep-2022 11:02                3806
function.svn-auth-set-parameter.php                30-Sep-2022 11:02                5304
function.svn-blame.php                             30-Sep-2022 11:02                4806
function.svn-cat.php                               30-Sep-2022 11:02                4645
function.svn-checkout.php                          30-Sep-2022 11:02                7119
function.svn-cleanup.php                           30-Sep-2022 11:02                4993
function.svn-client-version.php                    30-Sep-2022 11:02                3391
function.svn-commit.php                            30-Sep-2022 11:02                7705
function.svn-delete.php                            30-Sep-2022 11:02                4313
function.svn-diff.php                              30-Sep-2022 11:02               13294
function.svn-export.php                            30-Sep-2022 11:02                4948
function.svn-fs-abort-txn.php                      30-Sep-2022 11:02                2964
function.svn-fs-apply-text.php                     30-Sep-2022 11:02                2575
function.svn-fs-begin-txn2.php                     30-Sep-2022 11:02                2520
function.svn-fs-change-node-prop.php               30-Sep-2022 11:02                2931
function.svn-fs-check-path.php                     30-Sep-2022 11:02                2626
function.svn-fs-contents-changed.php               30-Sep-2022 11:02                2932
function.svn-fs-copy.php                           30-Sep-2022 11:02                3785
function.svn-fs-delete.php                         30-Sep-2022 11:02                3186
function.svn-fs-dir-entries.php                    30-Sep-2022 11:02                2639
function.svn-fs-file-contents.php                  30-Sep-2022 11:02                2656
function.svn-fs-file-length.php                    30-Sep-2022 11:02                2585
function.svn-fs-is-dir.php                         30-Sep-2022 11:02                3232
function.svn-fs-is-file.php                        30-Sep-2022 11:02                3220
function.svn-fs-make-dir.php                       30-Sep-2022 11:02                3210
function.svn-fs-make-file.php                      30-Sep-2022 11:02                3227
function.svn-fs-node-created-rev.php               30-Sep-2022 11:02                2628
function.svn-fs-node-prop.php                      30-Sep-2022 11:02                2664
function.svn-fs-props-changed.php                  30-Sep-2022 11:02                2919
function.svn-fs-revision-prop.php                  30-Sep-2022 11:02                2679
function.svn-fs-revision-root.php                  30-Sep-2022 11:02                2603
function.svn-fs-txn-root.php                       30-Sep-2022 11:02                2426
function.svn-fs-youngest-rev.php                   30-Sep-2022 11:02                2474
function.svn-import.php                            30-Sep-2022 11:02                5730
function.svn-log.php                               30-Sep-2022 11:02                8693
function.svn-ls.php                                30-Sep-2022 11:02                6962
function.svn-mkdir.php                             30-Sep-2022 11:02                3028
function.svn-repos-create.php                      30-Sep-2022 11:02                2734
function.svn-repos-fs-begin-txn-for-commit.php     30-Sep-2022 11:02                2988
function.svn-repos-fs-commit-txn.php               30-Sep-2022 11:02                2529
function.svn-repos-fs.php                          30-Sep-2022 11:02                2423
function.svn-repos-hotcopy.php                     30-Sep-2022 11:02                2682
function.svn-repos-open.php                        30-Sep-2022 11:02                2399
function.svn-repos-recover.php                     30-Sep-2022 11:02                2448
function.svn-revert.php                            30-Sep-2022 11:02                3318
function.svn-status.php                            30-Sep-2022 11:02               14501
function.svn-update.php                            30-Sep-2022 11:02                5847
function.swoole-async-dns-lookup.php               30-Sep-2022 11:02                3585
function.swoole-async-read.php                     30-Sep-2022 11:02                4175
function.swoole-async-readfile.php                 30-Sep-2022 11:02                3595
function.swoole-async-set.php                      30-Sep-2022 11:02                2336
function.swoole-async-write.php                    30-Sep-2022 11:02                3435
function.swoole-async-writefile.php                30-Sep-2022 11:02                3463
function.swoole-clear-error.php                    30-Sep-2022 11:02                2253
function.swoole-client-select.php                  30-Sep-2022 11:02                3222
function.swoole-cpu-num.php                        30-Sep-2022 11:02                2070
function.swoole-errno.php                          30-Sep-2022 11:02                2047
function.swoole-error-log.php                      30-Sep-2022 11:02                3003
function.swoole-event-add.php                      30-Sep-2022 11:02                3345
function.swoole-event-defer.php                    30-Sep-2022 11:02                2484
function.swoole-event-del.php                      30-Sep-2022 11:02                2392
function.swoole-event-exit.php                     30-Sep-2022 11:02                2146
function.swoole-event-set.php                      30-Sep-2022 11:02                3332
function.swoole-event-wait.php                     30-Sep-2022 11:02                2117
function.swoole-event-write.php                    30-Sep-2022 11:02                2608
function.swoole-get-local-ip.php                   30-Sep-2022 11:02                2141
function.swoole-last-error.php                     30-Sep-2022 11:02                2096
function.swoole-load-module.php                    30-Sep-2022 11:02                2293
function.swoole-select.php                         30-Sep-2022 11:02                3189
function.swoole-set-process-name.php               30-Sep-2022 11:02                2497
function.swoole-strerror.php                       30-Sep-2022 11:02                2418
function.swoole-timer-after.php                    30-Sep-2022 11:02                2951
function.swoole-timer-exists.php                   30-Sep-2022 11:02                2314
function.swoole-timer-tick.php                     30-Sep-2022 11:02                2824
function.swoole-version.php                        30-Sep-2022 11:02                2073
function.symlink.php                               30-Sep-2022 11:02                3767
function.sys-get-temp-dir.php                      30-Sep-2022 11:02                4188
function.sys-getloadavg.php                        30-Sep-2022 11:02                4095
function.syslog.php                                30-Sep-2022 11:02                9066
function.system.php                                30-Sep-2022 11:02                8483
function.taint.php                                 30-Sep-2022 11:02                2500
function.tan.php                                   30-Sep-2022 11:02                4351
function.tanh.php                                  30-Sep-2022 11:02                3192
function.tcpwrap-check.php                         30-Sep-2022 11:02                5408
function.tempnam.php                               30-Sep-2022 11:02                5885
function.textdomain.php                            30-Sep-2022 11:02                2190
function.tidy-access-count.php                     30-Sep-2022 11:02                6485
function.tidy-config-count.php                     30-Sep-2022 11:02                4340
function.tidy-error-count.php                      30-Sep-2022 11:02                5302
function.tidy-get-output.php                       30-Sep-2022 11:02                4197
function.tidy-warning-count.php                    30-Sep-2022 11:02                4905
function.time-nanosleep.php                        30-Sep-2022 11:02                8679
function.time-sleep-until.php                      30-Sep-2022 11:02                5577
function.time.php                                  30-Sep-2022 11:02                5671
function.timezone-abbreviations-list.php           30-Sep-2022 11:02                1915
function.timezone-identifiers-list.php             30-Sep-2022 11:02                1931
function.timezone-location-get.php                 30-Sep-2022 11:02                1887
function.timezone-name-from-abbr.php               30-Sep-2022 11:02                5989
function.timezone-name-get.php                     30-Sep-2022 11:02                1831
function.timezone-offset-get.php                   30-Sep-2022 11:02                1829
function.timezone-open.php                         30-Sep-2022 11:02                1721
function.timezone-transitions-get.php              30-Sep-2022 11:02                1890
function.timezone-version-get.php                  30-Sep-2022 11:02                3190
function.tmpfile.php                               30-Sep-2022 11:02                5198
function.token-get-all.php                         30-Sep-2022 11:02                7333
function.token-name.php                            30-Sep-2022 11:02                4191
function.touch.php                                 30-Sep-2022 11:02                5246
function.trader-acos.php                           30-Sep-2022 11:02                2372
function.trader-ad.php                             30-Sep-2022 11:02                3147
function.trader-add.php                            30-Sep-2022 11:02                2639
function.trader-adosc.php                          30-Sep-2022 11:02                3913
function.trader-adx.php                            30-Sep-2022 11:02                3234
function.trader-adxr.php                           30-Sep-2022 11:02                3245
function.trader-apo.php                            30-Sep-2022 11:02                3411
function.trader-aroon.php                          30-Sep-2022 11:02                2837
function.trader-aroonosc.php                       30-Sep-2022 11:02                2874
function.trader-asin.php                           30-Sep-2022 11:02                2375
function.trader-atan.php                           30-Sep-2022 11:02                2368
function.trader-atr.php                            30-Sep-2022 11:02                3224
function.trader-avgprice.php                       30-Sep-2022 11:02                3206
function.trader-bbands.php                         30-Sep-2022 11:02                4126
function.trader-beta.php                           30-Sep-2022 11:02                2796
function.trader-bop.php                            30-Sep-2022 11:02                3155
function.trader-cci.php                            30-Sep-2022 11:02                3229
function.trader-cdl2crows.php                      30-Sep-2022 11:02                3228
function.trader-cdl3blackcrows.php                 30-Sep-2022 11:02                3290
function.trader-cdl3inside.php                     30-Sep-2022 11:02                3271
function.trader-cdl3linestrike.php                 30-Sep-2022 11:02                3294
function.trader-cdl3outside.php                    30-Sep-2022 11:02                3286
function.trader-cdl3starsinsouth.php               30-Sep-2022 11:02                3335
function.trader-cdl3whitesoldiers.php              30-Sep-2022 11:02                3359
function.trader-cdlabandonedbaby.php               30-Sep-2022 11:02                3691
function.trader-cdladvanceblock.php                30-Sep-2022 11:02                3312
function.trader-cdlbelthold.php                    30-Sep-2022 11:02                3268
function.trader-cdlbreakaway.php                   30-Sep-2022 11:02                3282
function.trader-cdlclosingmarubozu.php             30-Sep-2022 11:02                3353
function.trader-cdlconcealbabyswall.php            30-Sep-2022 11:02                3376
function.trader-cdlcounterattack.php               30-Sep-2022 11:02                3340
function.trader-cdldarkcloudcover.php              30-Sep-2022 11:02                3685
function.trader-cdldoji.php                        30-Sep-2022 11:02                3225
function.trader-cdldojistar.php                    30-Sep-2022 11:02                3260
function.trader-cdldragonflydoji.php               30-Sep-2022 11:02                3315
function.trader-cdlengulfing.php                   30-Sep-2022 11:02                3300
function.trader-cdleveningdojistar.php             30-Sep-2022 11:02                3702
function.trader-cdleveningstar.php                 30-Sep-2022 11:02                3679
function.trader-cdlgapsidesidewhite.php            30-Sep-2022 11:02                3383
function.trader-cdlgravestonedoji.php              30-Sep-2022 11:02                3336
function.trader-cdlhammer.php                      30-Sep-2022 11:02                3251
function.trader-cdlhangingman.php                  30-Sep-2022 11:02                3272
function.trader-cdlharami.php                      30-Sep-2022 11:02                3253
function.trader-cdlharamicross.php                 30-Sep-2022 11:02                3295
function.trader-cdlhighwave.php                    30-Sep-2022 11:02                3269
function.trader-cdlhikkake.php                     30-Sep-2022 11:02                3258
function.trader-cdlhikkakemod.php                  30-Sep-2022 11:02                3299
function.trader-cdlhomingpigeon.php                30-Sep-2022 11:02                3320
function.trader-cdlidentical3crows.php             30-Sep-2022 11:02                3344
function.trader-cdlinneck.php                      30-Sep-2022 11:02                3270
function.trader-cdlinvertedhammer.php              30-Sep-2022 11:02                3318
function.trader-cdlkicking.php                     30-Sep-2022 11:02                3272
function.trader-cdlkickingbylength.php             30-Sep-2022 11:02                3378
function.trader-cdlladderbottom.php                30-Sep-2022 11:02                3328
function.trader-cdllongleggeddoji.php              30-Sep-2022 11:02                3333
function.trader-cdllongline.php                    30-Sep-2022 11:02                3277
function.trader-cdlmarubozu.php                    30-Sep-2022 11:02                3263
function.trader-cdlmatchinglow.php                 30-Sep-2022 11:02                3289
function.trader-cdlmathold.php                     30-Sep-2022 11:02                3625
function.trader-cdlmorningdojistar.php             30-Sep-2022 11:02                3698
function.trader-cdlmorningstar.php                 30-Sep-2022 11:02                3659
function.trader-cdlonneck.php                      30-Sep-2022 11:02                3250
function.trader-cdlpiercing.php                    30-Sep-2022 11:02                3267
function.trader-cdlrickshawman.php                 30-Sep-2022 11:02                3307
function.trader-cdlrisefall3methods.php            30-Sep-2022 11:02                3377
function.trader-cdlseparatinglines.php             30-Sep-2022 11:02                3359
function.trader-cdlshootingstar.php                30-Sep-2022 11:02                3318
function.trader-cdlshortline.php                   30-Sep-2022 11:02                3290
function.trader-cdlspinningtop.php                 30-Sep-2022 11:02                3305
function.trader-cdlstalledpattern.php              30-Sep-2022 11:02                3340
function.trader-cdlsticksandwich.php               30-Sep-2022 11:02                3321
function.trader-cdltakuri.php                      30-Sep-2022 11:02                3292
function.trader-cdltasukigap.php                   30-Sep-2022 11:02                3267
function.trader-cdlthrusting.php                   30-Sep-2022 11:02                3276
function.trader-cdltristar.php                     30-Sep-2022 11:02                3264
function.trader-cdlunique3river.php                30-Sep-2022 11:02                3315
function.trader-cdlupsidegap2crows.php             30-Sep-2022 11:02                3363
function.trader-cdlxsidegap3methods.php            30-Sep-2022 11:02                3362
function.trader-ceil.php                           30-Sep-2022 11:02                2392
function.trader-cmo.php                            30-Sep-2022 11:02                2561
function.trader-correl.php                         30-Sep-2022 11:02                2848
function.trader-cos.php                            30-Sep-2022 11:02                2358
function.trader-cosh.php                           30-Sep-2022 11:02                2374
function.trader-dema.php                           30-Sep-2022 11:02                2572
function.trader-div.php                            30-Sep-2022 11:02                2655
function.trader-dx.php                             30-Sep-2022 11:02                3210
function.trader-ema.php                            30-Sep-2022 11:02                2555
function.trader-errno.php                          30-Sep-2022 11:02                2140
function.trader-exp.php                            30-Sep-2022 11:02                2402
function.trader-floor.php                          30-Sep-2022 11:02                2384
function.trader-get-compat.php                     30-Sep-2022 11:02                2330
function.trader-get-unstable-period.php            30-Sep-2022 11:02                2604
function.trader-ht-dcperiod.php                    30-Sep-2022 11:02                2372
function.trader-ht-dcphase.php                     30-Sep-2022 11:02                2343
function.trader-ht-phasor.php                      30-Sep-2022 11:02                2324
function.trader-ht-sine.php                        30-Sep-2022 11:02                2303
function.trader-ht-trendline.php                   30-Sep-2022 11:02                2364
function.trader-ht-trendmode.php                   30-Sep-2022 11:02                2354
function.trader-kama.php                           30-Sep-2022 11:02                2610
function.trader-linearreg-angle.php                30-Sep-2022 11:02                2704
function.trader-linearreg-intercept.php            30-Sep-2022 11:02                2762
function.trader-linearreg-slope.php                30-Sep-2022 11:02                2714
function.trader-linearreg.php                      30-Sep-2022 11:02                2626
function.trader-ln.php                             30-Sep-2022 11:02                2360
function.trader-log10.php                          30-Sep-2022 11:02                2364
function.trader-ma.php                             30-Sep-2022 11:02                2921
function.trader-macd.php                           30-Sep-2022 11:02                3401
function.trader-macdext.php                        30-Sep-2022 11:02                4742
function.trader-macdfix.php                        30-Sep-2022 11:02                2654
function.trader-mama.php                           30-Sep-2022 11:02                2969
function.trader-mavp.php                           30-Sep-2022 11:02                3759
function.trader-max.php                            30-Sep-2022 11:02                2576
function.trader-maxindex.php                       30-Sep-2022 11:02                2633
function.trader-medprice.php                       30-Sep-2022 11:02                2552
function.trader-mfi.php                            30-Sep-2022 11:02                3524
function.trader-midpoint.php                       30-Sep-2022 11:02                2607
function.trader-midprice.php                       30-Sep-2022 11:02                2888
function.trader-min.php                            30-Sep-2022 11:02                2583
function.trader-minindex.php                       30-Sep-2022 11:02                2628
function.trader-minmax.php                         30-Sep-2022 11:02                2632
function.trader-minmaxindex.php                    30-Sep-2022 11:02                2683
function.trader-minus-di.php                       30-Sep-2022 11:02                3297
function.trader-minus-dm.php                       30-Sep-2022 11:02                2888
function.trader-mom.php                            30-Sep-2022 11:02                2547
function.trader-mult.php                           30-Sep-2022 11:02                2655
function.trader-natr.php                           30-Sep-2022 11:02                3235
function.trader-obv.php                            30-Sep-2022 11:02                2499
function.trader-plus-di.php                        30-Sep-2022 11:02                3268
function.trader-plus-dm.php                        30-Sep-2022 11:02                2875
function.trader-ppo.php                            30-Sep-2022 11:02                3415
function.trader-roc.php                            30-Sep-2022 11:02                2571
function.trader-rocp.php                           30-Sep-2022 11:02                2599
function.trader-rocr.php                           30-Sep-2022 11:02                2584
function.trader-rocr100.php                        30-Sep-2022 11:02                2624
function.trader-rsi.php                            30-Sep-2022 11:02                2552
function.trader-sar.php                            30-Sep-2022 11:02                3459
function.trader-sarext.php                         30-Sep-2022 11:02                6547
function.trader-set-compat.php                     30-Sep-2022 11:02                2545
function.trader-set-unstable-period.php            30-Sep-2022 11:02                3079
function.trader-sin.php                            30-Sep-2022 11:02                2382
function.trader-sinh.php                           30-Sep-2022 11:02                2370
function.trader-sma.php                            30-Sep-2022 11:02                2552
function.trader-sqrt.php                           30-Sep-2022 11:02                2363
function.trader-stddev.php                         30-Sep-2022 11:02                2842
function.trader-stoch.php                          30-Sep-2022 11:02                4897
function.trader-stochf.php                         30-Sep-2022 11:02                4101
function.trader-stochrsi.php                       30-Sep-2022 11:02                3873
function.trader-sub.php                            30-Sep-2022 11:02                2660
function.trader-sum.php                            30-Sep-2022 11:02                2534
function.trader-t3.php                             30-Sep-2022 11:02                2854
function.trader-tan.php                            30-Sep-2022 11:02                2351
function.trader-tanh.php                           30-Sep-2022 11:02                2375
function.trader-tema.php                           30-Sep-2022 11:02                2578
function.trader-trange.php                         30-Sep-2022 11:02                2805
function.trader-trima.php                          30-Sep-2022 11:02                2580
function.trader-trix.php                           30-Sep-2022 11:02                2590
function.trader-tsf.php                            30-Sep-2022 11:02                2559
function.trader-typprice.php                       30-Sep-2022 11:02                2828
function.trader-ultosc.php                         30-Sep-2022 11:02                3978
function.trader-var.php                            30-Sep-2022 11:02                2812
function.trader-wclprice.php                       30-Sep-2022 11:02                2833
function.trader-willr.php                          30-Sep-2022 11:02                3241
function.trader-wma.php                            30-Sep-2022 11:02                2583
function.trait-exists.php                          30-Sep-2022 11:02                2769
function.trigger-error.php                         30-Sep-2022 11:02                6413
function.trim.php                                  30-Sep-2022 11:02               12043
function.uasort.php                                30-Sep-2022 11:02                4933
function.ucfirst.php                               30-Sep-2022 11:02                5375
function.ucwords.php                               30-Sep-2022 11:02                8287
function.ui-draw-text-font-fontfamilies.php        30-Sep-2022 11:02                2297
function.ui-quit.php                               30-Sep-2022 11:02                2013
function.ui-run.php                                30-Sep-2022 11:02                2337
function.uksort.php                                30-Sep-2022 11:02                6651
function.umask.php                                 30-Sep-2022 11:02                4991
function.uniqid.php                                30-Sep-2022 11:02                4665
function.unixtojd.php                              30-Sep-2022 11:02                2903
function.unlink.php                                30-Sep-2022 11:02                5761
function.unpack.php                                30-Sep-2022 11:02               10196
function.unregister-tick-function.php              30-Sep-2022 11:02                3203
function.unserialize.php                           30-Sep-2022 11:02               15993
function.unset.php                                 30-Sep-2022 11:02               13869
function.untaint.php                               30-Sep-2022 11:02                2356
function.uopz-add-function.php                     30-Sep-2022 11:02                6574
function.uopz-allow-exit.php                       30-Sep-2022 11:02                4553
function.uopz-backup.php                           30-Sep-2022 11:02                4367
function.uopz-compose.php                          30-Sep-2022 11:02                6864
function.uopz-copy.php                             30-Sep-2022 11:02                5079
function.uopz-del-function.php                     30-Sep-2022 11:02                6107
function.uopz-delete.php                           30-Sep-2022 11:02                5854
function.uopz-extend.php                           30-Sep-2022 11:02                4738
function.uopz-flags.php                            30-Sep-2022 11:02               10687
function.uopz-function.php                         30-Sep-2022 11:02                7052
function.uopz-get-exit-status.php                  30-Sep-2022 11:02                4183
function.uopz-get-hook.php                         30-Sep-2022 11:02                5180
function.uopz-get-mock.php                         30-Sep-2022 11:02                5126
function.uopz-get-property.php                     30-Sep-2022 11:02                6113
function.uopz-get-return.php                       30-Sep-2022 11:02                4329
function.uopz-get-static.php                       30-Sep-2022 11:02                4803
function.uopz-implement.php                        30-Sep-2022 11:02                4763
function.uopz-overload.php                         30-Sep-2022 11:02                3852
function.uopz-redefine.php                         30-Sep-2022 11:02                4816
function.uopz-rename.php                           30-Sep-2022 11:02                6532
function.uopz-restore.php                          30-Sep-2022 11:02                4732
function.uopz-set-hook.php                         30-Sep-2022 11:02                5342
function.uopz-set-mock.php                         30-Sep-2022 11:02               12553
function.uopz-set-property.php                     30-Sep-2022 11:02                7568
function.uopz-set-return.php                       30-Sep-2022 11:02                9357
function.uopz-set-static.php                       30-Sep-2022 11:02                5443
function.uopz-undefine.php                         30-Sep-2022 11:02                4278
function.uopz-unset-hook.php                       30-Sep-2022 11:02                5236
function.uopz-unset-mock.php                       30-Sep-2022 11:02                5454
function.uopz-unset-return.php                     30-Sep-2022 11:02                4625
function.urldecode.php                             30-Sep-2022 11:02                6450
function.urlencode.php                             30-Sep-2022 11:02                5951
function.use-soap-error-handler.php                30-Sep-2022 11:02                3703
function.user-error.php                            30-Sep-2022 11:02                1745
function.usleep.php                                30-Sep-2022 11:02                5200
function.usort.php                                 30-Sep-2022 11:02               17875
function.utf8-decode.php                           30-Sep-2022 11:02                9056
function.utf8-encode.php                           30-Sep-2022 11:02                7406
function.var-dump.php                              30-Sep-2022 11:02                6609
function.var-export.php                            30-Sep-2022 11:02               18134
function.var-representation.php                    30-Sep-2022 11:02               14365
function.variant-abs.php                           30-Sep-2022 11:02                4187
function.variant-add.php                           30-Sep-2022 11:02                5560
function.variant-and.php                           30-Sep-2022 11:02                6264
function.variant-cast.php                          30-Sep-2022 11:02                3488
function.variant-cat.php                           30-Sep-2022 11:02                4780
function.variant-cmp.php                           30-Sep-2022 11:02                7217
function.variant-date-from-timestamp.php           30-Sep-2022 11:02                3545
function.variant-date-to-timestamp.php             30-Sep-2022 11:02                3620
function.variant-div.php                           30-Sep-2022 11:02                6356
function.variant-eqv.php                           30-Sep-2022 11:02                4381
function.variant-fix.php                           30-Sep-2022 11:02                5606
function.variant-get-type.php                      30-Sep-2022 11:02                3421
function.variant-idiv.php                          30-Sep-2022 11:02                5779
function.variant-imp.php                           30-Sep-2022 11:02                5801
function.variant-int.php                           30-Sep-2022 11:02                5106
function.variant-mod.php                           30-Sep-2022 11:02                4855
function.variant-mul.php                           30-Sep-2022 11:02                5864
function.variant-neg.php                           30-Sep-2022 11:02                3841
function.variant-not.php                           30-Sep-2022 11:02                4005
function.variant-or.php                            30-Sep-2022 11:02                6439
function.variant-pow.php                           30-Sep-2022 11:02                4677
function.variant-round.php                         30-Sep-2022 11:02                4375
function.variant-set-type.php                      30-Sep-2022 11:02                3611
function.variant-set.php                           30-Sep-2022 11:02                2910
function.variant-sub.php                           30-Sep-2022 11:02                5522
function.variant-xor.php                           30-Sep-2022 11:02                5791
function.version-compare.php                       30-Sep-2022 11:02               11373
function.vfprintf.php                              30-Sep-2022 11:02                6151
function.virtual.php                               30-Sep-2022 11:02                5236
function.vprintf.php                               30-Sep-2022 11:02                3757
function.vsprintf.php                              30-Sep-2022 11:02                3535
function.wddx-add-vars.php                         30-Sep-2022 11:02                3520
function.wddx-deserialize.php                      30-Sep-2022 11:02                1678
function.wddx-packet-end.php                       30-Sep-2022 11:02                2520
function.wddx-packet-start.php                     30-Sep-2022 11:02                2710
function.wddx-serialize-value.php                  30-Sep-2022 11:02                2931
function.wddx-serialize-vars.php                   30-Sep-2022 11:02                5873
function.win32-continue-service.php                30-Sep-2022 11:02                6404
function.win32-create-service.php                  30-Sep-2022 11:02               32907
function.win32-delete-service.php                  30-Sep-2022 11:02                6821
function.win32-get-last-control-message.php        30-Sep-2022 11:02                7112
function.win32-pause-service.php                   30-Sep-2022 11:02                6390
function.win32-query-service-status.php            30-Sep-2022 11:02                8297
function.win32-send-custom-control.php             30-Sep-2022 11:02                6945
function.win32-set-service-exit-code.php           30-Sep-2022 11:02                5655
function.win32-set-service-exit-mode.php           30-Sep-2022 11:02                5698
function.win32-set-service-status.php              30-Sep-2022 11:02                8098
function.win32-start-service-ctrl-dispatcher.php   30-Sep-2022 11:02               10984
function.win32-start-service.php                   30-Sep-2022 11:02                6394
function.win32-stop-service.php                    30-Sep-2022 11:02                6331
function.wincache-fcache-fileinfo.php              30-Sep-2022 11:02                9160
function.wincache-fcache-meminfo.php               30-Sep-2022 11:02                7080
function.wincache-lock.php                         30-Sep-2022 11:02                8558
function.wincache-ocache-fileinfo.php              30-Sep-2022 11:02                9835
function.wincache-ocache-meminfo.php               30-Sep-2022 11:02                7292
function.wincache-refresh-if-changed.php           30-Sep-2022 11:02                7836
function.wincache-rplist-fileinfo.php              30-Sep-2022 11:02                7515
function.wincache-rplist-meminfo.php               30-Sep-2022 11:02                7195
function.wincache-scache-info.php                  30-Sep-2022 11:02                9418
function.wincache-scache-meminfo.php               30-Sep-2022 11:02                6653
function.wincache-ucache-add.php                   30-Sep-2022 11:02               13221
function.wincache-ucache-cas.php                   30-Sep-2022 11:02                6083
function.wincache-ucache-clear.php                 30-Sep-2022 11:02                7566
function.wincache-ucache-dec.php                   30-Sep-2022 11:02                6120
function.wincache-ucache-delete.php                30-Sep-2022 11:02               11447
function.wincache-ucache-exists.php                30-Sep-2022 11:02                6077
function.wincache-ucache-get.php                   30-Sep-2022 11:02               10530
function.wincache-ucache-inc.php                   30-Sep-2022 11:02                6112
function.wincache-ucache-info.php                  30-Sep-2022 11:02               11137
function.wincache-ucache-meminfo.php               30-Sep-2022 11:02                6857
function.wincache-ucache-set.php                   30-Sep-2022 11:02               13449
function.wincache-unlock.php                       30-Sep-2022 11:02                7927
function.wordwrap.php                              30-Sep-2022 11:02                7347
function.xattr-get.php                             30-Sep-2022 11:02                5875
function.xattr-list.php                            30-Sep-2022 11:02                6573
function.xattr-remove.php                          30-Sep-2022 11:02                6114
function.xattr-set.php                             30-Sep-2022 11:02                7678
function.xattr-supported.php                       30-Sep-2022 11:02                5219
function.xdiff-file-bdiff-size.php                 30-Sep-2022 11:02                4847
function.xdiff-file-bdiff.php                      30-Sep-2022 11:02                5685
function.xdiff-file-bpatch.php                     30-Sep-2022 11:02                6347
function.xdiff-file-diff-binary.php                30-Sep-2022 11:02                6126
function.xdiff-file-diff.php                       30-Sep-2022 11:02                6915
function.xdiff-file-merge3.php                     30-Sep-2022 11:02                6665
function.xdiff-file-patch-binary.php               30-Sep-2022 11:02                6498
function.xdiff-file-patch.php                      30-Sep-2022 11:02                8735
function.xdiff-file-rabdiff.php                    30-Sep-2022 11:02                6241
function.xdiff-string-bdiff-size.php               30-Sep-2022 11:02                5160
function.xdiff-string-bdiff.php                    30-Sep-2022 11:02                3651
function.xdiff-string-bpatch.php                   30-Sep-2022 11:02                3764
function.xdiff-string-diff-binary.php              30-Sep-2022 11:02                4160
function.xdiff-string-diff.php                     30-Sep-2022 11:02                7404
function.xdiff-string-merge3.php                   30-Sep-2022 11:02                4536
function.xdiff-string-patch-binary.php             30-Sep-2022 11:02                4317
function.xdiff-string-patch.php                    30-Sep-2022 11:02                8096
function.xdiff-string-rabdiff.php                  30-Sep-2022 11:02                4276
function.xhprof-disable.php                        30-Sep-2022 11:02                3873
function.xhprof-enable.php                         30-Sep-2022 11:02                7775
function.xhprof-sample-disable.php                 30-Sep-2022 11:02                4668
function.xhprof-sample-enable.php                  30-Sep-2022 11:02                3489
function.xml-error-string.php                      30-Sep-2022 11:02                3159
function.xml-get-current-byte-index.php            30-Sep-2022 11:02                3623
function.xml-get-current-column-number.php         30-Sep-2022 11:02                3545
function.xml-get-current-line-number.php           30-Sep-2022 11:02                3370
function.xml-get-error-code.php                    30-Sep-2022 11:02                3140
function.xml-parse-into-struct.php                 30-Sep-2022 11:02               20336
function.xml-parse.php                             30-Sep-2022 11:02                4570
function.xml-parser-create-ns.php                  30-Sep-2022 11:02                4528
function.xml-parser-create.php                     30-Sep-2022 11:02                3884
function.xml-parser-free.php                       30-Sep-2022 11:02                2654
function.xml-parser-get-option.php                 30-Sep-2022 11:02                3470
function.xml-parser-set-option.php                 30-Sep-2022 11:02                5357
function.xml-set-character-data-handler.php        30-Sep-2022 11:02                5713
function.xml-set-default-handler.php               30-Sep-2022 11:02                5585
function.xml-set-element-handler.php               30-Sep-2022 11:02                8364
function.xml-set-end-namespace-decl-handler.php    30-Sep-2022 11:02                6706
function.xml-set-external-entity-ref-handler.php   30-Sep-2022 11:02                8120
function.xml-set-notation-decl-handler.php         30-Sep-2022 11:02                7464
function.xml-set-object.php                        30-Sep-2022 11:02               10467
function.xml-set-processing-instruction-handler..> 30-Sep-2022 11:02                6713
function.xml-set-start-namespace-decl-handler.php  30-Sep-2022 11:02                6900
function.xml-set-unparsed-entity-decl-handler.php  30-Sep-2022 11:02                8090
function.xmlrpc-decode-request.php                 30-Sep-2022 11:02                2649
function.xmlrpc-decode.php                         30-Sep-2022 11:02                4068
function.xmlrpc-encode-request.php                 30-Sep-2022 11:02                8721
function.xmlrpc-encode.php                         30-Sep-2022 11:02                2325
function.xmlrpc-get-type.php                       30-Sep-2022 11:02                2433
function.xmlrpc-is-fault.php                       30-Sep-2022 11:02                3702
function.xmlrpc-parse-method-descriptions.php      30-Sep-2022 11:02                2435
function.xmlrpc-server-add-introspection-data.php  30-Sep-2022 11:02                2568
function.xmlrpc-server-call-method.php             30-Sep-2022 11:02                2959
function.xmlrpc-server-create.php                  30-Sep-2022 11:02                2196
function.xmlrpc-server-destroy.php                 30-Sep-2022 11:02                2346
function.xmlrpc-server-register-introspection-c..> 30-Sep-2022 11:02                2645
function.xmlrpc-server-register-method.php         30-Sep-2022 11:02                2658
function.xmlrpc-set-type.php                       30-Sep-2022 11:02                3332
function.yaml-emit-file.php                        30-Sep-2022 11:02                5838
function.yaml-emit.php                             30-Sep-2022 11:02               12823
function.yaml-parse-file.php                       30-Sep-2022 11:02                5702
function.yaml-parse-url.php                        30-Sep-2022 11:02                6030
function.yaml-parse.php                            30-Sep-2022 11:02                9963
function.yaz-addinfo.php                           30-Sep-2022 11:02                3314
function.yaz-ccl-conf.php                          30-Sep-2022 11:02                5663
function.yaz-ccl-parse.php                         30-Sep-2022 11:02                6593
function.yaz-close.php                             30-Sep-2022 11:02                3289
function.yaz-connect.php                           30-Sep-2022 11:02                8928
function.yaz-database.php                          30-Sep-2022 11:02                3154
function.yaz-element.php                           30-Sep-2022 11:02                3586
function.yaz-errno.php                             30-Sep-2022 11:02                3539
function.yaz-error.php                             30-Sep-2022 11:02                3292
function.yaz-es-result.php                         30-Sep-2022 11:02                3197
function.yaz-es.php                                30-Sep-2022 11:02                7120
function.yaz-get-option.php                        30-Sep-2022 11:02                3216
function.yaz-hits.php                              30-Sep-2022 11:02                4689
function.yaz-itemorder.php                         30-Sep-2022 11:02                6912
function.yaz-present.php                           30-Sep-2022 11:02                2786
function.yaz-range.php                             30-Sep-2022 11:02                3419
function.yaz-record.php                            30-Sep-2022 11:02               14196
function.yaz-scan-result.php                       30-Sep-2022 11:02                3840
function.yaz-scan.php                              30-Sep-2022 11:02                9716
function.yaz-schema.php                            30-Sep-2022 11:02                3307
function.yaz-search.php                            30-Sep-2022 11:02                8343
function.yaz-set-option.php                        30-Sep-2022 11:02                6667
function.yaz-sort.php                              30-Sep-2022 11:02                5476
function.yaz-syntax.php                            30-Sep-2022 11:02                3265
function.yaz-wait.php                              30-Sep-2022 11:02                3989
function.zend-thread-id.php                        30-Sep-2022 11:02                3706
function.zend-version.php                          30-Sep-2022 11:02                3917
function.zip-close.php                             30-Sep-2022 11:02                2998
function.zip-entry-close.php                       30-Sep-2022 11:02                3201
function.zip-entry-compressedsize.php              30-Sep-2022 11:02                3304
function.zip-entry-compressionmethod.php           30-Sep-2022 11:02                3378
function.zip-entry-filesize.php                    30-Sep-2022 11:02                3173
function.zip-entry-name.php                        30-Sep-2022 11:02                3116
function.zip-entry-open.php                        30-Sep-2022 11:02                4795
function.zip-entry-read.php                        30-Sep-2022 11:02                3876
function.zip-open.php                              30-Sep-2022 11:02                3266
function.zip-read.php                              30-Sep-2022 11:02                3581
function.zlib-decode.php                           30-Sep-2022 11:02                3209
function.zlib-encode.php                           30-Sep-2022 11:02                4971
function.zlib-get-coding-type.php                  30-Sep-2022 11:02                2551
function.zookeeper-dispatch.php                    30-Sep-2022 11:02                8657
functional.parallel.php                            30-Sep-2022 11:02                2544
functions.anonymous.php                            30-Sep-2022 11:01               26934
functions.arguments.php                            30-Sep-2022 11:01               48445
functions.arrow.php                                30-Sep-2022 11:01               11183
functions.first_class_callable_syntax.php          30-Sep-2022 11:01               12257
functions.internal.php                             30-Sep-2022 11:01                7730
functions.returning-values.php                     30-Sep-2022 11:01                6503
functions.user-defined.php                         30-Sep-2022 11:01               10402
functions.variable-functions.php                   30-Sep-2022 11:01               12868
gearman.configuration.php                          30-Sep-2022 11:02                1318
gearman.constants.php                              30-Sep-2022 11:02               17927
gearman.examples-reverse-bg.php                    30-Sep-2022 11:02               11679
gearman.examples-reverse-task.php                  30-Sep-2022 11:02               18858
gearman.examples-reverse.php                       30-Sep-2022 11:02               14299
gearman.examples.php                               30-Sep-2022 11:02                1559
gearman.installation.php                           30-Sep-2022 11:02                1618
gearman.requirements.php                           30-Sep-2022 11:02                1551
gearman.resources.php                              30-Sep-2022 11:02                1272
gearman.setup.php                                  30-Sep-2022 11:02                1659
gearmanclient.addoptions.php                       30-Sep-2022 11:02                2856
gearmanclient.addserver.php                        30-Sep-2022 11:02                4912
gearmanclient.addservers.php                       30-Sep-2022 11:02                4416
gearmanclient.addtask.php                          30-Sep-2022 11:02               15141
gearmanclient.addtaskbackground.php                30-Sep-2022 11:02               21448
gearmanclient.addtaskhigh.php                      30-Sep-2022 11:02               11262
gearmanclient.addtaskhighbackground.php            30-Sep-2022 11:02                5814
gearmanclient.addtasklow.php                       30-Sep-2022 11:02               11244
gearmanclient.addtasklowbackground.php             30-Sep-2022 11:02                5807
gearmanclient.addtaskstatus.php                    30-Sep-2022 11:02                9914
gearmanclient.clearcallbacks.php                   30-Sep-2022 11:02                4341
gearmanclient.clone.php                            30-Sep-2022 11:02                2576
gearmanclient.construct.php                        30-Sep-2022 11:02                2815
gearmanclient.context.php                          30-Sep-2022 11:02                2828
gearmanclient.data.php                             30-Sep-2022 11:02                3093
gearmanclient.do.php                               30-Sep-2022 11:02               23833
gearmanclient.dobackground.php                     30-Sep-2022 11:02                9679
gearmanclient.dohigh.php                           30-Sep-2022 11:02                4709
gearmanclient.dohighbackground.php                 30-Sep-2022 11:02                4536
gearmanclient.dojobhandle.php                      30-Sep-2022 11:02                2885
gearmanclient.dolow.php                            30-Sep-2022 11:02                4695
gearmanclient.dolowbackground.php                  30-Sep-2022 11:02                4518
gearmanclient.donormal.php                         30-Sep-2022 11:02               24221
gearmanclient.dostatus.php                         30-Sep-2022 11:02                8767
gearmanclient.echo.php                             30-Sep-2022 11:02                2746
gearmanclient.error.php                            30-Sep-2022 11:02                2573
gearmanclient.geterrno.php                         30-Sep-2022 11:02                2597
gearmanclient.jobstatus.php                        30-Sep-2022 11:02                8628
gearmanclient.ping.php                             30-Sep-2022 11:02                2719
gearmanclient.removeoptions.php                    30-Sep-2022 11:02                2502
gearmanclient.returncode.php                       30-Sep-2022 11:02                2226
gearmanclient.runtasks.php                         30-Sep-2022 11:02                3545
gearmanclient.setclientcallback.php                30-Sep-2022 11:02                5335
gearmanclient.setcompletecallback.php              30-Sep-2022 11:02                5172
gearmanclient.setcontext.php                       30-Sep-2022 11:02                3063
gearmanclient.setcreatedcallback.php               30-Sep-2022 11:02                4645
gearmanclient.setdata.php                          30-Sep-2022 11:02                3255
gearmanclient.setdatacallback.php                  30-Sep-2022 11:02                4696
gearmanclient.setexceptioncallback.php             30-Sep-2022 11:02                4616
gearmanclient.setfailcallback.php                  30-Sep-2022 11:02                4702
gearmanclient.setoptions.php                       30-Sep-2022 11:02                2488
gearmanclient.setstatuscallback.php                30-Sep-2022 11:02                4702
gearmanclient.settimeout.php                       30-Sep-2022 11:02                2530
gearmanclient.setwarningcallback.php               30-Sep-2022 11:02                4705
gearmanclient.setworkloadcallback.php              30-Sep-2022 11:02                4859
gearmanclient.timeout.php                          30-Sep-2022 11:02                2692
gearmanclient.wait.php                             30-Sep-2022 11:02                2635
gearmanjob.complete.php                            30-Sep-2022 11:02                3374
gearmanjob.construct.php                           30-Sep-2022 11:02                2318
gearmanjob.data.php                                30-Sep-2022 11:02                3334
gearmanjob.exception.php                           30-Sep-2022 11:02                3556
gearmanjob.fail.php                                30-Sep-2022 11:02                3551
gearmanjob.functionname.php                        30-Sep-2022 11:02                2618
gearmanjob.handle.php                              30-Sep-2022 11:02                2505
gearmanjob.returncode.php                          30-Sep-2022 11:02                2552
gearmanjob.sendcomplete.php                        30-Sep-2022 11:02                3095
gearmanjob.senddata.php                            30-Sep-2022 11:02                3062
gearmanjob.sendexception.php                       30-Sep-2022 11:02                3290
gearmanjob.sendfail.php                            30-Sep-2022 11:02                3270
gearmanjob.sendstatus.php                          30-Sep-2022 11:02                3753
gearmanjob.sendwarning.php                         30-Sep-2022 11:02                3286
gearmanjob.setreturn.php                           30-Sep-2022 11:02                2423
gearmanjob.status.php                              30-Sep-2022 11:02                4034
gearmanjob.unique.php                              30-Sep-2022 11:02                2757
gearmanjob.warning.php                             30-Sep-2022 11:02                3567
gearmanjob.workload.php                            30-Sep-2022 11:02                2763
gearmanjob.workloadsize.php                        30-Sep-2022 11:02                2568
gearmantask.construct.php                          30-Sep-2022 11:02                2338
gearmantask.create.php                             30-Sep-2022 11:02                2695
gearmantask.data.php                               30-Sep-2022 11:02                2559
gearmantask.datasize.php                           30-Sep-2022 11:02                2584
gearmantask.function.php                           30-Sep-2022 11:02                2568
gearmantask.functionname.php                       30-Sep-2022 11:02                2260
gearmantask.isknown.php                            30-Sep-2022 11:02                2275
gearmantask.isrunning.php                          30-Sep-2022 11:02                2279
gearmantask.jobhandle.php                          30-Sep-2022 11:02                2654
gearmantask.recvdata.php                           30-Sep-2022 11:02                3181
gearmantask.returncode.php                         30-Sep-2022 11:02                2579
gearmantask.senddata.php                           30-Sep-2022 11:02                3108
gearmantask.sendworkload.php                       30-Sep-2022 11:02                3141
gearmantask.taskdenominator.php                    30-Sep-2022 11:02                2777
gearmantask.tasknumerator.php                      30-Sep-2022 11:02                2749
gearmantask.unique.php                             30-Sep-2022 11:02                3007
gearmantask.uuid.php                               30-Sep-2022 11:02                3296
gearmanworker.addfunction.php                      30-Sep-2022 11:02                7817
gearmanworker.addoptions.php                       30-Sep-2022 11:02                3249
gearmanworker.addserver.php                        30-Sep-2022 11:02                4569
gearmanworker.addservers.php                       30-Sep-2022 11:02                4068
gearmanworker.clone.php                            30-Sep-2022 11:02                2274
gearmanworker.construct.php                        30-Sep-2022 11:02                2788
gearmanworker.echo.php                             30-Sep-2022 11:02                2902
gearmanworker.error.php                            30-Sep-2022 11:02                2526
gearmanworker.geterrno.php                         30-Sep-2022 11:02                2564
gearmanworker.options.php                          30-Sep-2022 11:02                2571
gearmanworker.register.php                         30-Sep-2022 11:02                3620
gearmanworker.removeoptions.php                    30-Sep-2022 11:02                3271
gearmanworker.returncode.php                       30-Sep-2022 11:02                2774
gearmanworker.setid.php                            30-Sep-2022 11:02                3838
gearmanworker.setoptions.php                       30-Sep-2022 11:02                3419
gearmanworker.settimeout.php                       30-Sep-2022 11:02                8084
gearmanworker.timeout.php                          30-Sep-2022 11:02                2671
gearmanworker.unregister.php                       30-Sep-2022 11:02                3238
gearmanworker.unregisterall.php                    30-Sep-2022 11:02                2949
gearmanworker.wait.php                             30-Sep-2022 11:02                8432
gearmanworker.work.php                             30-Sep-2022 11:02                5364
gender-gender.connect.php                          30-Sep-2022 11:02                2419
gender-gender.construct.php                        30-Sep-2022 11:02                2331
gender-gender.country.php                          30-Sep-2022 11:02                3590
gender-gender.get.php                              30-Sep-2022 11:02                2682
gender-gender.isnick.php                           30-Sep-2022 11:02                3128
gender-gender.similarnames.php                     30-Sep-2022 11:02                2795
gender.example.admin.php                           30-Sep-2022 11:02                9304
gender.examples.php                                30-Sep-2022 11:02                1337
gender.installation.php                            30-Sep-2022 11:02                2002
gender.setup.php                                   30-Sep-2022 11:02                1409
generator.current.php                              30-Sep-2022 11:01                2113
generator.key.php                                  30-Sep-2022 11:01                3956
generator.next.php                                 30-Sep-2022 11:01                2341
generator.rewind.php                               30-Sep-2022 11:01                2156
generator.send.php                                 30-Sep-2022 11:01                5465
generator.throw.php                                30-Sep-2022 11:01                5315
generator.valid.php                                30-Sep-2022 11:01                2128
generator.wakeup.php                               30-Sep-2022 11:01                2150
geoip.configuration.php                            30-Sep-2022 11:02                2453
geoip.constants.php                                30-Sep-2022 11:02                4502
geoip.installation.php                             30-Sep-2022 11:02                1759
geoip.requirements.php                             30-Sep-2022 11:02                1754
geoip.resources.php                                30-Sep-2022 11:02                1228
geoip.setup.php                                    30-Sep-2022 11:02                1620
gettext.configuration.php                          30-Sep-2022 11:02                1321
gettext.constants.php                              30-Sep-2022 11:02                1172
gettext.installation.php                           30-Sep-2022 11:02                1483
gettext.requirements.php                           30-Sep-2022 11:02                1439
gettext.resources.php                              30-Sep-2022 11:02                1245
gettext.setup.php                                  30-Sep-2022 11:02                1667
getting-started.php                                30-Sep-2022 11:01                1957
globiterator.construct.php                         30-Sep-2022 11:02                7853
globiterator.count.php                             30-Sep-2022 11:02                4391
gmagick.addimage.php                               30-Sep-2022 11:02                2831
gmagick.addnoiseimage.php                          30-Sep-2022 11:02                2828
gmagick.annotateimage.php                          30-Sep-2022 11:02                4203
gmagick.blurimage.php                              30-Sep-2022 11:02                3112
gmagick.borderimage.php                            30-Sep-2022 11:02                3623
gmagick.charcoalimage.php                          30-Sep-2022 11:02                3120
gmagick.chopimage.php                              30-Sep-2022 11:02                3664
gmagick.clear.php                                  30-Sep-2022 11:02                2574
gmagick.commentimage.php                           30-Sep-2022 11:02                2773
gmagick.compositeimage.php                         30-Sep-2022 11:02                3885
gmagick.configuration.php                          30-Sep-2022 11:02                1333
gmagick.constants.php                              30-Sep-2022 11:02               68543
gmagick.construct.php                              30-Sep-2022 11:02                2529
gmagick.cropimage.php                              30-Sep-2022 11:02                3799
gmagick.cropthumbnailimage.php                     30-Sep-2022 11:02                3157
gmagick.current.php                                30-Sep-2022 11:02                2475
gmagick.cyclecolormapimage.php                     30-Sep-2022 11:02                2901
gmagick.deconstructimages.php                      30-Sep-2022 11:02                2723
gmagick.despeckleimage.php                         30-Sep-2022 11:02                3408
gmagick.destroy.php                                30-Sep-2022 11:02                2545
gmagick.drawimage.php                              30-Sep-2022 11:02                2955
gmagick.edgeimage.php                              30-Sep-2022 11:02                2844
gmagick.embossimage.php                            30-Sep-2022 11:02                3298
gmagick.enhanceimage.php                           30-Sep-2022 11:02                2585
gmagick.equalizeimage.php                          30-Sep-2022 11:02                2544
gmagick.examples.php                               30-Sep-2022 11:02                3684
gmagick.flipimage.php                              30-Sep-2022 11:02                2897
gmagick.flopimage.php                              30-Sep-2022 11:02                2894
gmagick.frameimage.php                             30-Sep-2022 11:02                4340
gmagick.gammaimage.php                             30-Sep-2022 11:02                3055
gmagick.getcopyright.php                           30-Sep-2022 11:02                2506
gmagick.getfilename.php                            30-Sep-2022 11:02                2456
gmagick.getimagebackgroundcolor.php                30-Sep-2022 11:02                2653
gmagick.getimageblueprimary.php                    30-Sep-2022 11:02                2907
gmagick.getimagebordercolor.php                    30-Sep-2022 11:02                2697
gmagick.getimagechanneldepth.php                   30-Sep-2022 11:02                2642
gmagick.getimagecolors.php                         30-Sep-2022 11:02                2494
gmagick.getimagecolorspace.php                     30-Sep-2022 11:02                2452
gmagick.getimagecompose.php                        30-Sep-2022 11:02                2532
gmagick.getimagedelay.php                          30-Sep-2022 11:02                2429
gmagick.getimagedepth.php                          30-Sep-2022 11:02                2399
gmagick.getimagedispose.php                        30-Sep-2022 11:02                2453
gmagick.getimageextrema.php                        30-Sep-2022 11:02                2670
gmagick.getimagefilename.php                       30-Sep-2022 11:02                2535
gmagick.getimageformat.php                         30-Sep-2022 11:02                2518
gmagick.getimagegamma.php                          30-Sep-2022 11:02                2420
gmagick.getimagegreenprimary.php                   30-Sep-2022 11:02                2639
gmagick.getimageheight.php                         30-Sep-2022 11:02                2451
gmagick.getimagehistogram.php                      30-Sep-2022 11:02                2812
gmagick.getimageindex.php                          30-Sep-2022 11:02                2582
gmagick.getimageinterlacescheme.php                30-Sep-2022 11:02                2570
gmagick.getimageiterations.php                     30-Sep-2022 11:02                2497
gmagick.getimagematte.php                          30-Sep-2022 11:02                2631
gmagick.getimagemattecolor.php                     30-Sep-2022 11:02                2603
gmagick.getimageprofile.php                        30-Sep-2022 11:02                2590
gmagick.getimageredprimary.php                     30-Sep-2022 11:02                2660
gmagick.getimagerenderingintent.php                30-Sep-2022 11:02                2581
gmagick.getimageresolution.php                     30-Sep-2022 11:02                2513
gmagick.getimagescene.php                          30-Sep-2022 11:02                2416
gmagick.getimagesignature.php                      30-Sep-2022 11:02                2529
gmagick.getimagetype.php                           30-Sep-2022 11:02                2423
gmagick.getimageunits.php                          30-Sep-2022 11:02                2191
gmagick.getimagewhitepoint.php                     30-Sep-2022 11:02                2636
gmagick.getimagewidth.php                          30-Sep-2022 11:02                2430
gmagick.getpackagename.php                         30-Sep-2022 11:02                2482
gmagick.getquantumdepth.php                        30-Sep-2022 11:02                2661
gmagick.getreleasedate.php                         30-Sep-2022 11:02                2516
gmagick.getsamplingfactors.php                     30-Sep-2022 11:02                2571
gmagick.getsize.php                                30-Sep-2022 11:02                2720
gmagick.getversion.php                             30-Sep-2022 11:02                2461
gmagick.hasnextimage.php                           30-Sep-2022 11:02                2763
gmagick.haspreviousimage.php                       30-Sep-2022 11:02                2807
gmagick.implodeimage.php                           30-Sep-2022 11:02                2925
gmagick.installation.php                           30-Sep-2022 11:02                1990
gmagick.labelimage.php                             30-Sep-2022 11:02                2692
gmagick.levelimage.php                             30-Sep-2022 11:02                4483
gmagick.magnifyimage.php                           30-Sep-2022 11:02                2611
gmagick.mapimage.php                               30-Sep-2022 11:02                3192
gmagick.medianfilterimage.php                      30-Sep-2022 11:02                2948
gmagick.minifyimage.php                            30-Sep-2022 11:02                2604
gmagick.modulateimage.php                          30-Sep-2022 11:02                3694
gmagick.motionblurimage.php                        30-Sep-2022 11:02                3719
gmagick.newimage.php                               30-Sep-2022 11:02                3683
gmagick.nextimage.php                              30-Sep-2022 11:02                2566
gmagick.normalizeimage.php                         30-Sep-2022 11:02                2929
gmagick.oilpaintimage.php                          30-Sep-2022 11:02                2945
gmagick.previousimage.php                          30-Sep-2022 11:02                2561
gmagick.profileimage.php                           30-Sep-2022 11:02                3343
gmagick.quantizeimage.php                          30-Sep-2022 11:02                5054
gmagick.quantizeimages.php                         30-Sep-2022 11:02                5057
gmagick.queryfontmetrics.php                       30-Sep-2022 11:02                2779
gmagick.queryfonts.php                             30-Sep-2022 11:02                2555
gmagick.queryformats.php                           30-Sep-2022 11:02                2903
gmagick.radialblurimage.php                        30-Sep-2022 11:02                3095
gmagick.raiseimage.php                             30-Sep-2022 11:02                4123
gmagick.read.php                                   30-Sep-2022 11:02                2666
gmagick.readimage.php                              30-Sep-2022 11:02                2716
gmagick.readimageblob.php                          30-Sep-2022 11:02                3083
gmagick.readimagefile.php                          30-Sep-2022 11:02                2952
gmagick.reducenoiseimage.php                       30-Sep-2022 11:02                3123
gmagick.removeimage.php                            30-Sep-2022 11:02                2552
gmagick.removeimageprofile.php                     30-Sep-2022 11:02                2768
gmagick.requirements.php                           30-Sep-2022 11:02                1714
gmagick.resampleimage.php                          30-Sep-2022 11:02                3690
gmagick.resizeimage.php                            30-Sep-2022 11:02                3916
gmagick.rollimage.php                              30-Sep-2022 11:02                2874
gmagick.rotateimage.php                            30-Sep-2022 11:02                3148
gmagick.scaleimage.php                             30-Sep-2022 11:02                3306
gmagick.separateimagechannel.php                   30-Sep-2022 11:02                3115
gmagick.setcompressionquality.php                  30-Sep-2022 11:02                4152
gmagick.setfilename.php                            30-Sep-2022 11:02                2846
gmagick.setimagebackgroundcolor.php                30-Sep-2022 11:02                2975
gmagick.setimageblueprimary.php                    30-Sep-2022 11:02                3157
gmagick.setimagebordercolor.php                    30-Sep-2022 11:02                2937
gmagick.setimagechanneldepth.php                   30-Sep-2022 11:02                3304
gmagick.setimagecolorspace.php                     30-Sep-2022 11:02                3000
gmagick.setimagecompose.php                        30-Sep-2022 11:02                2766
gmagick.setimagedelay.php                          30-Sep-2022 11:02                2780
gmagick.setimagedepth.php                          30-Sep-2022 11:02                2778
gmagick.setimagedispose.php                        30-Sep-2022 11:02                2822
gmagick.setimagefilename.php                       30-Sep-2022 11:02                2870
gmagick.setimageformat.php                         30-Sep-2022 11:02                2833
gmagick.setimagegamma.php                          30-Sep-2022 11:02                2772
gmagick.setimagegreenprimary.php                   30-Sep-2022 11:02                3165
gmagick.setimageindex.php                          30-Sep-2022 11:02                2919
gmagick.setimageinterlacescheme.php                30-Sep-2022 11:02                3066
gmagick.setimageiterations.php                     30-Sep-2022 11:02                2875
gmagick.setimageprofile.php                        30-Sep-2022 11:02                3250
gmagick.setimageredprimary.php                     30-Sep-2022 11:02                3068
gmagick.setimagerenderingintent.php                30-Sep-2022 11:02                3097
gmagick.setimageresolution.php                     30-Sep-2022 11:02                3062
gmagick.setimagescene.php                          30-Sep-2022 11:02                2768
gmagick.setimagetype.php                           30-Sep-2022 11:02                2893
gmagick.setimageunits.php                          30-Sep-2022 11:02                2952
gmagick.setimagewhitepoint.php                     30-Sep-2022 11:02                3094
gmagick.setsamplingfactors.php                     30-Sep-2022 11:02                2936
gmagick.setsize.php                                30-Sep-2022 11:02                3201
gmagick.setup.php                                  30-Sep-2022 11:02                1585
gmagick.shearimage.php                             30-Sep-2022 11:02                3837
gmagick.solarizeimage.php                          30-Sep-2022 11:02                3026
gmagick.spreadimage.php                            30-Sep-2022 11:02                2870
gmagick.stripimage.php                             30-Sep-2022 11:02                2532
gmagick.swirlimage.php                             30-Sep-2022 11:02                2951
gmagick.thumbnailimage.php                         30-Sep-2022 11:02                3566
gmagick.trimimage.php                              30-Sep-2022 11:02                3015
gmagick.write.php                                  30-Sep-2022 11:02                1702
gmagick.writeimage.php                             30-Sep-2022 11:02                3263
gmagickdraw.annotate.php                           30-Sep-2022 11:02                3000
gmagickdraw.arc.php                                30-Sep-2022 11:02                4000
gmagickdraw.bezier.php                             30-Sep-2022 11:02                2549
gmagickdraw.ellipse.php                            30-Sep-2022 11:02                3921
gmagickdraw.getfillcolor.php                       30-Sep-2022 11:02                2419
gmagickdraw.getfillopacity.php                     30-Sep-2022 11:02                2312
gmagickdraw.getfont.php                            30-Sep-2022 11:02                2350
gmagickdraw.getfontsize.php                        30-Sep-2022 11:02                2354
gmagickdraw.getfontstyle.php                       30-Sep-2022 11:02                2430
gmagickdraw.getfontweight.php                      30-Sep-2022 11:02                2275
gmagickdraw.getstrokecolor.php                     30-Sep-2022 11:02                2474
gmagickdraw.getstrokeopacity.php                   30-Sep-2022 11:02                2331
gmagickdraw.getstrokewidth.php                     30-Sep-2022 11:02                2350
gmagickdraw.gettextdecoration.php                  30-Sep-2022 11:02                2342
gmagickdraw.gettextencoding.php                    30-Sep-2022 11:02                2478
gmagickdraw.line.php                               30-Sep-2022 11:02                3392
gmagickdraw.point.php                              30-Sep-2022 11:02                2787
gmagickdraw.polygon.php                            30-Sep-2022 11:02                2616
gmagickdraw.polyline.php                           30-Sep-2022 11:02                2651
gmagickdraw.rectangle.php                          30-Sep-2022 11:02                3496
gmagickdraw.rotate.php                             30-Sep-2022 11:02                2607
gmagickdraw.roundrectangle.php                     30-Sep-2022 11:02                4165
gmagickdraw.scale.php                              30-Sep-2022 11:02                2851
gmagickdraw.setfillcolor.php                       30-Sep-2022 11:02                2906
gmagickdraw.setfillopacity.php                     30-Sep-2022 11:02                2705
gmagickdraw.setfont.php                            30-Sep-2022 11:02                2603
gmagickdraw.setfontsize.php                        30-Sep-2022 11:02                2635
gmagickdraw.setfontstyle.php                       30-Sep-2022 11:02                2766
gmagickdraw.setfontweight.php                      30-Sep-2022 11:02                2637
gmagickdraw.setstrokecolor.php                     30-Sep-2022 11:02                2930
gmagickdraw.setstrokeopacity.php                   30-Sep-2022 11:02                2723
gmagickdraw.setstrokewidth.php                     30-Sep-2022 11:02                2683
gmagickdraw.settextdecoration.php                  30-Sep-2022 11:02                2769
gmagickdraw.settextencoding.php                    30-Sep-2022 11:02                2975
gmagickpixel.construct.php                         30-Sep-2022 11:02                2477
gmagickpixel.getcolor.php                          30-Sep-2022 11:02                3643
gmagickpixel.getcolorcount.php                     30-Sep-2022 11:02                2403
gmagickpixel.getcolorvalue.php                     30-Sep-2022 11:02                2755
gmagickpixel.setcolor.php                          30-Sep-2022 11:02                2942
gmagickpixel.setcolorvalue.php                     30-Sep-2022 11:02                3169
gmp.configuration.php                              30-Sep-2022 11:02                1293
gmp.constants.php                                  30-Sep-2022 11:02                2016
gmp.examples.php                                   30-Sep-2022 11:02                3262
gmp.installation.php                               30-Sep-2022 11:02                1397
gmp.requirements.php                               30-Sep-2022 11:02                1669
gmp.resources.php                                  30-Sep-2022 11:02                1242
gmp.setup.php                                      30-Sep-2022 11:02                1614
gnupg.configuration.php                            30-Sep-2022 11:02                1302
gnupg.constants.php                                30-Sep-2022 11:02                6367
gnupg.examples-clearsign.php                       30-Sep-2022 11:02                6730
gnupg.examples.php                                 30-Sep-2022 11:02                1341
gnupg.installation.php                             30-Sep-2022 11:02                1599
gnupg.requirements.php                             30-Sep-2022 11:02                1318
gnupg.resources.php                                30-Sep-2022 11:02                1228
gnupg.setup.php                                    30-Sep-2022 11:02                1638
hash.configuration.php                             30-Sep-2022 11:02                1297
hash.constants.php                                 30-Sep-2022 11:02                1698
hash.installation.php                              30-Sep-2022 11:02                1675
hash.requirements.php                              30-Sep-2022 11:02                1260
hash.resources.php                                 30-Sep-2022 11:02                1346
hash.setup.php                                     30-Sep-2022 11:02                1619
hashcontext.construct.php                          30-Sep-2022 11:02                1888
hashcontext.serialize.php                          30-Sep-2022 11:02                2308
hashcontext.unserialize.php                        30-Sep-2022 11:02                2606
history.php                                        30-Sep-2022 11:02                2242
history.php.books.php                              30-Sep-2022 11:02                2643
history.php.php                                    30-Sep-2022 11:02               11527
history.php.publications.php                       30-Sep-2022 11:02                1836
history.php.related.php                            30-Sep-2022 11:02                6210
hrtime-performancecounter.getfrequency.php         30-Sep-2022 11:02                2601
hrtime-performancecounter.getticks.php             30-Sep-2022 11:02                2474
hrtime-performancecounter.gettickssince.php        30-Sep-2022 11:02                2726
hrtime-stopwatch.getelapsedticks.php               30-Sep-2022 11:02                2376
hrtime-stopwatch.getelapsedtime.php                30-Sep-2022 11:02                2721
hrtime-stopwatch.getlastelapsedticks.php           30-Sep-2022 11:02                2444
hrtime-stopwatch.getlastelapsedtime.php            30-Sep-2022 11:02                2745
hrtime-stopwatch.isrunning.php                     30-Sep-2022 11:02                2335
hrtime-stopwatch.start.php                         30-Sep-2022 11:02                2329
hrtime-stopwatch.stop.php                          30-Sep-2022 11:02                2208
hrtime.example.basic.php                           30-Sep-2022 11:02                5960
hrtime.examples.php                                30-Sep-2022 11:02                1331
hrtime.installation.php                            30-Sep-2022 11:02                2002
hrtime.setup.php                                   30-Sep-2022 11:02                1406
ibase.configuration.php                            30-Sep-2022 11:02                6611
ibase.constants.php                                30-Sep-2022 11:02               15090
ibase.installation.php                             30-Sep-2022 11:02                2730
ibase.requirements.php                             30-Sep-2022 11:02                1247
ibase.resources.php                                30-Sep-2022 11:02                1231
ibase.setup.php                                    30-Sep-2022 11:02                1659
ibm-db2.configuration.php                          30-Sep-2022 11:02                9369
ibm-db2.constants.php                              30-Sep-2022 11:02                6844
ibm-db2.installation.php                           30-Sep-2022 11:02                3614
ibm-db2.requirements.php                           30-Sep-2022 11:02                3257
ibm-db2.resources.php                              30-Sep-2022 11:02                1307
ibm-db2.setup.php                                  30-Sep-2022 11:02                1668
iconv.configuration.php                            30-Sep-2022 11:02                4585
iconv.constants.php                                30-Sep-2022 11:02                3164
iconv.installation.php                             30-Sep-2022 11:02                1611
iconv.requirements.php                             30-Sep-2022 11:02                1534
iconv.resources.php                                30-Sep-2022 11:02                1228
iconv.setup.php                                    30-Sep-2022 11:02                1644
igbinary.configuration.php                         30-Sep-2022 11:02                3352
igbinary.installation.php                          30-Sep-2022 11:02                2010
igbinary.requirements.php                          30-Sep-2022 11:02                1265
igbinary.setup.php                                 30-Sep-2022 11:02                1592
image.configuration.php                            30-Sep-2022 11:02                3379
image.constants.php                                30-Sep-2022 11:02               39801
image.examples-png.php                             30-Sep-2022 11:02                4659
image.examples.php                                 30-Sep-2022 11:02                1301
image.installation.php                             30-Sep-2022 11:02                5313
image.requirements.php                             30-Sep-2022 11:02                5949
image.resources.php                                30-Sep-2022 11:02                1299
image.setup.php                                    30-Sep-2022 11:02                1644
imagick.adaptiveblurimage.php                      30-Sep-2022 11:02                6628
imagick.adaptiveresizeimage.php                    30-Sep-2022 11:02                8756
imagick.adaptivesharpenimage.php                   30-Sep-2022 11:02                6250
imagick.adaptivethresholdimage.php                 30-Sep-2022 11:02                6126
imagick.addimage.php                               30-Sep-2022 11:02                2768
imagick.addnoiseimage.php                          30-Sep-2022 11:02                5399
imagick.affinetransformimage.php                   30-Sep-2022 11:02                6963
imagick.animateimages.php                          30-Sep-2022 11:02                2990
imagick.annotateimage.php                          30-Sep-2022 11:02                8641
imagick.appendimages.php                           30-Sep-2022 11:02                6681
imagick.autolevelimage.php                         30-Sep-2022 11:02                4359
imagick.averageimages.php                          30-Sep-2022 11:02                2694
imagick.blackthresholdimage.php                    30-Sep-2022 11:02                5330
imagick.blueshiftimage.php                         30-Sep-2022 11:02                4428
imagick.blurimage.php                              30-Sep-2022 11:02                5527
imagick.borderimage.php                            30-Sep-2022 11:02                5992
imagick.brightnesscontrastimage.php                30-Sep-2022 11:02                5480
imagick.charcoalimage.php                          30-Sep-2022 11:02                4895
imagick.chopimage.php                              30-Sep-2022 11:02                6853
imagick.clampimage.php                             30-Sep-2022 11:02                2441
imagick.clear.php                                  30-Sep-2022 11:02                2132
imagick.clipimage.php                              30-Sep-2022 11:02                2362
imagick.clipimagepath.php                          30-Sep-2022 11:02                2934
imagick.clippathimage.php                          30-Sep-2022 11:02                3204
imagick.clone.php                                  30-Sep-2022 11:02                4239
imagick.clutimage.php                              30-Sep-2022 11:02                5946
imagick.coalesceimages.php                         30-Sep-2022 11:02                2772
imagick.colorfloodfillimage.php                    30-Sep-2022 11:02                5223
imagick.colorizeimage.php                          30-Sep-2022 11:02                6927
imagick.colormatriximage.php                       30-Sep-2022 11:02                8387
imagick.combineimages.php                          30-Sep-2022 11:02                3213
imagick.commentimage.php                           30-Sep-2022 11:02                4919
imagick.compareimagechannels.php                   30-Sep-2022 11:02                3751
imagick.compareimagelayers.php                     30-Sep-2022 11:02                5485
imagick.compareimages.php                          30-Sep-2022 11:02                5570
imagick.compositeimage.php                         30-Sep-2022 11:02                7806
imagick.configuration.php                          30-Sep-2022 11:02                4089
imagick.constants.php                              30-Sep-2022 11:02              111171
imagick.construct.php                              30-Sep-2022 11:02                2594
imagick.contrastimage.php                          30-Sep-2022 11:02                5041
imagick.contraststretchimage.php                   30-Sep-2022 11:02                3591
imagick.convolveimage.php                          30-Sep-2022 11:02                5949
imagick.count.php                                  30-Sep-2022 11:02                2576
imagick.cropimage.php                              30-Sep-2022 11:02                5947
imagick.cropthumbnailimage.php                     30-Sep-2022 11:02                3159
imagick.current.php                                30-Sep-2022 11:02                2433
imagick.cyclecolormapimage.php                     30-Sep-2022 11:02                2793
imagick.decipherimage.php                          30-Sep-2022 11:02                3082
imagick.deconstructimages.php                      30-Sep-2022 11:02                2588
imagick.deleteimageartifact.php                    30-Sep-2022 11:02                3488
imagick.deleteimageproperty.php                    30-Sep-2022 11:02                2442
imagick.deskewimage.php                            30-Sep-2022 11:02               11649
imagick.despeckleimage.php                         30-Sep-2022 11:02                4235
imagick.destroy.php                                30-Sep-2022 11:02                2270
imagick.displayimage.php                           30-Sep-2022 11:02                2592
imagick.displayimages.php                          30-Sep-2022 11:02                2636
imagick.distortimage.php                           30-Sep-2022 11:02               12880
imagick.drawimage.php                              30-Sep-2022 11:02                2504
imagick.edgeimage.php                              30-Sep-2022 11:02                4600
imagick.embossimage.php                            30-Sep-2022 11:02                5253
imagick.encipherimage.php                          30-Sep-2022 11:02                3078
imagick.enhanceimage.php                           30-Sep-2022 11:02                4202
imagick.equalizeimage.php                          30-Sep-2022 11:02                4169
imagick.evaluateimage.php                          30-Sep-2022 11:02                5731
imagick.examples-1.php                             30-Sep-2022 11:02               32544
imagick.examples.php                               30-Sep-2022 11:02                1343
imagick.exportimagepixels.php                      30-Sep-2022 11:02                7634
imagick.extentimage.php                            30-Sep-2022 11:02                4948
imagick.filter.php                                 30-Sep-2022 11:02                7820
imagick.flattenimages.php                          30-Sep-2022 11:02                2748
imagick.flipimage.php                              30-Sep-2022 11:02                4517
imagick.floodfillpaintimage.php                    30-Sep-2022 11:02               11556
imagick.flopimage.php                              30-Sep-2022 11:02                4549
imagick.forwardfouriertransformimage.php           30-Sep-2022 11:02               12981
imagick.frameimage.php                             30-Sep-2022 11:02                8469
imagick.functionimage.php                          30-Sep-2022 11:02               13670
imagick.fximage.php                                30-Sep-2022 11:02                6081
imagick.gammaimage.php                             30-Sep-2022 11:02                5595
imagick.gaussianblurimage.php                      30-Sep-2022 11:02                6087
imagick.getcolorspace.php                          30-Sep-2022 11:02                2369
imagick.getcompression.php                         30-Sep-2022 11:02                2197
imagick.getcompressionquality.php                  30-Sep-2022 11:02                2271
imagick.getcopyright.php                           30-Sep-2022 11:02                2298
imagick.getfilename.php                            30-Sep-2022 11:02                2350
imagick.getfont.php                                30-Sep-2022 11:02                2992
imagick.getformat.php                              30-Sep-2022 11:02                2312
imagick.getgravity.php                             30-Sep-2022 11:02                2348
imagick.gethomeurl.php                             30-Sep-2022 11:02                2175
imagick.getimage.php                               30-Sep-2022 11:02                2414
imagick.getimagealphachannel.php                   30-Sep-2022 11:02                3221
imagick.getimageartifact.php                       30-Sep-2022 11:02                3437
imagick.getimageattribute.php                      30-Sep-2022 11:02                2684
imagick.getimagebackgroundcolor.php                30-Sep-2022 11:02                2580
imagick.getimageblob.php                           30-Sep-2022 11:02                2606
imagick.getimageblueprimary.php                    30-Sep-2022 11:02                2809
imagick.getimagebordercolor.php                    30-Sep-2022 11:02                2537
imagick.getimagechanneldepth.php                   30-Sep-2022 11:02                2946
imagick.getimagechanneldistortion.php              30-Sep-2022 11:02                3835
imagick.getimagechanneldistortions.php             30-Sep-2022 11:02                4148
imagick.getimagechannelextrema.php                 30-Sep-2022 11:02                3447
imagick.getimagechannelkurtosis.php                30-Sep-2022 11:02                3391
imagick.getimagechannelmean.php                    30-Sep-2022 11:02                3113
imagick.getimagechannelrange.php                   30-Sep-2022 11:02                3244
imagick.getimagechannelstatistics.php              30-Sep-2022 11:02                2476
imagick.getimageclipmask.php                       30-Sep-2022 11:02                2944
imagick.getimagecolormapcolor.php                  30-Sep-2022 11:02                2820
imagick.getimagecolors.php                         30-Sep-2022 11:02                2283
imagick.getimagecolorspace.php                     30-Sep-2022 11:02                2324
imagick.getimagecompose.php                        30-Sep-2022 11:02                2282
imagick.getimagecompression.php                    30-Sep-2022 11:02                2285
imagick.getimagecompressionquality.php             30-Sep-2022 11:02                2379
imagick.getimagedelay.php                          30-Sep-2022 11:02                2345
imagick.getimagedepth.php                          30-Sep-2022 11:02                2130
imagick.getimagedispose.php                        30-Sep-2022 11:02                2385
imagick.getimagedistortion.php                     30-Sep-2022 11:02                3159
imagick.getimageextrema.php                        30-Sep-2022 11:02                2799
imagick.getimagefilename.php                       30-Sep-2022 11:02                2457
imagick.getimageformat.php                         30-Sep-2022 11:02                2439
imagick.getimagegamma.php                          30-Sep-2022 11:02                2340
imagick.getimagegeometry.php                       30-Sep-2022 11:02                4069
imagick.getimagegravity.php                        30-Sep-2022 11:02                2641
imagick.getimagegreenprimary.php                   30-Sep-2022 11:02                2610
imagick.getimageheight.php                         30-Sep-2022 11:02                2371
imagick.getimagehistogram.php                      30-Sep-2022 11:02               19702
imagick.getimageindex.php                          30-Sep-2022 11:02                2906
imagick.getimageinterlacescheme.php                30-Sep-2022 11:02                2434
imagick.getimageinterpolatemethod.php              30-Sep-2022 11:02                2644
imagick.getimageiterations.php                     30-Sep-2022 11:02                2433
imagick.getimagelength.php                         30-Sep-2022 11:02                3351
imagick.getimagematte.php                          30-Sep-2022 11:02                2652
imagick.getimagemattecolor.php                     30-Sep-2022 11:02                2772
imagick.getimagemimetype.php                       30-Sep-2022 11:02                2177
imagick.getimageorientation.php                    30-Sep-2022 11:02                2537
imagick.getimagepage.php                           30-Sep-2022 11:02                2602
imagick.getimagepixelcolor.php                     30-Sep-2022 11:02                3017
imagick.getimageprofile.php                        30-Sep-2022 11:02                2653
imagick.getimageprofiles.php                       30-Sep-2022 11:02                3205
imagick.getimageproperties.php                     30-Sep-2022 11:02                5634
imagick.getimageproperty.php                       30-Sep-2022 11:02                4870
imagick.getimageredprimary.php                     30-Sep-2022 11:02                2690
imagick.getimageregion.php                         30-Sep-2022 11:02                3709
imagick.getimagerenderingintent.php                30-Sep-2022 11:02                2561
imagick.getimageresolution.php                     30-Sep-2022 11:02                2437
imagick.getimagesblob.php                          30-Sep-2022 11:02                2453
imagick.getimagescene.php                          30-Sep-2022 11:02                2327
imagick.getimagesignature.php                      30-Sep-2022 11:02                2454
imagick.getimagesize.php                           30-Sep-2022 11:02                2589
imagick.getimagetickspersecond.php                 30-Sep-2022 11:02                2473
imagick.getimagetotalinkdensity.php                30-Sep-2022 11:02                2420
imagick.getimagetype.php                           30-Sep-2022 11:02                3963
imagick.getimageunits.php                          30-Sep-2022 11:02                2389
imagick.getimagevirtualpixelmethod.php             30-Sep-2022 11:02                2540
imagick.getimagewhitepoint.php                     30-Sep-2022 11:02                2590
imagick.getimagewidth.php                          30-Sep-2022 11:02                2345
imagick.getinterlacescheme.php                     30-Sep-2022 11:02                2491
imagick.getiteratorindex.php                       30-Sep-2022 11:02                6118
imagick.getnumberimages.php                        30-Sep-2022 11:02                2440
imagick.getoption.php                              30-Sep-2022 11:02                2627
imagick.getpackagename.php                         30-Sep-2022 11:02                2411
imagick.getpage.php                                30-Sep-2022 11:02                2431
imagick.getpixeliterator.php                       30-Sep-2022 11:02                6796
imagick.getpixelregioniterator.php                 30-Sep-2022 11:02                6749
imagick.getpointsize.php                           30-Sep-2022 11:02                2674
imagick.getquantum.php                             30-Sep-2022 11:02                2144
imagick.getquantumdepth.php                        30-Sep-2022 11:02                2524
imagick.getquantumrange.php                        30-Sep-2022 11:02                2668
imagick.getregistry.php                            30-Sep-2022 11:02                2366
imagick.getreleasedate.php                         30-Sep-2022 11:02                2435
imagick.getresource.php                            30-Sep-2022 11:02                2788
imagick.getresourcelimit.php                       30-Sep-2022 11:02                3220
imagick.getsamplingfactors.php                     30-Sep-2022 11:02                2501
imagick.getsize.php                                30-Sep-2022 11:02                5823
imagick.getsizeoffset.php                          30-Sep-2022 11:02                2484
imagick.getversion.php                             30-Sep-2022 11:02                2423
imagick.haldclutimage.php                          30-Sep-2022 11:02                6007
imagick.hasnextimage.php                           30-Sep-2022 11:02                2418
imagick.haspreviousimage.php                       30-Sep-2022 11:02                2456
imagick.identifyformat.php                         30-Sep-2022 11:02                4486
imagick.identifyimage.php                          30-Sep-2022 11:02                3827
imagick.implodeimage.php                           30-Sep-2022 11:02                4585
imagick.importimagepixels.php                      30-Sep-2022 11:02               11666
imagick.installation.php                           30-Sep-2022 11:02                3031
imagick.inversefouriertransformimage.php           30-Sep-2022 11:02                3266
imagick.labelimage.php                             30-Sep-2022 11:02                2400
imagick.levelimage.php                             30-Sep-2022 11:02                7673
imagick.linearstretchimage.php                     30-Sep-2022 11:02                5638
imagick.liquidrescaleimage.php                     30-Sep-2022 11:02                4181
imagick.listregistry.php                           30-Sep-2022 11:02                2263
imagick.magnifyimage.php                           30-Sep-2022 11:02                4201
imagick.mapimage.php                               30-Sep-2022 11:02                3056
imagick.mattefloodfillimage.php                    30-Sep-2022 11:02                5461
imagick.medianfilterimage.php                      30-Sep-2022 11:02                5078
imagick.mergeimagelayers.php                       30-Sep-2022 11:02                6599
imagick.minifyimage.php                            30-Sep-2022 11:02                2250
imagick.modulateimage.php                          30-Sep-2022 11:02                5482
imagick.montageimage.php                           30-Sep-2022 11:02                4325
imagick.morphimages.php                            30-Sep-2022 11:02                2733
imagick.morphology.php                             30-Sep-2022 11:02               75783
imagick.mosaicimages.php                           30-Sep-2022 11:02                2658
imagick.motionblurimage.php                        30-Sep-2022 11:02                6609
imagick.negateimage.php                            30-Sep-2022 11:02                5444
imagick.newimage.php                               30-Sep-2022 11:02                6069
imagick.newpseudoimage.php                         30-Sep-2022 11:02                5677
imagick.nextimage.php                              30-Sep-2022 11:02                2182
imagick.normalizeimage.php                         30-Sep-2022 11:02                6458
imagick.oilpaintimage.php                          30-Sep-2022 11:02                4548
imagick.opaquepaintimage.php                       30-Sep-2022 11:02                4670
imagick.optimizeimagelayers.php                    30-Sep-2022 11:02                5320
imagick.orderedposterizeimage.php                  30-Sep-2022 11:02                6778
imagick.paintfloodfillimage.php                    30-Sep-2022 11:02                5434
imagick.paintopaqueimage.php                       30-Sep-2022 11:02                5225
imagick.painttransparentimage.php                  30-Sep-2022 11:02                4445
imagick.pingimage.php                              30-Sep-2022 11:02                2522
imagick.pingimageblob.php                          30-Sep-2022 11:02                6022
imagick.pingimagefile.php                          30-Sep-2022 11:02                5734
imagick.polaroidimage.php                          30-Sep-2022 11:02                4672
imagick.posterizeimage.php                         30-Sep-2022 11:02                5566
imagick.previewimages.php                          30-Sep-2022 11:02                2916
imagick.previousimage.php                          30-Sep-2022 11:02                2237
imagick.profileimage.php                           30-Sep-2022 11:02                3005
imagick.quantizeimage.php                          30-Sep-2022 11:02                6466
imagick.quantizeimages.php                         30-Sep-2022 11:02                3615
imagick.queryfontmetrics.php                       30-Sep-2022 11:02                5546
imagick.queryfonts.php                             30-Sep-2022 11:02                4988
imagick.queryformats.php                           30-Sep-2022 11:02                8213
imagick.radialblurimage.php                        30-Sep-2022 11:02                5516
imagick.raiseimage.php                             30-Sep-2022 11:02                6328
imagick.randomthresholdimage.php                   30-Sep-2022 11:02                6437
imagick.readimage.php                              30-Sep-2022 11:02                2364
imagick.readimageblob.php                          30-Sep-2022 11:02                5406
imagick.readimagefile.php                          30-Sep-2022 11:02                2889
imagick.readimages.php                             30-Sep-2022 11:02                2386
imagick.recolorimage.php                           30-Sep-2022 11:02                6620
imagick.reducenoiseimage.php                       30-Sep-2022 11:02                5128
imagick.remapimage.php                             30-Sep-2022 11:02                3250
imagick.removeimage.php                            30-Sep-2022 11:02                2368
imagick.removeimageprofile.php                     30-Sep-2022 11:02                2648
imagick.render.php                                 30-Sep-2022 11:02                2145
imagick.requirements.php                           30-Sep-2022 11:02                1597
imagick.resampleimage.php                          30-Sep-2022 11:02                5422
imagick.resetimagepage.php                         30-Sep-2022 11:02                2617
imagick.resizeimage.php                            30-Sep-2022 11:02               11769
imagick.resources.php                              30-Sep-2022 11:02                1242
imagick.rollimage.php                              30-Sep-2022 11:02                4702
imagick.rotateimage.php                            30-Sep-2022 11:02                5676
imagick.rotationalblurimage.php                    30-Sep-2022 11:02                5580
imagick.roundcorners.php                           30-Sep-2022 11:02                6363
imagick.sampleimage.php                            30-Sep-2022 11:02                2735
imagick.scaleimage.php                             30-Sep-2022 11:02                6609
imagick.segmentimage.php                           30-Sep-2022 11:02                6585
imagick.selectiveblurimage.php                     30-Sep-2022 11:02                6302
imagick.separateimagechannel.php                   30-Sep-2022 11:02                5330
imagick.sepiatoneimage.php                         30-Sep-2022 11:02                4821
imagick.setbackgroundcolor.php                     30-Sep-2022 11:02                3167
imagick.setcolorspace.php                          30-Sep-2022 11:02                2803
imagick.setcompression.php                         30-Sep-2022 11:02                2583
imagick.setcompressionquality.php                  30-Sep-2022 11:02                7264
imagick.setfilename.php                            30-Sep-2022 11:02                2451
imagick.setfirstiterator.php                       30-Sep-2022 11:02                2231
imagick.setfont.php                                30-Sep-2022 11:02                5523
imagick.setformat.php                              30-Sep-2022 11:02                2353
imagick.setgravity.php                             30-Sep-2022 11:02                2597
imagick.setimage.php                               30-Sep-2022 11:02                4680
imagick.setimagealphachannel.php                   30-Sep-2022 11:02                3497
imagick.setimageartifact.php                       30-Sep-2022 11:02                7355
imagick.setimageattribute.php                      30-Sep-2022 11:02                3066
imagick.setimagebackgroundcolor.php                30-Sep-2022 11:02                3391
imagick.setimagebias.php                           30-Sep-2022 11:02                7006
imagick.setimagebiasquantum.php                    30-Sep-2022 11:02                2822
imagick.setimageblueprimary.php                    30-Sep-2022 11:02                2909
imagick.setimagebordercolor.php                    30-Sep-2022 11:02                3369
imagick.setimagechanneldepth.php                   30-Sep-2022 11:02                2926
imagick.setimageclipmask.php                       30-Sep-2022 11:02                9371
imagick.setimagecolormapcolor.php                  30-Sep-2022 11:02                3007
imagick.setimagecolorspace.php                     30-Sep-2022 11:02                3024
imagick.setimagecompose.php                        30-Sep-2022 11:02                2743
imagick.setimagecompression.php                    30-Sep-2022 11:02                2715
imagick.setimagecompressionquality.php             30-Sep-2022 11:02                4813
imagick.setimagedelay.php                          30-Sep-2022 11:02                6274
imagick.setimagedepth.php                          30-Sep-2022 11:02                2561
imagick.setimagedispose.php                        30-Sep-2022 11:02                2605
imagick.setimageextent.php                         30-Sep-2022 11:02                2826
imagick.setimagefilename.php                       30-Sep-2022 11:02                2655
imagick.setimageformat.php                         30-Sep-2022 11:02                2552
imagick.setimagegamma.php                          30-Sep-2022 11:02                2565
imagick.setimagegravity.php                        30-Sep-2022 11:02                2762
imagick.setimagegreenprimary.php                   30-Sep-2022 11:02                2902
imagick.setimageindex.php                          30-Sep-2022 11:02                3173
imagick.setimageinterlacescheme.php                30-Sep-2022 11:02                2725
imagick.setimageinterpolatemethod.php              30-Sep-2022 11:02                2657
imagick.setimageiterations.php                     30-Sep-2022 11:02                4860
imagick.setimagematte.php                          30-Sep-2022 11:02                2576
imagick.setimagemattecolor.php                     30-Sep-2022 11:02                3592
imagick.setimageopacity.php                        30-Sep-2022 11:02                4946
imagick.setimageorientation.php                    30-Sep-2022 11:02                4677
imagick.setimagepage.php                           30-Sep-2022 11:02                3357
imagick.setimageprofile.php                        30-Sep-2022 11:02                3041
imagick.setimageproperty.php                       30-Sep-2022 11:02                4982
imagick.setimageredprimary.php                     30-Sep-2022 11:02                2898
imagick.setimagerenderingintent.php                30-Sep-2022 11:02                2731
imagick.setimageresolution.php                     30-Sep-2022 11:02                4900
imagick.setimagescene.php                          30-Sep-2022 11:02                2585
imagick.setimagetickspersecond.php                 30-Sep-2022 11:02                8270
imagick.setimagetype.php                           30-Sep-2022 11:02                2388
imagick.setimageunits.php                          30-Sep-2022 11:02                2424
imagick.setimagevirtualpixelmethod.php             30-Sep-2022 11:02                2544
imagick.setimagewhitepoint.php                     30-Sep-2022 11:02                2896
imagick.setinterlacescheme.php                     30-Sep-2022 11:02                2472
imagick.setiteratorindex.php                       30-Sep-2022 11:02                6177
imagick.setlastiterator.php                        30-Sep-2022 11:02                2245
imagick.setoption.php                              30-Sep-2022 11:02               12878
imagick.setpage.php                                30-Sep-2022 11:02                3115
imagick.setpointsize.php                           30-Sep-2022 11:02                5223
imagick.setprogressmonitor.php                     30-Sep-2022 11:02               12726
imagick.setregistry.php                            30-Sep-2022 11:02                2769
imagick.setresolution.php                          30-Sep-2022 11:02                3545
imagick.setresourcelimit.php                       30-Sep-2022 11:02                3450
imagick.setsamplingfactors.php                     30-Sep-2022 11:02                7111
imagick.setsize.php                                30-Sep-2022 11:02                2649
imagick.setsizeoffset.php                          30-Sep-2022 11:02                3105
imagick.settype.php                                30-Sep-2022 11:02                2334
imagick.setup.php                                  30-Sep-2022 11:02                1663
imagick.shadeimage.php                             30-Sep-2022 11:02                5472
imagick.shadowimage.php                            30-Sep-2022 11:02                5233
imagick.sharpenimage.php                           30-Sep-2022 11:02                5467
imagick.shaveimage.php                             30-Sep-2022 11:02                4634
imagick.shearimage.php                             30-Sep-2022 11:02                6412
imagick.sigmoidalcontrastimage.php                 30-Sep-2022 11:02                7775
imagick.sketchimage.php                            30-Sep-2022 11:02                5702
imagick.smushimages.php                            30-Sep-2022 11:02                5802
imagick.solarizeimage.php                          30-Sep-2022 11:02                4801
imagick.sparsecolorimage.php                       30-Sep-2022 11:02               31254
imagick.spliceimage.php                            30-Sep-2022 11:02                5621
imagick.spreadimage.php                            30-Sep-2022 11:02                4596
imagick.statisticimage.php                         30-Sep-2022 11:02                6697
imagick.steganoimage.php                           30-Sep-2022 11:02                2918
imagick.stereoimage.php                            30-Sep-2022 11:02                2694
imagick.stripimage.php                             30-Sep-2022 11:02                2365
imagick.subimagematch.php                          30-Sep-2022 11:02                7648
imagick.swirlimage.php                             30-Sep-2022 11:02                4648
imagick.textureimage.php                           30-Sep-2022 11:02                6370
imagick.thresholdimage.php                         30-Sep-2022 11:02                5173
imagick.thumbnailimage.php                         30-Sep-2022 11:02                7056
imagick.tintimage.php                              30-Sep-2022 11:02                7966
imagick.tostring.php                               30-Sep-2022 11:02                2883
imagick.transformimage.php                         30-Sep-2022 11:02                5992
imagick.transformimagecolorspace.php               30-Sep-2022 11:02                5797
imagick.transparentpaintimage.php                  30-Sep-2022 11:02                7313
imagick.transposeimage.php                         30-Sep-2022 11:02                4598
imagick.transverseimage.php                        30-Sep-2022 11:02                4586
imagick.trimimage.php                              30-Sep-2022 11:02                5694
imagick.uniqueimagecolors.php                      30-Sep-2022 11:02                5640
imagick.unsharpmaskimage.php                       30-Sep-2022 11:02                6452
imagick.valid.php                                  30-Sep-2022 11:02                2125
imagick.vignetteimage.php                          30-Sep-2022 11:02                6439
imagick.waveimage.php                              30-Sep-2022 11:02                6288
imagick.whitethresholdimage.php                    30-Sep-2022 11:02                5242
imagick.writeimage.php                             30-Sep-2022 11:02                2831
imagick.writeimagefile.php                         30-Sep-2022 11:02                3531
imagick.writeimages.php                            30-Sep-2022 11:02                2630
imagick.writeimagesfile.php                        30-Sep-2022 11:02                3581
imagickdraw.affine.php                             30-Sep-2022 11:02               18695
imagickdraw.annotation.php                         30-Sep-2022 11:02                3078
imagickdraw.arc.php                                30-Sep-2022 11:02                9877
imagickdraw.bezier.php                             30-Sep-2022 11:02               19615
imagickdraw.circle.php                             30-Sep-2022 11:02                9240
imagickdraw.clear.php                              30-Sep-2022 11:02                2266
imagickdraw.clone.php                              30-Sep-2022 11:02                2418
imagickdraw.color.php                              30-Sep-2022 11:02                3240
imagickdraw.comment.php                            30-Sep-2022 11:02                2572
imagickdraw.composite.php                          30-Sep-2022 11:02               12258
imagickdraw.construct.php                          30-Sep-2022 11:02                2200
imagickdraw.destroy.php                            30-Sep-2022 11:02                2242
imagickdraw.ellipse.php                            30-Sep-2022 11:02               12473
imagickdraw.getclippath.php                        30-Sep-2022 11:02                2233
imagickdraw.getcliprule.php                        30-Sep-2022 11:02                2356
imagickdraw.getclipunits.php                       30-Sep-2022 11:02                2242
imagickdraw.getfillcolor.php                       30-Sep-2022 11:02                2367
imagickdraw.getfillopacity.php                     30-Sep-2022 11:02                2269
imagickdraw.getfillrule.php                        30-Sep-2022 11:02                2318
imagickdraw.getfont.php                            30-Sep-2022 11:02                2200
imagickdraw.getfontfamily.php                      30-Sep-2022 11:02                2260
imagickdraw.getfontsize.php                        30-Sep-2022 11:02                2338
imagickdraw.getfontstretch.php                     30-Sep-2022 11:02                2247
imagickdraw.getfontstyle.php                       30-Sep-2022 11:02                2481
imagickdraw.getfontweight.php                      30-Sep-2022 11:02                2262
imagickdraw.getgravity.php                         30-Sep-2022 11:02                2386
imagickdraw.getstrokeantialias.php                 30-Sep-2022 11:02                2554
imagickdraw.getstrokecolor.php                     30-Sep-2022 11:02                2766
imagickdraw.getstrokedasharray.php                 30-Sep-2022 11:02                2396
imagickdraw.getstrokedashoffset.php                30-Sep-2022 11:02                2370
imagickdraw.getstrokelinecap.php                   30-Sep-2022 11:02                2511
imagickdraw.getstrokelinejoin.php                  30-Sep-2022 11:02                2540
imagickdraw.getstrokemiterlimit.php                30-Sep-2022 11:02                2632
imagickdraw.getstrokeopacity.php                   30-Sep-2022 11:02                2315
imagickdraw.getstrokewidth.php                     30-Sep-2022 11:02                2324
imagickdraw.gettextalignment.php                   30-Sep-2022 11:02                2402
imagickdraw.gettextantialias.php                   30-Sep-2022 11:02                2435
imagickdraw.gettextdecoration.php                  30-Sep-2022 11:02                2439
imagickdraw.gettextencoding.php                    30-Sep-2022 11:02                2362
imagickdraw.gettextinterlinespacing.php            30-Sep-2022 11:02                2307
imagickdraw.gettextinterwordspacing.php            30-Sep-2022 11:02                2331
imagickdraw.gettextkerning.php                     30-Sep-2022 11:02                2236
imagickdraw.gettextundercolor.php                  30-Sep-2022 11:02                2470
imagickdraw.getvectorgraphics.php                  30-Sep-2022 11:02                2460
imagickdraw.line.php                               30-Sep-2022 11:02                8414
imagickdraw.matte.php                              30-Sep-2022 11:02                8407
imagickdraw.pathclose.php                          30-Sep-2022 11:02                2365
imagickdraw.pathcurvetoabsolute.php                30-Sep-2022 11:02                4502
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-Sep-2022 11:02               12229
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-Sep-2022 11:02                3991
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-Sep-2022 11:02               10809
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-Sep-2022 11:02               10948
imagickdraw.pathcurvetorelative.php                30-Sep-2022 11:02                4518
imagickdraw.pathcurvetosmoothabsolute.php          30-Sep-2022 11:02                4363
imagickdraw.pathcurvetosmoothrelative.php          30-Sep-2022 11:02                4370
imagickdraw.pathellipticarcabsolute.php            30-Sep-2022 11:02                5168
imagickdraw.pathellipticarcrelative.php            30-Sep-2022 11:02                5138
imagickdraw.pathfinish.php                         30-Sep-2022 11:02                2198
imagickdraw.pathlinetoabsolute.php                 30-Sep-2022 11:02                3024
imagickdraw.pathlinetohorizontalabsolute.php       30-Sep-2022 11:02                2928
imagickdraw.pathlinetohorizontalrelative.php       30-Sep-2022 11:02                2923
imagickdraw.pathlinetorelative.php                 30-Sep-2022 11:02                3074
imagickdraw.pathlinetoverticalabsolute.php         30-Sep-2022 11:02                2892
imagickdraw.pathlinetoverticalrelative.php         30-Sep-2022 11:02                2897
imagickdraw.pathmovetoabsolute.php                 30-Sep-2022 11:02                3071
imagickdraw.pathmovetorelative.php                 30-Sep-2022 11:02                3007
imagickdraw.pathstart.php                          30-Sep-2022 11:02               12463
imagickdraw.point.php                              30-Sep-2022 11:02                7056
imagickdraw.polygon.php                            30-Sep-2022 11:02                9486
imagickdraw.polyline.php                           30-Sep-2022 11:02                9480
imagickdraw.pop.php                                30-Sep-2022 11:02                2506
imagickdraw.popclippath.php                        30-Sep-2022 11:02                2157
imagickdraw.popdefs.php                            30-Sep-2022 11:02                8093
imagickdraw.poppattern.php                         30-Sep-2022 11:02                2239
imagickdraw.push.php                               30-Sep-2022 11:02                8720
imagickdraw.pushclippath.php                       30-Sep-2022 11:02                2799
imagickdraw.pushdefs.php                           30-Sep-2022 11:02                2456
imagickdraw.pushpattern.php                        30-Sep-2022 11:02               15205
imagickdraw.rectangle.php                          30-Sep-2022 11:02                8655
imagickdraw.render.php                             30-Sep-2022 11:02                2281
imagickdraw.resetvectorgraphics.php                30-Sep-2022 11:02                2268
imagickdraw.rotate.php                             30-Sep-2022 11:02                8002
imagickdraw.roundrectangle.php                     30-Sep-2022 11:02                9367
imagickdraw.scale.php                              30-Sep-2022 11:02                8299
imagickdraw.setclippath.php                        30-Sep-2022 11:02                8742
imagickdraw.setcliprule.php                        30-Sep-2022 11:02                9850
imagickdraw.setclipunits.php                       30-Sep-2022 11:02                9192
imagickdraw.setfillalpha.php                       30-Sep-2022 11:02                8018
imagickdraw.setfillcolor.php                       30-Sep-2022 11:02                8088
imagickdraw.setfillopacity.php                     30-Sep-2022 11:02                8076
imagickdraw.setfillpatternurl.php                  30-Sep-2022 11:02                3018
imagickdraw.setfillrule.php                        30-Sep-2022 11:02               14797
imagickdraw.setfont.php                            30-Sep-2022 11:02                9599
imagickdraw.setfontfamily.php                      30-Sep-2022 11:02               10301
imagickdraw.setfontsize.php                        30-Sep-2022 11:02                8679
imagickdraw.setfontstretch.php                     30-Sep-2022 11:02               10511
imagickdraw.setfontstyle.php                       30-Sep-2022 11:02                9316
imagickdraw.setfontweight.php                      30-Sep-2022 11:02                9515
imagickdraw.setgravity.php                         30-Sep-2022 11:02               11418
imagickdraw.setresolution.php                      30-Sep-2022 11:02                2650
imagickdraw.setstrokealpha.php                     30-Sep-2022 11:02                8728
imagickdraw.setstrokeantialias.php                 30-Sep-2022 11:02                9286
imagickdraw.setstrokecolor.php                     30-Sep-2022 11:02                8845
imagickdraw.setstrokedasharray.php                 30-Sep-2022 11:02               13946
imagickdraw.setstrokedashoffset.php                30-Sep-2022 11:02               10359
imagickdraw.setstrokelinecap.php                   30-Sep-2022 11:02                9010
imagickdraw.setstrokelinejoin.php                  30-Sep-2022 11:02               12591
imagickdraw.setstrokemiterlimit.php                30-Sep-2022 11:02               12183
imagickdraw.setstrokeopacity.php                   30-Sep-2022 11:02               10654
imagickdraw.setstrokepatternurl.php                30-Sep-2022 11:02                2766
imagickdraw.setstrokewidth.php                     30-Sep-2022 11:02                8759
imagickdraw.settextalignment.php                   30-Sep-2022 11:02                9800
imagickdraw.settextantialias.php                   30-Sep-2022 11:02                9263
imagickdraw.settextdecoration.php                  30-Sep-2022 11:02                7696
imagickdraw.settextencoding.php                    30-Sep-2022 11:02                3006
imagickdraw.settextinterlinespacing.php            30-Sep-2022 11:02                2723
imagickdraw.settextinterwordspacing.php            30-Sep-2022 11:02                2556
imagickdraw.settextkerning.php                     30-Sep-2022 11:02                2642
imagickdraw.settextundercolor.php                  30-Sep-2022 11:02                8105
imagickdraw.setvectorgraphics.php                  30-Sep-2022 11:02                9490
imagickdraw.setviewbox.php                         30-Sep-2022 11:02               10895
imagickdraw.skewx.php                              30-Sep-2022 11:02                8513
imagickdraw.skewy.php                              30-Sep-2022 11:02                8502
imagickdraw.translate.php                          30-Sep-2022 11:02                8796
imagickkernel.addkernel.php                        30-Sep-2022 11:02                7619
imagickkernel.addunitykernel.php                   30-Sep-2022 11:02               15972
imagickkernel.frombuiltin.php                      30-Sep-2022 11:02               29673
imagickkernel.frommatrix.php                       30-Sep-2022 11:02               26045
imagickkernel.getmatrix.php                        30-Sep-2022 11:02                8216
imagickkernel.scale.php                            30-Sep-2022 11:02               15173
imagickkernel.separate.php                         30-Sep-2022 11:02               11754
imagickpixel.clear.php                             30-Sep-2022 11:02                2246
imagickpixel.construct.php                         30-Sep-2022 11:02               13826
imagickpixel.destroy.php                           30-Sep-2022 11:02                2335
imagickpixel.getcolor.php                          30-Sep-2022 11:02                7636
imagickpixel.getcolorasstring.php                  30-Sep-2022 11:02                4822
imagickpixel.getcolorcount.php                     30-Sep-2022 11:02                4989
imagickpixel.getcolorquantum.php                   30-Sep-2022 11:02                2758
imagickpixel.getcolorvalue.php                     30-Sep-2022 11:02                8707
imagickpixel.getcolorvaluequantum.php              30-Sep-2022 11:02                6555
imagickpixel.gethsl.php                            30-Sep-2022 11:02                4287
imagickpixel.getindex.php                          30-Sep-2022 11:02                2163
imagickpixel.ispixelsimilar.php                    30-Sep-2022 11:02                3437
imagickpixel.ispixelsimilarquantum.php             30-Sep-2022 11:02                2973
imagickpixel.issimilar.php                         30-Sep-2022 11:02               22812
imagickpixel.setcolor.php                          30-Sep-2022 11:02                7662
imagickpixel.setcolorcount.php                     30-Sep-2022 11:02                2449
imagickpixel.setcolorvalue.php                     30-Sep-2022 11:02                4925
imagickpixel.setcolorvaluequantum.php              30-Sep-2022 11:02                8519
imagickpixel.sethsl.php                            30-Sep-2022 11:02                7469
imagickpixel.setindex.php                          30-Sep-2022 11:02                2384
imagickpixeliterator.clear.php                     30-Sep-2022 11:02                7190
imagickpixeliterator.construct.php                 30-Sep-2022 11:02                6907
imagickpixeliterator.destroy.php                   30-Sep-2022 11:02                2376
imagickpixeliterator.getcurrentiteratorrow.php     30-Sep-2022 11:02                2535
imagickpixeliterator.getiteratorrow.php            30-Sep-2022 11:02                2460
imagickpixeliterator.getnextiteratorrow.php        30-Sep-2022 11:02                7998
imagickpixeliterator.getpreviousiteratorrow.php    30-Sep-2022 11:02                2604
imagickpixeliterator.newpixeliterator.php          30-Sep-2022 11:02                2629
imagickpixeliterator.newpixelregioniterator.php    30-Sep-2022 11:02                3986
imagickpixeliterator.resetiterator.php             30-Sep-2022 11:02               10483
imagickpixeliterator.setiteratorfirstrow.php       30-Sep-2022 11:02                2470
imagickpixeliterator.setiteratorlastrow.php        30-Sep-2022 11:02                2463
imagickpixeliterator.setiteratorrow.php            30-Sep-2022 11:02                7868
imagickpixeliterator.synciterator.php              30-Sep-2022 11:02                2318
imap.configuration.php                             30-Sep-2022 11:02                3227
imap.constants.php                                 30-Sep-2022 11:02               17527
imap.installation.php                              30-Sep-2022 11:02                2672
imap.requirements.php                              30-Sep-2022 11:02                3070
imap.resources.php                                 30-Sep-2022 11:02                1430
imap.setup.php                                     30-Sep-2022 11:02                1632
index.php                                          30-Sep-2022 11:02               15736
indexes.examples.php                               30-Sep-2022 11:02              660091
indexes.functions.php                              30-Sep-2022 11:02             1137066
indexes.php                                        30-Sep-2022 11:02                1454
infiniteiterator.construct.php                     30-Sep-2022 11:02                5128
infiniteiterator.next.php                          30-Sep-2022 11:02                3256
info.configuration.php                             30-Sep-2022 11:02               19575
info.constants.php                                 30-Sep-2022 11:02                6429
info.installation.php                              30-Sep-2022 11:02                1272
info.requirements.php                              30-Sep-2022 11:02                1240
info.resources.php                                 30-Sep-2022 11:02                1224
info.setup.php                                     30-Sep-2022 11:02                1639
ini.core.php                                       30-Sep-2022 11:02               69810
ini.list.php                                       30-Sep-2022 11:02               86785
ini.php                                            30-Sep-2022 11:02                1581
ini.sections.php                                   30-Sep-2022 11:02                4084
inotify.configuration.php                          30-Sep-2022 11:02                1340
inotify.constants.php                              30-Sep-2022 11:02                7819
inotify.install.php                                30-Sep-2022 11:02                1809
inotify.requirements.php                           30-Sep-2022 11:02                1284
inotify.resources.php                              30-Sep-2022 11:02                1364
inotify.setup.php                                  30-Sep-2022 11:02                1680
install.cloud.azure.php                            30-Sep-2022 11:01                4383
install.cloud.ec2.php                              30-Sep-2022 11:01                1444
install.cloud.php                                  30-Sep-2022 11:01                1652
install.fpm.configuration.php                      30-Sep-2022 11:01               25206
install.fpm.install.php                            30-Sep-2022 11:01                3056
install.fpm.php                                    30-Sep-2022 11:01                3738
install.general.php                                30-Sep-2022 11:01                4819
install.macosx.bundled.php                         30-Sep-2022 11:01               10358
install.macosx.compile.php                         30-Sep-2022 11:01                1362
install.macosx.packages.php                        30-Sep-2022 11:01                3097
install.macosx.php                                 30-Sep-2022 11:01                1990
install.pecl.downloads.php                         30-Sep-2022 11:01                3593
install.pecl.intro.php                             30-Sep-2022 11:01                3113
install.pecl.pear.php                              30-Sep-2022 11:01                2993
install.pecl.php                                   30-Sep-2022 11:01                2088
install.pecl.php-config.php                        30-Sep-2022 11:01                3836
install.pecl.phpize.php                            30-Sep-2022 11:01                3165
install.pecl.static.php                            30-Sep-2022 11:01                3087
install.pecl.windows.php                           30-Sep-2022 11:01                9318
install.php                                        30-Sep-2022 11:01                5920
install.problems.bugs.php                          30-Sep-2022 11:01                1974
install.problems.faq.php                           30-Sep-2022 11:01                1273
install.problems.php                               30-Sep-2022 11:01                1546
install.problems.support.php                       30-Sep-2022 11:01                2368
install.unix.apache2.php                           30-Sep-2022 11:01               12715
install.unix.commandline.php                       30-Sep-2022 11:01                3917
install.unix.debian.php                            30-Sep-2022 11:01                6984
install.unix.lighttpd-14.php                       30-Sep-2022 11:01                5921
install.unix.litespeed.php                         30-Sep-2022 11:01                8978
install.unix.nginx.php                             30-Sep-2022 11:01                8325
install.unix.openbsd.php                           30-Sep-2022 11:01                5745
install.unix.php                                   30-Sep-2022 11:01                7399
install.unix.solaris.php                           30-Sep-2022 11:01                3953
install.windows.apache2.php                        30-Sep-2022 11:01                7068
install.windows.building.php                       30-Sep-2022 11:01                1687
install.windows.commandline.php                    30-Sep-2022 11:01                8160
install.windows.manual.php                         30-Sep-2022 11:01                5207
install.windows.pecl.php                           30-Sep-2022 11:01                1611
install.windows.php                                30-Sep-2022 11:01                3171
install.windows.recommended.php                    30-Sep-2022 11:01                4571
install.windows.requirements.php                   30-Sep-2022 11:01                2295
install.windows.tools.php                          30-Sep-2022 11:01                1750
install.windows.troubleshooting.php                30-Sep-2022 11:01                1692
intl.configuration.php                             30-Sep-2022 11:02                5093
intl.constants.php                                 30-Sep-2022 11:02                7307
intl.examples.basic.php                            30-Sep-2022 11:02                4433
intl.examples.php                                  30-Sep-2022 11:02                1355
intl.installation.php                              30-Sep-2022 11:02                2420
intl.requirements.php                              30-Sep-2022 11:02                1624
intl.resources.php                                 30-Sep-2022 11:02                1221
intl.setup.php                                     30-Sep-2022 11:02                1631
intlbreakiterator.construct.php                    30-Sep-2022 11:02                2410
intlbreakiterator.createcharacterinstance.php      30-Sep-2022 11:02                3117
intlbreakiterator.createcodepointinstance.php      30-Sep-2022 11:02                2753
intlbreakiterator.createlineinstance.php           30-Sep-2022 11:02                3078
intlbreakiterator.createsentenceinstance.php       30-Sep-2022 11:02                3080
intlbreakiterator.createtitleinstance.php          30-Sep-2022 11:02                3060
intlbreakiterator.createwordinstance.php           30-Sep-2022 11:02                3014
intlbreakiterator.current.php                      30-Sep-2022 11:02                2384
intlbreakiterator.first.php                        30-Sep-2022 11:02                2368
intlbreakiterator.following.php                    30-Sep-2022 11:02                2616
intlbreakiterator.geterrorcode.php                 30-Sep-2022 11:02                2859
intlbreakiterator.geterrormessage.php              30-Sep-2022 11:02                2994
intlbreakiterator.getlocale.php                    30-Sep-2022 11:02                2608
intlbreakiterator.getpartsiterator.php             30-Sep-2022 11:02                3410
intlbreakiterator.gettext.php                      30-Sep-2022 11:02                2443
intlbreakiterator.isboundary.php                   30-Sep-2022 11:02                2585
intlbreakiterator.last.php                         30-Sep-2022 11:02                2367
intlbreakiterator.next.php                         30-Sep-2022 11:02                2669
intlbreakiterator.preceding.php                    30-Sep-2022 11:02                2594
intlbreakiterator.previous.php                     30-Sep-2022 11:02                2423
intlbreakiterator.settext.php                      30-Sep-2022 11:02                2602
intlcalendar.add.php                               30-Sep-2022 11:02                8352
intlcalendar.after.php                             30-Sep-2022 11:02                6678
intlcalendar.before.php                            30-Sep-2022 11:02                3918
intlcalendar.clear.php                             30-Sep-2022 11:02               20703
intlcalendar.construct.php                         30-Sep-2022 11:02                2305
intlcalendar.createinstance.php                    30-Sep-2022 11:02               12844
intlcalendar.equals.php                            30-Sep-2022 11:02               10918
intlcalendar.fielddifference.php                   30-Sep-2022 11:02               11292
intlcalendar.fromdatetime.php                      30-Sep-2022 11:02                7440
intlcalendar.get.php                               30-Sep-2022 11:02                8849
intlcalendar.getactualmaximum.php                  30-Sep-2022 11:02                8401
intlcalendar.getactualminimum.php                  30-Sep-2022 11:02                5570
intlcalendar.getavailablelocales.php               30-Sep-2022 11:02                4173
intlcalendar.getdayofweektype.php                  30-Sep-2022 11:02                9808
intlcalendar.geterrorcode.php                      30-Sep-2022 11:02                9028
intlcalendar.geterrormessage.php                   30-Sep-2022 11:02                5942
intlcalendar.getfirstdayofweek.php                 30-Sep-2022 11:02                8464
intlcalendar.getgreatestminimum.php                30-Sep-2022 11:02                4408
intlcalendar.getkeywordvaluesforlocale.php         30-Sep-2022 11:02                7529
intlcalendar.getleastmaximum.php                   30-Sep-2022 11:02                8198
intlcalendar.getlocale.php                         30-Sep-2022 11:02                5910
intlcalendar.getmaximum.php                        30-Sep-2022 11:02                5103
intlcalendar.getminimaldaysinfirstweek.php         30-Sep-2022 11:02                9004
intlcalendar.getminimum.php                        30-Sep-2022 11:02                4352
intlcalendar.getnow.php                            30-Sep-2022 11:02                5310
intlcalendar.getrepeatedwalltimeoption.php         30-Sep-2022 11:02               10298
intlcalendar.getskippedwalltimeoption.php          30-Sep-2022 11:02               12707
intlcalendar.gettime.php                           30-Sep-2022 11:02                6429
intlcalendar.gettimezone.php                       30-Sep-2022 11:02                7525
intlcalendar.gettype.php                           30-Sep-2022 11:02                5583
intlcalendar.getweekendtransition.php              30-Sep-2022 11:02                4692
intlcalendar.indaylighttime.php                    30-Sep-2022 11:02                8738
intlcalendar.isequivalentto.php                    30-Sep-2022 11:02                8483
intlcalendar.islenient.php                         30-Sep-2022 11:02                8317
intlcalendar.isset.php                             30-Sep-2022 11:02                4596
intlcalendar.isweekend.php                         30-Sep-2022 11:02                8675
intlcalendar.roll.php                              30-Sep-2022 11:02                9018
intlcalendar.set.php                               30-Sep-2022 11:02               14060
intlcalendar.setfirstdayofweek.php                 30-Sep-2022 11:02                7867
intlcalendar.setlenient.php                        30-Sep-2022 11:02                4065
intlcalendar.setminimaldaysinfirstweek.php         30-Sep-2022 11:02                4067
intlcalendar.setrepeatedwalltimeoption.php         30-Sep-2022 11:02                5369
intlcalendar.setskippedwalltimeoption.php          30-Sep-2022 11:02                6078
intlcalendar.settime.php                           30-Sep-2022 11:02                8570
intlcalendar.settimezone.php                       30-Sep-2022 11:02               10852
intlcalendar.todatetime.php                        30-Sep-2022 11:02                7152
intlchar.charage.php                               30-Sep-2022 11:02                5488
intlchar.chardigitvalue.php                        30-Sep-2022 11:02                5160
intlchar.chardirection.php                         30-Sep-2022 11:02                8601
intlchar.charfromname.php                          30-Sep-2022 11:02                6680
intlchar.charmirror.php                            30-Sep-2022 11:02                5906
intlchar.charname.php                              30-Sep-2022 11:02                6953
intlchar.chartype.php                              30-Sep-2022 11:02                9142
intlchar.chr.php                                   30-Sep-2022 11:02                5337
intlchar.digit.php                                 30-Sep-2022 11:02                7920
intlchar.enumcharnames.php                         30-Sep-2022 11:02                7654
intlchar.enumchartypes.php                         30-Sep-2022 11:02                5726
intlchar.foldcase.php                              30-Sep-2022 11:02                3448
intlchar.fordigit.php                              30-Sep-2022 11:02                6833
intlchar.getbidipairedbracket.php                  30-Sep-2022 11:02                5504
intlchar.getblockcode.php                          30-Sep-2022 11:02                5234
intlchar.getcombiningclass.php                     30-Sep-2022 11:02                4548
intlchar.getfc-nfkc-closure.php                    30-Sep-2022 11:02                4489
intlchar.getintpropertymaxvalue.php                30-Sep-2022 11:02                6309
intlchar.getintpropertyminvalue.php                30-Sep-2022 11:02                6302
intlchar.getintpropertyvalue.php                   30-Sep-2022 11:02                7627
intlchar.getnumericvalue.php                       30-Sep-2022 11:02                5058
intlchar.getpropertyenum.php                       30-Sep-2022 11:02                6484
intlchar.getpropertyname.php                       30-Sep-2022 11:02                8150
intlchar.getpropertyvalueenum.php                  30-Sep-2022 11:02                7810
intlchar.getpropertyvaluename.php                  30-Sep-2022 11:02                9888
intlchar.getunicodeversion.php                     30-Sep-2022 11:02                3888
intlchar.hasbinaryproperty.php                     30-Sep-2022 11:02                8490
intlchar.isalnum.php                               30-Sep-2022 11:02                5282
intlchar.isalpha.php                               30-Sep-2022 11:02                5170
intlchar.isbase.php                                30-Sep-2022 11:02                5647
intlchar.isblank.php                               30-Sep-2022 11:02                6359
intlchar.iscntrl.php                               30-Sep-2022 11:02                5959
intlchar.isdefined.php                             30-Sep-2022 11:02                6389
intlchar.isdigit.php                               30-Sep-2022 11:02                5508
intlchar.isgraph.php                               30-Sep-2022 11:02                5198
intlchar.isidignorable.php                         30-Sep-2022 11:02                5786
intlchar.isidpart.php                              30-Sep-2022 11:02                6366
intlchar.isidstart.php                             30-Sep-2022 11:02                5873
intlchar.isisocontrol.php                          30-Sep-2022 11:02                5125
intlchar.isjavaidpart.php                          30-Sep-2022 11:02                6465
intlchar.isjavaidstart.php                         30-Sep-2022 11:02                6165
intlchar.isjavaspacechar.php                       30-Sep-2022 11:02                6403
intlchar.islower.php                               30-Sep-2022 11:02                6669
intlchar.ismirrored.php                            30-Sep-2022 11:02                5235
intlchar.isprint.php                               30-Sep-2022 11:02                5479
intlchar.ispunct.php                               30-Sep-2022 11:02                4945
intlchar.isspace.php                               30-Sep-2022 11:02                6046
intlchar.istitle.php                               30-Sep-2022 11:02                6107
intlchar.isualphabetic.php                         30-Sep-2022 11:02                5466
intlchar.isulowercase.php                          30-Sep-2022 11:02                6446
intlchar.isupper.php                               30-Sep-2022 11:02                6667
intlchar.isuuppercase.php                          30-Sep-2022 11:02                6484
intlchar.isuwhitespace.php                         30-Sep-2022 11:02                6990
intlchar.iswhitespace.php                          30-Sep-2022 11:02                7118
intlchar.isxdigit.php                              30-Sep-2022 11:02                6549
intlchar.ord.php                                   30-Sep-2022 11:02                5151
intlchar.tolower.php                               30-Sep-2022 11:02                7092
intlchar.totitle.php                               30-Sep-2022 11:02                7103
intlchar.toupper.php                               30-Sep-2022 11:02                7025
intlcodepointbreakiterator.getlastcodepoint.php    30-Sep-2022 11:02                2673
intldateformatter.create.php                       30-Sep-2022 11:02               27134
intldateformatter.format.php                       30-Sep-2022 11:02               27588
intldateformatter.formatobject.php                 30-Sep-2022 11:02               13967
intldateformatter.getcalendar.php                  30-Sep-2022 11:02                9440
intldateformatter.getcalendarobject.php            30-Sep-2022 11:02                7583
intldateformatter.getdatetype.php                  30-Sep-2022 11:02               12199
intldateformatter.geterrorcode.php                 30-Sep-2022 11:02                9237
intldateformatter.geterrormessage.php              30-Sep-2022 11:02                9145
intldateformatter.getlocale.php                    30-Sep-2022 11:02               12465
intldateformatter.getpattern.php                   30-Sep-2022 11:02               10755
intldateformatter.gettimetype.php                  30-Sep-2022 11:02               12193
intldateformatter.gettimezone.php                  30-Sep-2022 11:02                8729
intldateformatter.gettimezoneid.php                30-Sep-2022 11:02                9087
intldateformatter.islenient.php                    30-Sep-2022 11:02               15870
intldateformatter.localtime.php                    30-Sep-2022 11:02               11711
intldateformatter.parse.php                        30-Sep-2022 11:02               12459
intldateformatter.setcalendar.php                  30-Sep-2022 11:02               14521
intldateformatter.setlenient.php                   30-Sep-2022 11:02               16626
intldateformatter.setpattern.php                   30-Sep-2022 11:02               11839
intldateformatter.settimezone.php                  30-Sep-2022 11:02               11536
intldatepatterngenerator.create.php                30-Sep-2022 11:02                3773
intldatepatterngenerator.getbestpattern.php        30-Sep-2022 11:02                6802
intlgregoriancalendar.construct.php                30-Sep-2022 11:02                5083
intlgregoriancalendar.getgregorianchange.php       30-Sep-2022 11:02                2590
intlgregoriancalendar.isleapyear.php               30-Sep-2022 11:02                2814
intlgregoriancalendar.setgregorianchange.php       30-Sep-2022 11:02                2837
intliterator.current.php                           30-Sep-2022 11:02                2304
intliterator.key.php                               30-Sep-2022 11:02                2286
intliterator.next.php                              30-Sep-2022 11:02                2291
intliterator.rewind.php                            30-Sep-2022 11:02                2323
intliterator.valid.php                             30-Sep-2022 11:02                2310
intlpartsiterator.getbreakiterator.php             30-Sep-2022 11:02                2492
intlrulebasedbreakiterator.construct.php           30-Sep-2022 11:02                3001
intlrulebasedbreakiterator.getbinaryrules.php      30-Sep-2022 11:02                2698
intlrulebasedbreakiterator.getrules.php            30-Sep-2022 11:02                2662
intlrulebasedbreakiterator.getrulestatus.php       30-Sep-2022 11:02                2662
intlrulebasedbreakiterator.getrulestatusvec.php    30-Sep-2022 11:02                2758
intltimezone.construct.php                         30-Sep-2022 11:02                1946
intltimezone.countequivalentids.php                30-Sep-2022 11:02                3372
intltimezone.createdefault.php                     30-Sep-2022 11:02                2982
intltimezone.createenumeration.php                 30-Sep-2022 11:02                4128
intltimezone.createtimezone.php                    30-Sep-2022 11:02                3404
intltimezone.createtimezoneidenumeration.php       30-Sep-2022 11:02                5044
intltimezone.fromdatetimezone.php                  30-Sep-2022 11:02                3645
intltimezone.getcanonicalid.php                    30-Sep-2022 11:02                3875
intltimezone.getdisplayname.php                    30-Sep-2022 11:02                4780
intltimezone.getdstsavings.php                     30-Sep-2022 11:02                2998
intltimezone.getequivalentid.php                   30-Sep-2022 11:02                3662
intltimezone.geterrorcode.php                      30-Sep-2022 11:02                3118
intltimezone.geterrormessage.php                   30-Sep-2022 11:02                3142
intltimezone.getgmt.php                            30-Sep-2022 11:02                2831
intltimezone.getid.php                             30-Sep-2022 11:02                2994
intltimezone.getidforwindowsid.php                 30-Sep-2022 11:02                5209
intltimezone.getoffset.php                         30-Sep-2022 11:02                4512
intltimezone.getrawoffset.php                      30-Sep-2022 11:02                2949
intltimezone.getregion.php                         30-Sep-2022 11:02                3313
intltimezone.gettzdataversion.php                  30-Sep-2022 11:02                3033
intltimezone.getunknown.php                        30-Sep-2022 11:02                3046
intltimezone.getwindowsid.php                      30-Sep-2022 11:02                4069
intltimezone.hassamerules.php                      30-Sep-2022 11:02                3380
intltimezone.todatetimezone.php                    30-Sep-2022 11:02                3363
intltimezone.usedaylighttime.php                   30-Sep-2022 11:02                2973
intro-whatcando.php                                30-Sep-2022 11:01                8219
intro-whatis.php                                   30-Sep-2022 11:01                4435
intro.apache.php                                   30-Sep-2022 11:02                2248
intro.apcu.php                                     30-Sep-2022 11:02                1580
intro.array.php                                    30-Sep-2022 11:02                1968
intro.bc.php                                       30-Sep-2022 11:02                1254
intro.bzip2.php                                    30-Sep-2022 11:02                1226
intro.calendar.php                                 30-Sep-2022 11:02                2281
intro.classobj.php                                 30-Sep-2022 11:02                1738
intro.cmark.php                                    30-Sep-2022 11:02                6384
intro.com.php                                      30-Sep-2022 11:02                3086
intro.componere.php                                30-Sep-2022 11:02                6147
intro.csprng.php                                   30-Sep-2022 11:02                1670
intro.ctype.php                                    30-Sep-2022 11:02                2597
intro.cubrid.php                                   30-Sep-2022 11:02                1474
intro.curl.php                                     30-Sep-2022 11:02                1612
intro.datetime.php                                 30-Sep-2022 11:02                2400
intro.dba.php                                      30-Sep-2022 11:02                1494
intro.dbase.php                                    30-Sep-2022 11:02                4359
intro.dio.php                                      30-Sep-2022 11:02                1693
intro.dom.php                                      30-Sep-2022 11:02                1796
intro.ds.php                                       30-Sep-2022 11:02                1396
intro.eio.php                                      30-Sep-2022 11:02               15598
intro.enchant.php                                  30-Sep-2022 11:02                2607
intro.errorfunc.php                                30-Sep-2022 11:02                1987
intro.ev.php                                       30-Sep-2022 11:02                2291
intro.event.php                                    30-Sep-2022 11:02                1974
intro.exec.php                                     30-Sep-2022 11:02                1267
intro.exif.php                                     30-Sep-2022 11:02                1436
intro.expect.php                                   30-Sep-2022 11:02                1428
intro.fann.php                                     30-Sep-2022 11:02                1417
intro.fdf.php                                      30-Sep-2022 11:02                3823
intro.ffi.php                                      30-Sep-2022 11:02                2844
intro.fileinfo.php                                 30-Sep-2022 11:02                1410
intro.filesystem.php                               30-Sep-2022 11:02                1479
intro.filter.php                                   30-Sep-2022 11:02                2709
intro.fpm.php                                      30-Sep-2022 11:02                1308
intro.ftp.php                                      30-Sep-2022 11:02                1765
intro.funchand.php                                 30-Sep-2022 11:02                1323
intro.gearman.php                                  30-Sep-2022 11:02                1658
intro.gender.php                                   30-Sep-2022 11:02                1326
intro.geoip.php                                    30-Sep-2022 11:02                1564
intro.gettext.php                                  30-Sep-2022 11:02                1553
intro.gmagick.php                                  30-Sep-2022 11:02                1688
intro.gmp.php                                      30-Sep-2022 11:02                2780
intro.gnupg.php                                    30-Sep-2022 11:02                1215
intro.hash.php                                     30-Sep-2022 11:02                1230
intro.hrtime.php                                   30-Sep-2022 11:02                1659
intro.ibase.php                                    30-Sep-2022 11:02                3139
intro.ibm-db2.php                                  30-Sep-2022 11:02                1275
intro.iconv.php                                    30-Sep-2022 11:02                1951
intro.igbinary.php                                 30-Sep-2022 11:02                1670
intro.image.php                                    30-Sep-2022 11:02                2932
intro.imagick.php                                  30-Sep-2022 11:02                1707
intro.imap.php                                     30-Sep-2022 11:02                1682
intro.info.php                                     30-Sep-2022 11:02                1576
intro.inotify.php                                  30-Sep-2022 11:02                2337
intro.intl.php                                     30-Sep-2022 11:02                5013
intro.json.php                                     30-Sep-2022 11:02                2240
intro.ldap.php                                     30-Sep-2022 11:02                4076
intro.libxml.php                                   30-Sep-2022 11:02                1782
intro.lua.php                                      30-Sep-2022 11:02                1291
intro.luasandbox.php                               30-Sep-2022 11:02                2360
intro.lzf.php                                      30-Sep-2022 11:02                1463
intro.mail.php                                     30-Sep-2022 11:02                1213
intro.mailparse.php                                30-Sep-2022 11:02                1932
intro.math.php                                     30-Sep-2022 11:02                1629
intro.mbstring.php                                 30-Sep-2022 11:02                2768
intro.mcrypt.php                                   30-Sep-2022 11:02                2287
intro.memcache.php                                 30-Sep-2022 11:02                1679
intro.memcached.php                                30-Sep-2022 11:02                1872
intro.mhash.php                                    30-Sep-2022 11:02                2000
intro.misc.php                                     30-Sep-2022 11:02                1188
intro.mqseries.php                                 30-Sep-2022 11:02                1739
intro.mysql-xdevapi.php                            30-Sep-2022 11:02                1875
intro.mysql.php                                    30-Sep-2022 11:02                1521
intro.mysqli.php                                   30-Sep-2022 11:02                2238
intro.mysqlnd.php                                  30-Sep-2022 11:02                1912
intro.network.php                                  30-Sep-2022 11:02                1154
intro.oauth.php                                    30-Sep-2022 11:02                1329
intro.oci8.php                                     30-Sep-2022 11:02                1664
intro.opcache.php                                  30-Sep-2022 11:02                1525
intro.openal.php                                   30-Sep-2022 11:02                1248
intro.openssl.php                                  30-Sep-2022 11:02                1575
intro.outcontrol.php                               30-Sep-2022 11:02                2417
intro.parallel.php                                 30-Sep-2022 11:02                6830
intro.parle.php                                    30-Sep-2022 11:02                3434
intro.password.php                                 30-Sep-2022 11:02                1598
intro.pcntl.php                                    30-Sep-2022 11:02                2616
intro.pcre.php                                     30-Sep-2022 11:02                2712
intro.pdo.php                                      30-Sep-2022 11:02                2100
intro.pgsql.php                                    30-Sep-2022 11:02                1649
intro.phar.php                                     30-Sep-2022 11:02               10112
intro.phpdbg.php                                   30-Sep-2022 11:02                6036
intro.posix.php                                    30-Sep-2022 11:02                1721
intro.ps.php                                       30-Sep-2022 11:02                1757
intro.pspell.php                                   30-Sep-2022 11:02                1190
intro.pthreads.php                                 30-Sep-2022 11:02                9121
intro.quickhash.php                                30-Sep-2022 11:02                1262
intro.radius.php                                   30-Sep-2022 11:02                2160
intro.rar.php                                      30-Sep-2022 11:02                1536
intro.readline.php                                 30-Sep-2022 11:02                1921
intro.recode.php                                   30-Sep-2022 11:02                2264
intro.reflection.php                               30-Sep-2022 11:02                1902
intro.rpminfo.php                                  30-Sep-2022 11:02                1221
intro.rrd.php                                      30-Sep-2022 11:02                1431
intro.runkit7.php                                  30-Sep-2022 11:02                1474
intro.scoutapm.php                                 30-Sep-2022 11:02                1467
intro.seaslog.php                                  30-Sep-2022 11:02                4168
intro.sem.php                                      30-Sep-2022 11:02                3218
intro.session.php                                  30-Sep-2022 11:02                5579
intro.shmop.php                                    30-Sep-2022 11:02                1922
intro.simplexml.php                                30-Sep-2022 11:02                1342
intro.snmp.php                                     30-Sep-2022 11:02                1846
intro.soap.php                                     30-Sep-2022 11:02                1459
intro.sockets.php                                  30-Sep-2022 11:02                2939
intro.sodium.php                                   30-Sep-2022 11:02                1325
intro.solr.php                                     30-Sep-2022 11:02                1789
intro.spl.php                                      30-Sep-2022 11:02                1392
intro.sqlite3.php                                  30-Sep-2022 11:02                1155
intro.sqlsrv.php                                   30-Sep-2022 11:02                2161
intro.ssdeep.php                                   30-Sep-2022 11:02                1754
intro.ssh2.php                                     30-Sep-2022 11:02                1336
intro.stats.php                                    30-Sep-2022 11:02                1506
intro.stomp.php                                    30-Sep-2022 11:02                1339
intro.stream.php                                   30-Sep-2022 11:02                3871
intro.strings.php                                  30-Sep-2022 11:02                1675
intro.svm.php                                      30-Sep-2022 11:02                1237
intro.svn.php                                      30-Sep-2022 11:02                1812
intro.swoole.php                                   30-Sep-2022 11:02                1646
intro.sync.php                                     30-Sep-2022 11:02                2347
intro.taint.php                                    30-Sep-2022 11:02                4526
intro.tcpwrap.php                                  30-Sep-2022 11:02                1279
intro.tidy.php                                     30-Sep-2022 11:02                1284
intro.tokenizer.php                                30-Sep-2022 11:02                1535
intro.trader.php                                   30-Sep-2022 11:02                2383
intro.ui.php                                       30-Sep-2022 11:02                1206
intro.uodbc.php                                    30-Sep-2022 11:02                2833
intro.uopz.php                                     30-Sep-2022 11:02                2397
intro.url.php                                      30-Sep-2022 11:02                1146
intro.v8js.php                                     30-Sep-2022 11:02                1223
intro.var.php                                      30-Sep-2022 11:02                1392
intro.var_representation.php                       30-Sep-2022 11:02                1424
intro.varnish.php                                  30-Sep-2022 11:02                1313
intro.wddx.php                                     30-Sep-2022 11:02                1218
intro.win32service.php                             30-Sep-2022 11:02                1396
intro.wincache.php                                 30-Sep-2022 11:02                4970
intro.wkhtmltox.php                                30-Sep-2022 11:02                1272
intro.xattr.php                                    30-Sep-2022 11:02                1193
intro.xdiff.php                                    30-Sep-2022 11:02                2607
intro.xhprof.php                                   30-Sep-2022 11:02                2789
intro.xlswriter.php                                30-Sep-2022 11:02                1185
intro.xml.php                                      30-Sep-2022 11:02                2350
intro.xmldiff.php                                  30-Sep-2022 11:02                1406
intro.xmlreader.php                                30-Sep-2022 11:02                1590
intro.xmlrpc.php                                   30-Sep-2022 11:02                1920
intro.xmlwriter.php                                30-Sep-2022 11:02                1544
intro.xsl.php                                      30-Sep-2022 11:02                1334
intro.yac.php                                      30-Sep-2022 11:02                1197
intro.yaconf.php                                   30-Sep-2022 11:02                2567
intro.yaf.php                                      30-Sep-2022 11:02                1545
intro.yaml.php                                     30-Sep-2022 11:02                1401
intro.yar.php                                      30-Sep-2022 11:02                1266
intro.yaz.php                                      30-Sep-2022 11:02                2520
intro.zip.php                                      30-Sep-2022 11:02                1187
intro.zlib.php                                     30-Sep-2022 11:02                2643
intro.zmq.php                                      30-Sep-2022 11:02                1432
intro.zookeeper.php                                30-Sep-2022 11:02                1443
introduction.php                                   30-Sep-2022 11:01                1443
iterator.current.php                               30-Sep-2022 11:01                2153
iterator.key.php                                   30-Sep-2022 11:01                2452
iterator.next.php                                  30-Sep-2022 11:01                2348
iterator.rewind.php                                30-Sep-2022 11:01                2557
iterator.valid.php                                 30-Sep-2022 11:01                2509
iteratoraggregate.getiterator.php                  30-Sep-2022 11:01                2829
iteratoriterator.construct.php                     30-Sep-2022 11:02                2944
iteratoriterator.current.php                       30-Sep-2022 11:02                2742
iteratoriterator.getinneriterator.php              30-Sep-2022 11:02                3056
iteratoriterator.key.php                           30-Sep-2022 11:02                2690
iteratoriterator.next.php                          30-Sep-2022 11:02                2793
iteratoriterator.rewind.php                        30-Sep-2022 11:02                2812
iteratoriterator.valid.php                         30-Sep-2022 11:02                2860
json.configuration.php                             30-Sep-2022 11:02                1300
json.constants.php                                 30-Sep-2022 11:02                9565
json.installation.php                              30-Sep-2022 11:02                1272
json.requirements.php                              30-Sep-2022 11:02                1685
json.resources.php                                 30-Sep-2022 11:02                1224
json.setup.php                                     30-Sep-2022 11:02                1606
jsonserializable.jsonserialize.php                 30-Sep-2022 11:02               12842
langref.php                                        30-Sep-2022 11:01               19746
language.attributes.classes.php                    30-Sep-2022 11:01                5443
language.attributes.overview.php                   30-Sep-2022 11:01               11506
language.attributes.php                            30-Sep-2022 11:01                1685
language.attributes.reflection.php                 30-Sep-2022 11:01                8539
language.attributes.syntax.php                     30-Sep-2022 11:01                5077
language.basic-syntax.comments.php                 30-Sep-2022 11:01                4486
language.basic-syntax.instruction-separation.php   30-Sep-2022 11:01                4428
language.basic-syntax.php                          30-Sep-2022 11:01                1674
language.basic-syntax.phpmode.php                  30-Sep-2022 11:01                4884
language.basic-syntax.phptags.php                  30-Sep-2022 11:01                5311
language.constants.magic.php                       30-Sep-2022 11:01                5129
language.constants.php                             30-Sep-2022 11:01                6461
language.constants.predefined.php                  30-Sep-2022 11:01                1553
language.constants.syntax.php                      30-Sep-2022 11:01               10368
language.control-structures.php                    30-Sep-2022 11:01                2746
language.enumerations.backed.php                   30-Sep-2022 11:01               10668
language.enumerations.basics.php                   30-Sep-2022 11:01                7825
language.enumerations.constants.php                30-Sep-2022 11:01                2482
language.enumerations.examples.php                 30-Sep-2022 11:01                7940
language.enumerations.expressions.php              30-Sep-2022 11:01                6017
language.enumerations.listing.php                  30-Sep-2022 11:01                2254
language.enumerations.methods.php                  30-Sep-2022 11:01               16095
language.enumerations.object-differences.php       30-Sep-2022 11:01                4940
language.enumerations.overview.php                 30-Sep-2022 11:01                2359
language.enumerations.php                          30-Sep-2022 11:01                2520
language.enumerations.serialization.php            30-Sep-2022 11:01                4979
language.enumerations.static-methods.php           30-Sep-2022 11:01                3816
language.enumerations.traits.php                   30-Sep-2022 11:01                4989
language.errors.basics.php                         30-Sep-2022 11:01                4861
language.errors.php                                30-Sep-2022 11:01                1877
language.errors.php7.php                           30-Sep-2022 11:01                5853
language.exceptions.extending.php                  30-Sep-2022 11:01               24924
language.exceptions.php                            30-Sep-2022 11:01               30634
language.expressions.php                           30-Sep-2022 11:01               16871
language.fibers.php                                30-Sep-2022 11:01                6224
language.functions.php                             30-Sep-2022 11:01                2045
language.generators.comparison.php                 30-Sep-2022 11:01               10396
language.generators.overview.php                   30-Sep-2022 11:01               10225
language.generators.php                            30-Sep-2022 11:01                1574
language.generators.syntax.php                     30-Sep-2022 11:01               26907
language.namespaces.basics.php                     30-Sep-2022 11:01               12621
language.namespaces.definition.php                 30-Sep-2022 11:01                4499
language.namespaces.definitionmultiple.php         30-Sep-2022 11:01                9920
language.namespaces.dynamic.php                    30-Sep-2022 11:01                8746
language.namespaces.fallback.php                   30-Sep-2022 11:01                6635
language.namespaces.faq.php                        30-Sep-2022 11:01               34093
language.namespaces.global.php                     30-Sep-2022 11:01                3045
language.namespaces.importing.php                  30-Sep-2022 11:01               18648
language.namespaces.nested.php                     30-Sep-2022 11:01                2998
language.namespaces.nsconstants.php                30-Sep-2022 11:01                9801
language.namespaces.php                            30-Sep-2022 11:01                2465
language.namespaces.rationale.php                  30-Sep-2022 11:01                7280
language.namespaces.rules.php                      30-Sep-2022 11:01               15069
language.oop5.abstract.php                         30-Sep-2022 11:01               12418
language.oop5.anonymous.php                        30-Sep-2022 11:01               12069
language.oop5.autoload.php                         30-Sep-2022 11:01                6733
language.oop5.basic.php                            30-Sep-2022 11:01               49004
language.oop5.changelog.php                        30-Sep-2022 11:01                7219
language.oop5.cloning.php                          30-Sep-2022 11:01                8438
language.oop5.constants.php                        30-Sep-2022 11:01               10544
language.oop5.decon.php                            30-Sep-2022 11:01               25852
language.oop5.final.php                            30-Sep-2022 11:01                6852
language.oop5.inheritance.php                      30-Sep-2022 11:01               14464
language.oop5.interfaces.php                       30-Sep-2022 11:01               16032
language.oop5.iterations.php                       30-Sep-2022 11:01               20152
language.oop5.late-static-bindings.php             30-Sep-2022 11:01               16272
language.oop5.magic.php                            30-Sep-2022 11:01               37946
language.oop5.object-comparison.php                30-Sep-2022 11:01                9662
language.oop5.overloading.php                      30-Sep-2022 11:01               26821
language.oop5.paamayim-nekudotayim.php             30-Sep-2022 11:01                8989
language.oop5.php                                  30-Sep-2022 11:01                3409
language.oop5.properties.php                       30-Sep-2022 11:01               28306
language.oop5.references.php                       30-Sep-2022 11:01                6281
language.oop5.serialization.php                    30-Sep-2022 11:01                7523
language.oop5.static.php                           30-Sep-2022 11:01               10346
language.oop5.traits.php                           30-Sep-2022 11:01               34988
language.oop5.variance.php                         30-Sep-2022 11:01               17209
language.oop5.visibility.php                       30-Sep-2022 11:01               22464
language.operators.arithmetic.php                  30-Sep-2022 11:01                6049
language.operators.array.php                       30-Sep-2022 11:01                8783
language.operators.assignment.php                  30-Sep-2022 11:01                9125
language.operators.bitwise.php                     30-Sep-2022 11:01               47665
language.operators.comparison.php                  30-Sep-2022 11:01               36549
language.operators.errorcontrol.php                30-Sep-2022 11:01                5512
language.operators.execution.php                   30-Sep-2022 11:01                3365
language.operators.increment.php                   30-Sep-2022 11:01               11169
language.operators.logical.php                     30-Sep-2022 11:01                7220
language.operators.php                             30-Sep-2022 11:01                3982
language.operators.precedence.php                  30-Sep-2022 11:01               17114
language.operators.string.php                      30-Sep-2022 11:01                3142
language.operators.type.php                        30-Sep-2022 11:01               16080
language.references.arent.php                      30-Sep-2022 11:01                3283
language.references.pass.php                       30-Sep-2022 11:01                7177
language.references.php                            30-Sep-2022 11:01                1978
language.references.return.php                     30-Sep-2022 11:01                7644
language.references.spot.php                       30-Sep-2022 11:01                2555
language.references.unset.php                      30-Sep-2022 11:01                2304
language.references.whatare.php                    30-Sep-2022 11:01                2089
language.references.whatdo.php                     30-Sep-2022 11:01               19645
language.types.array.php                           30-Sep-2022 11:01               99660
language.types.boolean.php                         30-Sep-2022 11:01                9385
language.types.callable.php                        30-Sep-2022 11:01               13025
language.types.declarations.php                    30-Sep-2022 11:01               52829
language.types.enumerations.php                    30-Sep-2022 11:01                3568
language.types.float.php                           30-Sep-2022 11:01                9264
language.types.integer.php                         30-Sep-2022 11:01               19147
language.types.intro.php                           30-Sep-2022 11:01                7728
language.types.iterable.php                        30-Sep-2022 11:01                6656
language.types.null.php                            30-Sep-2022 11:01                3382
language.types.numeric-strings.php                 30-Sep-2022 11:01               10691
language.types.object.php                          30-Sep-2022 11:01                5683
language.types.php                                 30-Sep-2022 11:01                2370
language.types.resource.php                        30-Sep-2022 11:01                2876
language.types.string.php                          30-Sep-2022 11:01               82248
language.types.type-juggling.php                   30-Sep-2022 11:01               14567
language.variables.basics.php                      30-Sep-2022 11:01               14903
language.variables.external.php                    30-Sep-2022 11:01               18137
language.variables.php                             30-Sep-2022 11:01                1758
language.variables.predefined.php                  30-Sep-2022 11:01                2987
language.variables.scope.php                       30-Sep-2022 11:01               27001
language.variables.superglobals.php                30-Sep-2022 11:01                4965
language.variables.variable.php                    30-Sep-2022 11:01               10613
ldap.configuration.php                             30-Sep-2022 11:02                2377
ldap.constants.php                                 30-Sep-2022 11:02               24556
ldap.controls.php                                  30-Sep-2022 11:02                8681
ldap.examples-basic.php                            30-Sep-2022 11:02                9409
ldap.examples-controls.php                         30-Sep-2022 11:02               19000
ldap.examples.php                                  30-Sep-2022 11:02                1363
ldap.installation.php                              30-Sep-2022 11:02                2892
ldap.requirements.php                              30-Sep-2022 11:02                1556
ldap.resources.php                                 30-Sep-2022 11:02                1443
ldap.setup.php                                     30-Sep-2022 11:02                1630
ldap.using.php                                     30-Sep-2022 11:02                2189
libxml.configuration.php                           30-Sep-2022 11:02                1314
libxml.constants.php                               30-Sep-2022 11:02                6345
libxml.installation.php                            30-Sep-2022 11:02                1286
libxml.requirements.php                            30-Sep-2022 11:02                1310
libxml.resources.php                               30-Sep-2022 11:02                1238
libxml.setup.php                                   30-Sep-2022 11:02                1648
limititerator.construct.php                        30-Sep-2022 11:02                7245
limititerator.current.php                          30-Sep-2022 11:02                3652
limititerator.getinneriterator.php                 30-Sep-2022 11:02                3125
limititerator.getposition.php                      30-Sep-2022 11:02                2287
limititerator.key.php                              30-Sep-2022 11:02                3768
limititerator.next.php                             30-Sep-2022 11:02                2291
limititerator.rewind.php                           30-Sep-2022 11:02                2393
limititerator.seek.php                             30-Sep-2022 11:02                2495
limititerator.valid.php                            30-Sep-2022 11:02                2420
locale.acceptfromhttp.php                          30-Sep-2022 11:02                5826
locale.canonicalize.php                            30-Sep-2022 11:02                2854
locale.composelocale.php                           30-Sep-2022 11:02               13757
locale.filtermatches.php                           30-Sep-2022 11:02                8540
locale.getallvariants.php                          30-Sep-2022 11:02                6168
locale.getdefault.php                              30-Sep-2022 11:02                5760
locale.getdisplaylanguage.php                      30-Sep-2022 11:02                9308
locale.getdisplayname.php                          30-Sep-2022 11:02                9292
locale.getdisplayregion.php                        30-Sep-2022 11:02                9256
locale.getdisplayscript.php                        30-Sep-2022 11:02                9263
locale.getdisplayvariant.php                       30-Sep-2022 11:02                9304
locale.getkeywords.php                             30-Sep-2022 11:02                6989
locale.getprimarylanguage.php                      30-Sep-2022 11:02                5634
locale.getregion.php                               30-Sep-2022 11:02                5524
locale.getscript.php                               30-Sep-2022 11:02                5315
locale.lookup.php                                  30-Sep-2022 11:02                9235
locale.parselocale.php                             30-Sep-2022 11:02                7230
locale.setdefault.php                              30-Sep-2022 11:02                5066
lua.assign.php                                     30-Sep-2022 11:02                4593
lua.call.php                                       30-Sep-2022 11:02                7455
lua.configuration.php                              30-Sep-2022 11:02                1293
lua.construct.php                                  30-Sep-2022 11:02                2316
lua.eval.php                                       30-Sep-2022 11:02                3675
lua.getversion.php                                 30-Sep-2022 11:02                2205
lua.include.php                                    30-Sep-2022 11:02                2601
lua.installation.php                               30-Sep-2022 11:02                2037
lua.registercallback.php                           30-Sep-2022 11:02                4520
lua.requirements.php                               30-Sep-2022 11:02                1363
lua.resources.php                                  30-Sep-2022 11:02                1211
lua.setup.php                                      30-Sep-2022 11:02                1593
luaclosure.invoke.php                              30-Sep-2022 11:02                4657
luasandbox.callfunction.php                        30-Sep-2022 11:02                4879
luasandbox.configuration.php                       30-Sep-2022 11:02                1339
luasandbox.disableprofiler.php                     30-Sep-2022 11:02                2844
luasandbox.enableprofiler.php                      30-Sep-2022 11:02                3392
luasandbox.examples-basic.php                      30-Sep-2022 11:02                7408
luasandbox.examples.php                            30-Sep-2022 11:02                1423
luasandbox.getcpuusage.php                         30-Sep-2022 11:02                3575
luasandbox.getmemoryusage.php                      30-Sep-2022 11:02                3155
luasandbox.getpeakmemoryusage.php                  30-Sep-2022 11:02                3205
luasandbox.getprofilerfunctionreport.php           30-Sep-2022 11:02                5645
luasandbox.getversioninfo.php                      30-Sep-2022 11:02                2901
luasandbox.installation.php                        30-Sep-2022 11:02                2145
luasandbox.loadbinary.php                          30-Sep-2022 11:02                3507
luasandbox.loadstring.php                          30-Sep-2022 11:02                5617
luasandbox.pauseusagetimer.php                     30-Sep-2022 11:02               10277
luasandbox.registerlibrary.php                     30-Sep-2022 11:02                6881
luasandbox.requirements.php                        30-Sep-2022 11:02                1805
luasandbox.resources.php                           30-Sep-2022 11:02                1273
luasandbox.setcpulimit.php                         30-Sep-2022 11:02                5981
luasandbox.setmemorylimit.php                      30-Sep-2022 11:02                5636
luasandbox.setup.php                               30-Sep-2022 11:02                1681
luasandbox.unpauseusagetimer.php                   30-Sep-2022 11:02                3140
luasandbox.wrapphpfunction.php                     30-Sep-2022 11:02                4325
luasandboxfunction.call.php                        30-Sep-2022 11:02                6850
luasandboxfunction.construct.php                   30-Sep-2022 11:02                2658
luasandboxfunction.dump.php                        30-Sep-2022 11:02                2360
lzf.configuration.php                              30-Sep-2022 11:02                1293
lzf.constants.php                                  30-Sep-2022 11:02                1136
lzf.installation.php                               30-Sep-2022 11:02                2504
lzf.requirements.php                               30-Sep-2022 11:02                1233
lzf.resources.php                                  30-Sep-2022 11:02                1217
lzf.setup.php                                      30-Sep-2022 11:02                1614
mail.configuration.php                             30-Sep-2022 11:02                7596
mail.constants.php                                 30-Sep-2022 11:02                1145
mail.installation.php                              30-Sep-2022 11:02                1272
mail.requirements.php                              30-Sep-2022 11:02                1923
mail.resources.php                                 30-Sep-2022 11:02                1224
mail.setup.php                                     30-Sep-2022 11:02                1627
mailparse.configuration.php                        30-Sep-2022 11:02                2503
mailparse.constants.php                            30-Sep-2022 11:02                1985
mailparse.installation.php                         30-Sep-2022 11:02                2510
mailparse.requirements.php                         30-Sep-2022 11:02                1272
mailparse.resources.php                            30-Sep-2022 11:02                1586
mailparse.setup.php                                30-Sep-2022 11:02                1689
manual.php                                         30-Sep-2022 11:01                1250
math.configuration.php                             30-Sep-2022 11:02                1300
math.constants.php                                 30-Sep-2022 11:02                3542
math.installation.php                              30-Sep-2022 11:02                1272
math.requirements.php                              30-Sep-2022 11:02                1240
math.resources.php                                 30-Sep-2022 11:02                1224
math.setup.php                                     30-Sep-2022 11:02                1622
mbstring.configuration.php                         30-Sep-2022 11:02               14291
mbstring.constants.php                             30-Sep-2022 11:02                5383
mbstring.encodings.php                             30-Sep-2022 11:02               15435
mbstring.http.php                                  30-Sep-2022 11:02                5240
mbstring.installation.php                          30-Sep-2022 11:02                3368
mbstring.ja-basic.php                              30-Sep-2022 11:02                3961
mbstring.overload.php                              30-Sep-2022 11:02                7199
mbstring.php4.req.php                              30-Sep-2022 11:02                3973
mbstring.requirements.php                          30-Sep-2022 11:02                1265
mbstring.resources.php                             30-Sep-2022 11:02                1249
mbstring.setup.php                                 30-Sep-2022 11:02                1689
mbstring.supported-encodings.php                   30-Sep-2022 11:02                8150
mcrypt.ciphers.php                                 30-Sep-2022 11:02                6216
mcrypt.configuration.php                           30-Sep-2022 11:02                3489
mcrypt.constants.php                               30-Sep-2022 11:02                5856
mcrypt.installation.php                            30-Sep-2022 11:02                1805
mcrypt.requirements.php                            30-Sep-2022 11:02                2166
mcrypt.resources.php                               30-Sep-2022 11:02                1346
mcrypt.setup.php                                   30-Sep-2022 11:02                1656
memcache.add.php                                   30-Sep-2022 11:02                6942
memcache.addserver.php                             30-Sep-2022 11:02               13168
memcache.close.php                                 30-Sep-2022 11:02                5122
memcache.connect.php                               30-Sep-2022 11:02                7190
memcache.constants.php                             30-Sep-2022 11:02                4234
memcache.decrement.php                             30-Sep-2022 11:02                7190
memcache.delete.php                                30-Sep-2022 11:02                6386
memcache.examples-overview.php                     30-Sep-2022 11:02                6719
memcache.examples.php                              30-Sep-2022 11:02                1363
memcache.flush.php                                 30-Sep-2022 11:02                4478
memcache.get.php                                   30-Sep-2022 11:02                8633
memcache.getextendedstats.php                      30-Sep-2022 11:02                8020
memcache.getserverstatus.php                       30-Sep-2022 11:02                6119
memcache.getstats.php                              30-Sep-2022 11:02                4528
memcache.getversion.php                            30-Sep-2022 11:02                4995
memcache.increment.php                             30-Sep-2022 11:02                6988
memcache.ini.php                                   30-Sep-2022 11:02                9680
memcache.installation.php                          30-Sep-2022 11:02                2155
memcache.pconnect.php                              30-Sep-2022 11:02                6172
memcache.replace.php                               30-Sep-2022 11:02                7045
memcache.requirements.php                          30-Sep-2022 11:02                1395
memcache.resources.php                             30-Sep-2022 11:02                1324
memcache.set.php                                   30-Sep-2022 11:02                9654
memcache.setcompressthreshold.php                  30-Sep-2022 11:02                5821
memcache.setserverparams.php                       30-Sep-2022 11:02               10889
memcache.setup.php                                 30-Sep-2022 11:02                1671
memcached.add.php                                  30-Sep-2022 11:02                4387
memcached.addbykey.php                             30-Sep-2022 11:02                5269
memcached.addserver.php                            30-Sep-2022 11:02                7245
memcached.addservers.php                           30-Sep-2022 11:02                5322
memcached.append.php                               30-Sep-2022 11:02                6765
memcached.appendbykey.php                          30-Sep-2022 11:02                4435
memcached.callbacks.php                            30-Sep-2022 11:02                1466
memcached.callbacks.read-through.php               30-Sep-2022 11:02                4563
memcached.callbacks.result.php                     30-Sep-2022 11:02                4995
memcached.cas.php                                  30-Sep-2022 11:02                9654
memcached.casbykey.php                             30-Sep-2022 11:02                5302
memcached.configuration.php                        30-Sep-2022 11:02               23187
memcached.constants.php                            30-Sep-2022 11:02               22284
memcached.construct.php                            30-Sep-2022 11:02                4415
memcached.decrement.php                            30-Sep-2022 11:02                8898
memcached.decrementbykey.php                       30-Sep-2022 11:02                5575
memcached.delete.php                               30-Sep-2022 11:02                5791
memcached.deletebykey.php                          30-Sep-2022 11:02                4690
memcached.deletemulti.php                          30-Sep-2022 11:02                4835
memcached.deletemultibykey.php                     30-Sep-2022 11:02                4753
memcached.expiration.php                           30-Sep-2022 11:02                1889
memcached.fetch.php                                30-Sep-2022 11:02                6540
memcached.fetchall.php                             30-Sep-2022 11:02                6453
memcached.flush.php                                30-Sep-2022 11:02                4540
memcached.get.php                                  30-Sep-2022 11:02               10111
memcached.getallkeys.php                           30-Sep-2022 11:02                2689
memcached.getbykey.php                             30-Sep-2022 11:02                5984
memcached.getdelayed.php                           30-Sep-2022 11:02                8315
memcached.getdelayedbykey.php                      30-Sep-2022 11:02                5160
memcached.getmulti.php                             30-Sep-2022 11:02               21085
memcached.getmultibykey.php                        30-Sep-2022 11:02                5283
memcached.getoption.php                            30-Sep-2022 11:02                5115
memcached.getresultcode.php                        30-Sep-2022 11:02                4261
memcached.getresultmessage.php                     30-Sep-2022 11:02                4651
memcached.getserverbykey.php                       30-Sep-2022 11:02                7168
memcached.getserverlist.php                        30-Sep-2022 11:02                4582
memcached.getstats.php                             30-Sep-2022 11:02                5049
memcached.getversion.php                           30-Sep-2022 11:02                3796
memcached.increment.php                            30-Sep-2022 11:02                8218
memcached.incrementbykey.php                       30-Sep-2022 11:02                5508
memcached.installation.php                         30-Sep-2022 11:02                2640
memcached.ispersistent.php                         30-Sep-2022 11:02                2776
memcached.ispristine.php                           30-Sep-2022 11:02                2707
memcached.prepend.php                              30-Sep-2022 11:02                6793
memcached.prependbykey.php                         30-Sep-2022 11:02                4461
memcached.quit.php                                 30-Sep-2022 11:02                2267
memcached.replace.php                              30-Sep-2022 11:02                4459
memcached.replacebykey.php                         30-Sep-2022 11:02                5356
memcached.requirements.php                         30-Sep-2022 11:02                1569
memcached.resetserverlist.php                      30-Sep-2022 11:02                3010
memcached.resources.php                            30-Sep-2022 11:02                1256
memcached.sessions.php                             30-Sep-2022 11:02                2268
memcached.set.php                                  30-Sep-2022 11:02                8997
memcached.setbykey.php                             30-Sep-2022 11:02                6817
memcached.setmulti.php                             30-Sep-2022 11:02                6142
memcached.setmultibykey.php                        30-Sep-2022 11:02                4636
memcached.setoption.php                            30-Sep-2022 11:02                7259
memcached.setoptions.php                           30-Sep-2022 11:02                6828
memcached.setsaslauthdata.php                      30-Sep-2022 11:02                3170
memcached.setup.php                                30-Sep-2022 11:02                1689
memcached.touch.php                                30-Sep-2022 11:02                3454
memcached.touchbykey.php                           30-Sep-2022 11:02                4291
messageformatter.create.php                        30-Sep-2022 11:02               10791
messageformatter.format.php                        30-Sep-2022 11:02                9733
messageformatter.formatmessage.php                 30-Sep-2022 11:02                9885
messageformatter.geterrorcode.php                  30-Sep-2022 11:02                3887
messageformatter.geterrormessage.php               30-Sep-2022 11:02                7778
messageformatter.getlocale.php                     30-Sep-2022 11:02                5400
messageformatter.getpattern.php                    30-Sep-2022 11:02               10334
messageformatter.parse.php                         30-Sep-2022 11:02                9740
messageformatter.parsemessage.php                  30-Sep-2022 11:02               10329
messageformatter.setpattern.php                    30-Sep-2022 11:02               10761
mhash.configuration.php                            30-Sep-2022 11:02                1307
mhash.constants.php                                30-Sep-2022 11:02                3505
mhash.examples.php                                 30-Sep-2022 11:02                3429
mhash.installation.php                             30-Sep-2022 11:02                1649
mhash.requirements.php                             30-Sep-2022 11:02                1408
mhash.resources.php                                30-Sep-2022 11:02                1231
mhash.setup.php                                    30-Sep-2022 11:02                1640
migration56.changed-functions.php                  30-Sep-2022 11:02                6587
migration56.constants.php                          30-Sep-2022 11:02                5215
migration56.deprecated.php                         30-Sep-2022 11:02                6099
migration56.extensions.php                         30-Sep-2022 11:02                4321
migration56.incompatible.php                       30-Sep-2022 11:02                8635
migration56.new-features.php                       30-Sep-2022 11:02               30946
migration56.new-functions.php                      30-Sep-2022 11:02                7499
migration56.openssl.php                            30-Sep-2022 11:02               26329
migration56.php                                    30-Sep-2022 11:02                2471
migration70.changed-functions.php                  30-Sep-2022 11:02                5451
migration70.classes.php                            30-Sep-2022 11:02                3866
migration70.constants.php                          30-Sep-2022 11:02                7107
migration70.deprecated.php                         30-Sep-2022 11:02                5942
migration70.incompatible.php                       30-Sep-2022 11:02               63447
migration70.new-features.php                       30-Sep-2022 11:02               44701
migration70.new-functions.php                      30-Sep-2022 11:02                7389
migration70.other-changes.php                      30-Sep-2022 11:02                3565
migration70.php                                    30-Sep-2022 11:02                3016
migration70.removed-exts-sapis.php                 30-Sep-2022 11:02                3182
migration70.sapi-changes.php                       30-Sep-2022 11:02                2058
migration71.changed-functions.php                  30-Sep-2022 11:02                7198
migration71.constants.php                          30-Sep-2022 11:02                7192
migration71.deprecated.php                         30-Sep-2022 11:02                2250
migration71.incompatible.php                       30-Sep-2022 11:02               31674
migration71.new-features.php                       30-Sep-2022 11:02               28555
migration71.new-functions.php                      30-Sep-2022 11:02                5034
migration71.other-changes.php                      30-Sep-2022 11:02                8156
migration71.php                                    30-Sep-2022 11:02                2474
migration71.windows-support.php                    30-Sep-2022 11:02                7130
migration72.constants.php                          30-Sep-2022 11:02               24673
migration72.deprecated.php                         30-Sep-2022 11:02               10280
migration72.incompatible.php                       30-Sep-2022 11:02               19620
migration72.new-features.php                       30-Sep-2022 11:02               18547
migration72.new-functions.php                      30-Sep-2022 11:02               24382
migration72.other-changes.php                      30-Sep-2022 11:02                5675
migration72.php                                    30-Sep-2022 11:02                2382
migration73.constants.php                          30-Sep-2022 11:02               17681
migration73.deprecated.php                         30-Sep-2022 11:02                8456
migration73.incompatible.php                       30-Sep-2022 11:02               18429
migration73.new-features.php                       30-Sep-2022 11:02               16101
migration73.new-functions.php                      30-Sep-2022 11:02                7355
migration73.other-changes.php                      30-Sep-2022 11:02               15371
migration73.php                                    30-Sep-2022 11:02                2490
migration73.windows-support.php                    30-Sep-2022 11:02                1806
migration74.constants.php                          30-Sep-2022 11:02                5935
migration74.deprecated.php                         30-Sep-2022 11:02               15828
migration74.incompatible.php                       30-Sep-2022 11:02               17560
migration74.new-classes.php                        30-Sep-2022 11:02                1504
migration74.new-features.php                       30-Sep-2022 11:02               22974
migration74.new-functions.php                      30-Sep-2022 11:02                3726
migration74.other-changes.php                      30-Sep-2022 11:02               21118
migration74.php                                    30-Sep-2022 11:02                2786
migration74.removed-extensions.php                 30-Sep-2022 11:02                1930
migration74.windows-support.php                    30-Sep-2022 11:02                3759
migration80.deprecated.php                         30-Sep-2022 11:02               19507
migration80.incompatible.php                       30-Sep-2022 11:02               95940
migration80.new-features.php                       30-Sep-2022 11:02               32922
migration80.other-changes.php                      30-Sep-2022 11:02               14788
migration80.php                                    30-Sep-2022 11:02                2418
migration81.constants.php                          30-Sep-2022 11:02                5926
migration81.deprecated.php                         30-Sep-2022 11:02               18154
migration81.incompatible.php                       30-Sep-2022 11:02               23205
migration81.new-classes.php                        30-Sep-2022 11:02                2102
migration81.new-features.php                       30-Sep-2022 11:02               23970
migration81.new-functions.php                      30-Sep-2022 11:02                8499
migration81.other-changes.php                      30-Sep-2022 11:02                9787
migration81.php                                    30-Sep-2022 11:02                2687
migration82.constants.php                          30-Sep-2022 11:02               16111
migration82.deprecated.php                         30-Sep-2022 11:02                6003
migration82.incompatible.php                       30-Sep-2022 11:02                8086
migration82.new-features.php                       30-Sep-2022 11:02                6783
migration82.new-functions.php                      30-Sep-2022 11:02                3404
migration82.other-changes.php                      30-Sep-2022 11:02               24957
migration82.php                                    30-Sep-2022 11:02                2649
migration82.windows-support.php                    30-Sep-2022 11:02                2295
misc.configuration.php                             30-Sep-2022 11:02                4952
misc.constants.php                                 30-Sep-2022 11:02                2029
misc.installation.php                              30-Sep-2022 11:02                1272
misc.requirements.php                              30-Sep-2022 11:02                1240
misc.resources.php                                 30-Sep-2022 11:02                1224
misc.setup.php                                     30-Sep-2022 11:02                1612
mongodb-bson-binary.construct.php                  30-Sep-2022 11:02                7071
mongodb-bson-binary.getdata.php                    30-Sep-2022 11:02                4653
mongodb-bson-binary.gettype.php                    30-Sep-2022 11:02                4637
mongodb-bson-binary.jsonserialize.php              30-Sep-2022 11:02                5517
mongodb-bson-binary.serialize.php                  30-Sep-2022 11:02                3469
mongodb-bson-binary.tostring.php                   30-Sep-2022 11:02                4431
mongodb-bson-binary.unserialize.php                30-Sep-2022 11:02                4317
mongodb-bson-binaryinterface.getdata.php           30-Sep-2022 11:02                2776
mongodb-bson-binaryinterface.gettype.php           30-Sep-2022 11:02                2788
mongodb-bson-binaryinterface.tostring.php          30-Sep-2022 11:02                3259
mongodb-bson-dbpointer.construct.php               30-Sep-2022 11:02                2661
mongodb-bson-dbpointer.jsonserialize.php           30-Sep-2022 11:02                5586
mongodb-bson-dbpointer.serialize.php               30-Sep-2022 11:02                3544
mongodb-bson-dbpointer.tostring.php                30-Sep-2022 11:02                2618
mongodb-bson-dbpointer.unserialize.php             30-Sep-2022 11:02                3786
mongodb-bson-decimal128.construct.php              30-Sep-2022 11:02                6131
mongodb-bson-decimal128.jsonserialize.php          30-Sep-2022 11:02                5607
mongodb-bson-decimal128.serialize.php              30-Sep-2022 11:02                3569
mongodb-bson-decimal128.tostring.php               30-Sep-2022 11:02                4935
mongodb-bson-decimal128.unserialize.php            30-Sep-2022 11:02                4409
mongodb-bson-decimal128interface.tostring.php      30-Sep-2022 11:02                2939
mongodb-bson-int64.construct.php                   30-Sep-2022 11:02                2609
mongodb-bson-int64.jsonserialize.php               30-Sep-2022 11:02                5261
mongodb-bson-int64.serialize.php                   30-Sep-2022 11:02                3446
mongodb-bson-int64.tostring.php                    30-Sep-2022 11:02                3839
mongodb-bson-int64.unserialize.php                 30-Sep-2022 11:02                4288
mongodb-bson-javascript.construct.php              30-Sep-2022 11:02                7171
mongodb-bson-javascript.getcode.php                30-Sep-2022 11:02                4501
mongodb-bson-javascript.getscope.php               30-Sep-2022 11:02                5569
mongodb-bson-javascript.jsonserialize.php          30-Sep-2022 11:02                5603
mongodb-bson-javascript.serialize.php              30-Sep-2022 11:02                3569
mongodb-bson-javascript.tostring.php               30-Sep-2022 11:02                4301
mongodb-bson-javascript.unserialize.php            30-Sep-2022 11:02                4401
mongodb-bson-javascriptinterface.getcode.php       30-Sep-2022 11:02                2870
mongodb-bson-javascriptinterface.getscope.php      30-Sep-2022 11:02                2979
mongodb-bson-javascriptinterface.tostring.php      30-Sep-2022 11:02                3357
mongodb-bson-maxkey.construct.php                  30-Sep-2022 11:02                3781
mongodb-bson-maxkey.jsonserialize.php              30-Sep-2022 11:02                5523
mongodb-bson-maxkey.serialize.php                  30-Sep-2022 11:02                3473
mongodb-bson-maxkey.unserialize.php                30-Sep-2022 11:02                3719
mongodb-bson-minkey.construct.php                  30-Sep-2022 11:02                3781
mongodb-bson-minkey.jsonserialize.php              30-Sep-2022 11:02                5523
mongodb-bson-minkey.serialize.php                  30-Sep-2022 11:02                3473
mongodb-bson-minkey.unserialize.php                30-Sep-2022 11:02                3723
mongodb-bson-objectid.construct.php                30-Sep-2022 11:02                5391
mongodb-bson-objectid.gettimestamp.php             30-Sep-2022 11:02                5734
mongodb-bson-objectid.jsonserialize.php            30-Sep-2022 11:02                5569
mongodb-bson-objectid.serialize.php                30-Sep-2022 11:02                3521
mongodb-bson-objectid.tostring.php                 30-Sep-2022 11:02                4427
mongodb-bson-objectid.unserialize.php              30-Sep-2022 11:02                4355
mongodb-bson-objectidinterface.gettimestamp.php    30-Sep-2022 11:02                2941
mongodb-bson-objectidinterface.tostring.php        30-Sep-2022 11:02                2923
mongodb-bson-regex.construct.php                   30-Sep-2022 11:02                6961
mongodb-bson-regex.getflags.php                    30-Sep-2022 11:02                4613
mongodb-bson-regex.getpattern.php                  30-Sep-2022 11:02                4460
mongodb-bson-regex.jsonserialize.php               30-Sep-2022 11:02                5502
mongodb-bson-regex.serialize.php                   30-Sep-2022 11:02                3444
mongodb-bson-regex.tostring.php                    30-Sep-2022 11:02                3974
mongodb-bson-regex.unserialize.php                 30-Sep-2022 11:02                4292
mongodb-bson-regexinterface.getflags.php           30-Sep-2022 11:02                2775
mongodb-bson-regexinterface.getpattern.php         30-Sep-2022 11:02                2818
mongodb-bson-regexinterface.tostring.php           30-Sep-2022 11:02                2849
mongodb-bson-serializable.bsonserialize.php        30-Sep-2022 11:02               16194
mongodb-bson-symbol.construct.php                  30-Sep-2022 11:02                2601
mongodb-bson-symbol.jsonserialize.php              30-Sep-2022 11:02                5523
mongodb-bson-symbol.serialize.php                  30-Sep-2022 11:02                3469
mongodb-bson-symbol.tostring.php                   30-Sep-2022 11:02                2596
mongodb-bson-symbol.unserialize.php                30-Sep-2022 11:02                3725
mongodb-bson-timestamp.construct.php               30-Sep-2022 11:02                4751
mongodb-bson-timestamp.getincrement.php            30-Sep-2022 11:02                4260
mongodb-bson-timestamp.gettimestamp.php            30-Sep-2022 11:02                4245
mongodb-bson-timestamp.jsonserialize.php           30-Sep-2022 11:02                5590
mongodb-bson-timestamp.serialize.php               30-Sep-2022 11:02                3544
mongodb-bson-timestamp.tostring.php                30-Sep-2022 11:02                4115
mongodb-bson-timestamp.unserialize.php             30-Sep-2022 11:02                4388
mongodb-bson-timestampinterface.getincrement.php   30-Sep-2022 11:02                3303
mongodb-bson-timestampinterface.gettimestamp.php   30-Sep-2022 11:02                3318
mongodb-bson-timestampinterface.tostring.php       30-Sep-2022 11:02                2941
mongodb-bson-undefined.construct.php               30-Sep-2022 11:02                2661
mongodb-bson-undefined.jsonserialize.php           30-Sep-2022 11:02                5586
mongodb-bson-undefined.serialize.php               30-Sep-2022 11:02                3544
mongodb-bson-undefined.tostring.php                30-Sep-2022 11:02                2618
mongodb-bson-undefined.unserialize.php             30-Sep-2022 11:02                3787
mongodb-bson-unserializable.bsonunserialize.php    30-Sep-2022 11:02                7548
mongodb-bson-utcdatetime.construct.php             30-Sep-2022 11:02                8116
mongodb-bson-utcdatetime.jsonserialize.php         30-Sep-2022 11:02                5628
mongodb-bson-utcdatetime.serialize.php             30-Sep-2022 11:02                3596
mongodb-bson-utcdatetime.todatetime.php            30-Sep-2022 11:02                5994
mongodb-bson-utcdatetime.tostring.php              30-Sep-2022 11:02                4067
mongodb-bson-utcdatetime.unserialize.php           30-Sep-2022 11:02                4420
mongodb-bson-utcdatetimeinterface.todatetime.php   30-Sep-2022 11:02                3278
mongodb-bson-utcdatetimeinterface.tostring.php     30-Sep-2022 11:02                2957
mongodb-driver-bulkwrite.construct.php             30-Sep-2022 11:02               20275
mongodb-driver-bulkwrite.count.php                 30-Sep-2022 11:02                7102
mongodb-driver-bulkwrite.delete.php                30-Sep-2022 11:02               10395
mongodb-driver-bulkwrite.insert.php                30-Sep-2022 11:02               10066
mongodb-driver-bulkwrite.update.php                30-Sep-2022 11:02               13652
mongodb-driver-clientencryption.construct.php      30-Sep-2022 11:02                8516
mongodb-driver-clientencryption.createdatakey.php  30-Sep-2022 11:02               10226
mongodb-driver-clientencryption.decrypt.php        30-Sep-2022 11:02                4271
mongodb-driver-clientencryption.encrypt.php        30-Sep-2022 11:02                9867
mongodb-driver-command.construct.php               30-Sep-2022 11:02               15395
mongodb-driver-commandexception.getresultdocume..> 30-Sep-2022 11:02                3191
mongodb-driver-cursor.construct.php                30-Sep-2022 11:02                3380
mongodb-driver-cursor.current.php                  30-Sep-2022 11:02                2872
mongodb-driver-cursor.getid.php                    30-Sep-2022 11:02                8348
mongodb-driver-cursor.getserver.php                30-Sep-2022 11:02                7996
mongodb-driver-cursor.isdead.php                   30-Sep-2022 11:02               11118
mongodb-driver-cursor.key.php                      30-Sep-2022 11:02                2594
mongodb-driver-cursor.next.php                     30-Sep-2022 11:02                3533
mongodb-driver-cursor.rewind.php                   30-Sep-2022 11:02                3953
mongodb-driver-cursor.settypemap.php               30-Sep-2022 11:02                8420
mongodb-driver-cursor.toarray.php                  30-Sep-2022 11:02                8093
mongodb-driver-cursor.valid.php                    30-Sep-2022 11:02                2678
mongodb-driver-cursorid.construct.php              30-Sep-2022 11:02                2823
mongodb-driver-cursorid.serialize.php              30-Sep-2022 11:02                3567
mongodb-driver-cursorid.tostring.php               30-Sep-2022 11:02                7522
mongodb-driver-cursorid.unserialize.php            30-Sep-2022 11:02                4427
mongodb-driver-cursorinterface.getid.php           30-Sep-2022 11:02                4061
mongodb-driver-cursorinterface.getserver.php       30-Sep-2022 11:02                4147
mongodb-driver-cursorinterface.isdead.php          30-Sep-2022 11:02                3993
mongodb-driver-cursorinterface.settypemap.php      30-Sep-2022 11:02                4012
mongodb-driver-cursorinterface.toarray.php         30-Sep-2022 11:02                3893
mongodb-driver-manager.addsubscriber.php           30-Sep-2022 11:02                5126
mongodb-driver-manager.construct.php               30-Sep-2022 11:02               73133
mongodb-driver-manager.createclientencryption.php  30-Sep-2022 11:02               10252
mongodb-driver-manager.executebulkwrite.php        30-Sep-2022 11:02               24168
mongodb-driver-manager.executecommand.php          30-Sep-2022 11:02               26515
mongodb-driver-manager.executequery.php            30-Sep-2022 11:02               17327
mongodb-driver-manager.executereadcommand.php      30-Sep-2022 11:02               10255
mongodb-driver-manager.executereadwritecommand.php 30-Sep-2022 11:02               11239
mongodb-driver-manager.executewritecommand.php     30-Sep-2022 11:02               11314
mongodb-driver-manager.getencryptedfieldsmap.php   30-Sep-2022 11:02                3704
mongodb-driver-manager.getreadconcern.php          30-Sep-2022 11:02                6226
mongodb-driver-manager.getreadpreference.php       30-Sep-2022 11:02                6821
mongodb-driver-manager.getservers.php              30-Sep-2022 11:02                8135
mongodb-driver-manager.getwriteconcern.php         30-Sep-2022 11:02                6279
mongodb-driver-manager.removesubscriber.php        30-Sep-2022 11:02                4986
mongodb-driver-manager.selectserver.php            30-Sep-2022 11:02                7067
mongodb-driver-manager.startsession.php            30-Sep-2022 11:02               11883
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                3673
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                3768
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                3657
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                4825
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                3967
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                4239
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                4225
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                3871
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:02                3713
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:02                3974
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:02                3705
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:02                3607
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:02                5149
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:02                4715
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:02                4531
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:02                3891
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:02                3733
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:02                4953
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:02                5003
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:02                5018
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:02                3730
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:02                3837
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:02                4912
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:02                4024
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:02                4302
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:02                4760
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:02                3931
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:02                3759
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:02                4821
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:02                4791
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:02                5358
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:02                5403
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:02                5434
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:02                4821
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:02                4896
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:02                4833
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:02                4816
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:02                3125
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:02                3501
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:02                3195
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:02                3578
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:02                3301
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:02                3087
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:02                3139
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:02                3257
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:02                3575
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:02                3485
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:02                3262
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:02                3293
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:02                3544
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:02                3267
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:02                3311
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:02                3564
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:02                3627
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:02                3334
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:02                3345
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:02                4161
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:02                3580
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:02                3105
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:02                3157
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:02                3289
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:02                3570
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:02                3648
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:02                3309
mongodb-driver-monitoring-topologyclosedevent.g..> 30-Sep-2022 11:02                3254
mongodb-driver-monitoring-topologyopeningevent...> 30-Sep-2022 11:02                3264
mongodb-driver-query.construct.php                 30-Sep-2022 11:02               30320
mongodb-driver-readconcern.bsonserialize.php       30-Sep-2022 11:02                7758
mongodb-driver-readconcern.construct.php           30-Sep-2022 11:02                6528
mongodb-driver-readconcern.getlevel.php            30-Sep-2022 11:02                6431
mongodb-driver-readconcern.isdefault.php           30-Sep-2022 11:02                8709
mongodb-driver-readconcern.serialize.php           30-Sep-2022 11:02                3644
mongodb-driver-readconcern.unserialize.php         30-Sep-2022 11:02                4478
mongodb-driver-readpreference.bsonserialize.php    30-Sep-2022 11:02               12398
mongodb-driver-readpreference.construct.php        30-Sep-2022 11:02               18271
mongodb-driver-readpreference.gethedge.php         30-Sep-2022 11:02                3325
mongodb-driver-readpreference.getmaxstalenessse..> 30-Sep-2022 11:02                9605
mongodb-driver-readpreference.getmode.php          30-Sep-2022 11:02                8950
mongodb-driver-readpreference.getmodestring.php    30-Sep-2022 11:02                9154
mongodb-driver-readpreference.gettagsets.php       30-Sep-2022 11:02                9151
mongodb-driver-readpreference.serialize.php        30-Sep-2022 11:02                3721
mongodb-driver-readpreference.unserialize.php      30-Sep-2022 11:02                4557
mongodb-driver-runtimeexception.haserrorlabel.php  30-Sep-2022 11:02                4172
mongodb-driver-server.construct.php                30-Sep-2022 11:02                3382
mongodb-driver-server.executebulkwrite.php         30-Sep-2022 11:02               11151
mongodb-driver-server.executecommand.php           30-Sep-2022 11:02               13154
mongodb-driver-server.executequery.php             30-Sep-2022 11:02                8432
mongodb-driver-server.executereadcommand.php       30-Sep-2022 11:02               10577
mongodb-driver-server.executereadwritecommand.php  30-Sep-2022 11:02               11750
mongodb-driver-server.executewritecommand.php      30-Sep-2022 11:02               11791
mongodb-driver-server.gethost.php                  30-Sep-2022 11:02                5872
mongodb-driver-server.getinfo.php                  30-Sep-2022 11:02               10893
mongodb-driver-server.getlatency.php               30-Sep-2022 11:02                7390
mongodb-driver-server.getport.php                  30-Sep-2022 11:02                5916
mongodb-driver-server.getserverdescription.php     30-Sep-2022 11:02                3425
mongodb-driver-server.gettags.php                  30-Sep-2022 11:02                3568
mongodb-driver-server.gettype.php                  30-Sep-2022 11:02                3679
mongodb-driver-server.isarbiter.php                30-Sep-2022 11:02                3493
mongodb-driver-server.ishidden.php                 30-Sep-2022 11:02                3487
mongodb-driver-server.ispassive.php                30-Sep-2022 11:02                3555
mongodb-driver-server.isprimary.php                30-Sep-2022 11:02                3500
mongodb-driver-server.issecondary.php              30-Sep-2022 11:02                3535
mongodb-driver-serverapi.bsonserialize.php         30-Sep-2022 11:02                3267
mongodb-driver-serverapi.construct.php             30-Sep-2022 11:02                3116
mongodb-driver-serverapi.serialize.php             30-Sep-2022 11:02                3597
mongodb-driver-serverapi.unserialize.php           30-Sep-2022 11:02                4445
mongodb-driver-serverdescription.gethellorespon..> 30-Sep-2022 11:02                5185
mongodb-driver-serverdescription.gethost.php       30-Sep-2022 11:02                3404
mongodb-driver-serverdescription.getlastupdatet..> 30-Sep-2022 11:02                3542
mongodb-driver-serverdescription.getport.php       30-Sep-2022 11:02                3461
mongodb-driver-serverdescription.getroundtripti..> 30-Sep-2022 11:02                3804
mongodb-driver-serverdescription.gettype.php       30-Sep-2022 11:02                3674
mongodb-driver-session.aborttransaction.php        30-Sep-2022 11:02                4240
mongodb-driver-session.advanceclustertime.php      30-Sep-2022 11:02                4772
mongodb-driver-session.advanceoperationtime.php    30-Sep-2022 11:02                4830
mongodb-driver-session.committransaction.php       30-Sep-2022 11:02                5648
mongodb-driver-session.construct.php               30-Sep-2022 11:02                2890
mongodb-driver-session.endsession.php              30-Sep-2022 11:02                4372
mongodb-driver-session.getclustertime.php          30-Sep-2022 11:02                3774
mongodb-driver-session.getlogicalsessionid.php     30-Sep-2022 11:02                3075
mongodb-driver-session.getoperationtime.php        30-Sep-2022 11:02                3914
mongodb-driver-session.getserver.php               30-Sep-2022 11:02                3792
mongodb-driver-session.gettransactionoptions.php   30-Sep-2022 11:02                3624
mongodb-driver-session.gettransactionstate.php     30-Sep-2022 11:02                3706
mongodb-driver-session.isdirty.php                 30-Sep-2022 11:02                2961
mongodb-driver-session.isintransaction.php         30-Sep-2022 11:02                3651
mongodb-driver-session.starttransaction.php        30-Sep-2022 11:02                8995
mongodb-driver-topologydescription.getservers.php  30-Sep-2022 11:02                3404
mongodb-driver-topologydescription.gettype.php     30-Sep-2022 11:02                3330
mongodb-driver-topologydescription.hasreadables..> 30-Sep-2022 11:02                3809
mongodb-driver-topologydescription.haswritables..> 30-Sep-2022 11:02                3171
mongodb-driver-writeconcern.bsonserialize.php      30-Sep-2022 11:02                8213
mongodb-driver-writeconcern.construct.php          30-Sep-2022 11:02               10659
mongodb-driver-writeconcern.getjournal.php         30-Sep-2022 11:02                6350
mongodb-driver-writeconcern.getw.php               30-Sep-2022 11:02                5546
mongodb-driver-writeconcern.getwtimeout.php        30-Sep-2022 11:02                6288
mongodb-driver-writeconcern.isdefault.php          30-Sep-2022 11:02                8208
mongodb-driver-writeconcern.serialize.php          30-Sep-2022 11:02                3669
mongodb-driver-writeconcern.unserialize.php        30-Sep-2022 11:02                4517
mongodb-driver-writeconcernerror.getcode.php       30-Sep-2022 11:02                7023
mongodb-driver-writeconcernerror.getinfo.php       30-Sep-2022 11:02                7240
mongodb-driver-writeconcernerror.getmessage.php    30-Sep-2022 11:02                7112
mongodb-driver-writeerror.getcode.php              30-Sep-2022 11:02                6192
mongodb-driver-writeerror.getindex.php             30-Sep-2022 11:02                6735
mongodb-driver-writeerror.getinfo.php              30-Sep-2022 11:02                2965
mongodb-driver-writeerror.getmessage.php           30-Sep-2022 11:02                6326
mongodb-driver-writeexception.getwriteresult.php   30-Sep-2022 11:02                8734
mongodb-driver-writeresult.getdeletedcount.php     30-Sep-2022 11:02                8460
mongodb-driver-writeresult.getinsertedcount.php    30-Sep-2022 11:02                8542
mongodb-driver-writeresult.getmatchedcount.php     30-Sep-2022 11:02                9120
mongodb-driver-writeresult.getmodifiedcount.php    30-Sep-2022 11:02                9367
mongodb-driver-writeresult.getserver.php           30-Sep-2022 11:02                7168
mongodb-driver-writeresult.getupsertedcount.php    30-Sep-2022 11:02                8697
mongodb-driver-writeresult.getupsertedids.php      30-Sep-2022 11:02                9236
mongodb-driver-writeresult.getwriteconcernerror..> 30-Sep-2022 11:02                7867
mongodb-driver-writeresult.getwriteerrors.php      30-Sep-2022 11:02               14480
mongodb-driver-writeresult.isacknowledged.php      30-Sep-2022 11:02                8825
mongodb.architecture.php                           30-Sep-2022 11:02                1925
mongodb.configuration.php                          30-Sep-2022 11:02                3942
mongodb.connection-handling.php                    30-Sep-2022 11:02                9471
mongodb.constants.php                              30-Sep-2022 11:02                1934
mongodb.exceptions.php                             30-Sep-2022 11:02                5152
mongodb.exceptions.tree.php                        30-Sep-2022 11:02                5562
mongodb.installation.homebrew.php                  30-Sep-2022 11:02                1990
mongodb.installation.manual.php                    30-Sep-2022 11:02                6561
mongodb.installation.pecl.php                      30-Sep-2022 11:02                3627
mongodb.installation.php                           30-Sep-2022 11:02                1808
mongodb.installation.windows.php                   30-Sep-2022 11:02                2973
mongodb.monitoring.php                             30-Sep-2022 11:02               18594
mongodb.overview.php                               30-Sep-2022 11:02                7237
mongodb.persistence.deserialization.php            30-Sep-2022 11:02               20741
mongodb.persistence.php                            30-Sep-2022 11:02                1801
mongodb.persistence.serialization.php              30-Sep-2022 11:02               23897
mongodb.requirements.php                           30-Sep-2022 11:02                3185
mongodb.security.php                               30-Sep-2022 11:02                1487
mongodb.security.request_injection.php             30-Sep-2022 11:02                3007
mongodb.security.script_injection.php              30-Sep-2022 11:02               10547
mongodb.setup.php                                  30-Sep-2022 11:02                2112
mongodb.tutorial.apm.php                           30-Sep-2022 11:02               24278
mongodb.tutorial.library.php                       30-Sep-2022 11:02               11299
mongodb.tutorial.php                               30-Sep-2022 11:02                1708
mqseries.configure.php                             30-Sep-2022 11:02                2854
mqseries.constants.php                             30-Sep-2022 11:02                2145
mqseries.ini.php                                   30-Sep-2022 11:02                1377
mqseries.requirements.php                          30-Sep-2022 11:02                1660
mqseries.resources.php                             30-Sep-2022 11:02                1706
mqseries.setup.php                                 30-Sep-2022 11:02                1674
multipleiterator.attachiterator.php                30-Sep-2022 11:02                4163
multipleiterator.construct.php                     30-Sep-2022 11:02                8154
multipleiterator.containsiterator.php              30-Sep-2022 11:02                3325
multipleiterator.countiterators.php                30-Sep-2022 11:02                3001
multipleiterator.current.php                       30-Sep-2022 11:02                4258
multipleiterator.detachiterator.php                30-Sep-2022 11:02                3202
multipleiterator.getflags.php                      30-Sep-2022 11:02                3169
multipleiterator.key.php                           30-Sep-2022 11:02                4124
multipleiterator.next.php                          30-Sep-2022 11:02                2824
multipleiterator.rewind.php                        30-Sep-2022 11:02                2842
multipleiterator.setflags.php                      30-Sep-2022 11:02                3475
multipleiterator.valid.php                         30-Sep-2022 11:02                2913
mysql-xdevapi-baseresult.getwarnings.php           30-Sep-2022 11:02                7046
mysql-xdevapi-baseresult.getwarningscount.php      30-Sep-2022 11:02                6778
mysql-xdevapi-client.close.php                     30-Sep-2022 11:02                2323
mysql-xdevapi-client.construct.php                 30-Sep-2022 11:02                3607
mysql-xdevapi-client.getsession.php                30-Sep-2022 11:02                2389
mysql-xdevapi-collection.add.php                   30-Sep-2022 11:02                9922
mysql-xdevapi-collection.addorreplaceone.php       30-Sep-2022 11:02                8566
mysql-xdevapi-collection.construct.php             30-Sep-2022 11:02                6788
mysql-xdevapi-collection.count.php                 30-Sep-2022 11:02                6896
mysql-xdevapi-collection.createindex.php           30-Sep-2022 11:02               10053
mysql-xdevapi-collection.dropindex.php             30-Sep-2022 11:02                6920
mysql-xdevapi-collection.existsindatabase.php      30-Sep-2022 11:02                6170
mysql-xdevapi-collection.find.php                  30-Sep-2022 11:02               10193
mysql-xdevapi-collection.getname.php               30-Sep-2022 11:02                5227
mysql-xdevapi-collection.getone.php                30-Sep-2022 11:02                7462
mysql-xdevapi-collection.getschema.php             30-Sep-2022 11:02                5434
mysql-xdevapi-collection.getsession.php            30-Sep-2022 11:02                5709
mysql-xdevapi-collection.modify.php                30-Sep-2022 11:02                8535
mysql-xdevapi-collection.remove.php                30-Sep-2022 11:02                8865
mysql-xdevapi-collection.removeone.php             30-Sep-2022 11:02                8108
mysql-xdevapi-collection.replaceone.php            30-Sep-2022 11:02                8381
mysql-xdevapi-collectionadd.construct.php          30-Sep-2022 11:02                8391
mysql-xdevapi-collectionadd.execute.php            30-Sep-2022 11:02                8375
mysql-xdevapi-collectionfind.bind.php              30-Sep-2022 11:02                8266
mysql-xdevapi-collectionfind.construct.php         30-Sep-2022 11:02                7245
mysql-xdevapi-collectionfind.execute.php           30-Sep-2022 11:02                7444
mysql-xdevapi-collectionfind.fields.php            30-Sep-2022 11:02                7868
mysql-xdevapi-collectionfind.groupby.php           30-Sep-2022 11:02                4344
mysql-xdevapi-collectionfind.having.php            30-Sep-2022 11:02                4588
mysql-xdevapi-collectionfind.limit.php             30-Sep-2022 11:02                8533
mysql-xdevapi-collectionfind.lockexclusive.php     30-Sep-2022 11:02                6708
mysql-xdevapi-collectionfind.lockshared.php        30-Sep-2022 11:02                6511
mysql-xdevapi-collectionfind.offset.php            30-Sep-2022 11:02                8280
mysql-xdevapi-collectionfind.sort.php              30-Sep-2022 11:02                8390
mysql-xdevapi-collectionmodify.arrayappend.php     30-Sep-2022 11:02                8349
mysql-xdevapi-collectionmodify.arrayinsert.php     30-Sep-2022 11:02                8768
mysql-xdevapi-collectionmodify.bind.php            30-Sep-2022 11:02                8493
mysql-xdevapi-collectionmodify.construct.php       30-Sep-2022 11:02                7134
mysql-xdevapi-collectionmodify.execute.php         30-Sep-2022 11:02                3279
mysql-xdevapi-collectionmodify.limit.php           30-Sep-2022 11:02                8944
mysql-xdevapi-collectionmodify.patch.php           30-Sep-2022 11:02                4183
mysql-xdevapi-collectionmodify.replace.php         30-Sep-2022 11:02                8166
mysql-xdevapi-collectionmodify.set.php             30-Sep-2022 11:02                8108
mysql-xdevapi-collectionmodify.skip.php            30-Sep-2022 11:02                4852
mysql-xdevapi-collectionmodify.sort.php            30-Sep-2022 11:02                4895
mysql-xdevapi-collectionmodify.unset.php           30-Sep-2022 11:02                4483
mysql-xdevapi-collectionremove.bind.php            30-Sep-2022 11:02                5144
mysql-xdevapi-collectionremove.construct.php       30-Sep-2022 11:02                7650
mysql-xdevapi-collectionremove.execute.php         30-Sep-2022 11:02                4047
mysql-xdevapi-collectionremove.limit.php           30-Sep-2022 11:02                4484
mysql-xdevapi-collectionremove.sort.php            30-Sep-2022 11:02                4562
mysql-xdevapi-columnresult.construct.php           30-Sep-2022 11:02               10006
mysql-xdevapi-columnresult.getcharactersetname.php 30-Sep-2022 11:02                3247
mysql-xdevapi-columnresult.getcollationname.php    30-Sep-2022 11:02                3226
mysql-xdevapi-columnresult.getcolumnlabel.php      30-Sep-2022 11:02                3192
mysql-xdevapi-columnresult.getcolumnname.php       30-Sep-2022 11:02                3187
mysql-xdevapi-columnresult.getfractionaldigits.php 30-Sep-2022 11:02                3298
mysql-xdevapi-columnresult.getlength.php           30-Sep-2022 11:02                3142
mysql-xdevapi-columnresult.getschemaname.php       30-Sep-2022 11:02                3216
mysql-xdevapi-columnresult.gettablelabel.php       30-Sep-2022 11:02                3171
mysql-xdevapi-columnresult.gettablename.php        30-Sep-2022 11:02                3181
mysql-xdevapi-columnresult.gettype.php             30-Sep-2022 11:02                3098
mysql-xdevapi-columnresult.isnumbersigned.php      30-Sep-2022 11:02                3344
mysql-xdevapi-columnresult.ispadded.php            30-Sep-2022 11:02                3185
mysql-xdevapi-crudoperationbindable.bind.php       30-Sep-2022 11:02                5794
mysql-xdevapi-crudoperationlimitable.limit.php     30-Sep-2022 11:02                5885
mysql-xdevapi-crudoperationskippable.skip.php      30-Sep-2022 11:02                4556
mysql-xdevapi-crudoperationsortable.sort.php       30-Sep-2022 11:02                4592
mysql-xdevapi-databaseobject.existsindatabase.php  30-Sep-2022 11:02                3496
mysql-xdevapi-databaseobject.getname.php           30-Sep-2022 11:02                3418
mysql-xdevapi-databaseobject.getsession.php        30-Sep-2022 11:02                3521
mysql-xdevapi-docresult.construct.php              30-Sep-2022 11:02                7799
mysql-xdevapi-docresult.fetchall.php               30-Sep-2022 11:02                8250
mysql-xdevapi-docresult.fetchone.php               30-Sep-2022 11:02                7892
mysql-xdevapi-docresult.getwarnings.php            30-Sep-2022 11:02                8913
mysql-xdevapi-docresult.getwarningscount.php       30-Sep-2022 11:02                8725
mysql-xdevapi-executable.execute.php               30-Sep-2022 11:02                6752
mysql-xdevapi-executionstatus.construct.php        30-Sep-2022 11:02                2969
mysql-xdevapi-expression.construct.php             30-Sep-2022 11:02                3063
mysql-xdevapi-result.construct.php                 30-Sep-2022 11:02                7343
mysql-xdevapi-result.getaffecteditemscount.php     30-Sep-2022 11:02                6142
mysql-xdevapi-result.getautoincrementvalue.php     30-Sep-2022 11:02                7681
mysql-xdevapi-result.getgeneratedids.php           30-Sep-2022 11:02                6965
mysql-xdevapi-result.getwarnings.php               30-Sep-2022 11:02                6928
mysql-xdevapi-result.getwarningscount.php          30-Sep-2022 11:02                6624
mysql-xdevapi-rowresult.construct.php              30-Sep-2022 11:02                5002
mysql-xdevapi-rowresult.fetchall.php               30-Sep-2022 11:02                6698
mysql-xdevapi-rowresult.fetchone.php               30-Sep-2022 11:02                6868
mysql-xdevapi-rowresult.getcolumncount.php         30-Sep-2022 11:02                6175
mysql-xdevapi-rowresult.getcolumnnames.php         30-Sep-2022 11:02                6195
mysql-xdevapi-rowresult.getcolumns.php             30-Sep-2022 11:02                7156
mysql-xdevapi-rowresult.getwarnings.php            30-Sep-2022 11:02                6975
mysql-xdevapi-rowresult.getwarningscount.php       30-Sep-2022 11:02                6670
mysql-xdevapi-schema.construct.php                 30-Sep-2022 11:02                5527
mysql-xdevapi-schema.createcollection.php          30-Sep-2022 11:02               10313
mysql-xdevapi-schema.dropcollection.php            30-Sep-2022 11:02                6648
mysql-xdevapi-schema.existsindatabase.php          30-Sep-2022 11:02                6507
mysql-xdevapi-schema.getcollection.php             30-Sep-2022 11:02                5679
mysql-xdevapi-schema.getcollectionastable.php      30-Sep-2022 11:02                7311
mysql-xdevapi-schema.getcollections.php            30-Sep-2022 11:02                6412
mysql-xdevapi-schema.getname.php                   30-Sep-2022 11:02                4814
mysql-xdevapi-schema.getsession.php                30-Sep-2022 11:02                5312
mysql-xdevapi-schema.gettable.php                  30-Sep-2022 11:02                6878
mysql-xdevapi-schema.gettables.php                 30-Sep-2022 11:02                7097
mysql-xdevapi-schemaobject.getschema.php           30-Sep-2022 11:02                4081
mysql-xdevapi-session.close.php                    30-Sep-2022 11:02                3970
mysql-xdevapi-session.commit.php                   30-Sep-2022 11:02                4771
mysql-xdevapi-session.construct.php                30-Sep-2022 11:02                3132
mysql-xdevapi-session.createschema.php             30-Sep-2022 11:02                4981
mysql-xdevapi-session.dropschema.php               30-Sep-2022 11:02                4083
mysql-xdevapi-session.generateuuid.php             30-Sep-2022 11:02                3989
mysql-xdevapi-session.getdefaultschema.php         30-Sep-2022 11:02                4149
mysql-xdevapi-session.getschema.php                30-Sep-2022 11:02                4257
mysql-xdevapi-session.getschemas.php               30-Sep-2022 11:02                4082
mysql-xdevapi-session.getserverversion.php         30-Sep-2022 11:02                3925
mysql-xdevapi-session.listclients.php              30-Sep-2022 11:02                4249
mysql-xdevapi-session.quotename.php                30-Sep-2022 11:02                5358
mysql-xdevapi-session.releasesavepoint.php         30-Sep-2022 11:02                5698
mysql-xdevapi-session.rollback.php                 30-Sep-2022 11:02                5397
mysql-xdevapi-session.rollbackto.php               30-Sep-2022 11:02                5777
mysql-xdevapi-session.setsavepoint.php             30-Sep-2022 11:02                5997
mysql-xdevapi-session.sql.php                      30-Sep-2022 11:02                3941
mysql-xdevapi-session.starttransaction.php         30-Sep-2022 11:02                5473
mysql-xdevapi-sqlstatement.bind.php                30-Sep-2022 11:02                3350
mysql-xdevapi-sqlstatement.construct.php           30-Sep-2022 11:02                2907
mysql-xdevapi-sqlstatement.execute.php             30-Sep-2022 11:02                3196
mysql-xdevapi-sqlstatement.getnextresult.php       30-Sep-2022 11:02                3248
mysql-xdevapi-sqlstatement.getresult.php           30-Sep-2022 11:02                3217
mysql-xdevapi-sqlstatement.hasmoreresults.php      30-Sep-2022 11:02                3267
mysql-xdevapi-sqlstatementresult.construct.php     30-Sep-2022 11:02                3027
mysql-xdevapi-sqlstatementresult.fetchall.php      30-Sep-2022 11:02                7112
mysql-xdevapi-sqlstatementresult.fetchone.php      30-Sep-2022 11:02                6941
mysql-xdevapi-sqlstatementresult.getaffectedite..> 30-Sep-2022 11:02                3382
mysql-xdevapi-sqlstatementresult.getcolumncount..> 30-Sep-2022 11:02                3909
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 30-Sep-2022 11:02                3298
mysql-xdevapi-sqlstatementresult.getcolumns.php    30-Sep-2022 11:02                3254
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 30-Sep-2022 11:02                3412
mysql-xdevapi-sqlstatementresult.getlastinserti..> 30-Sep-2022 11:02                3355
mysql-xdevapi-sqlstatementresult.getwarningcoun..> 30-Sep-2022 11:02                3385
mysql-xdevapi-sqlstatementresult.getwarnings.php   30-Sep-2022 11:02                3506
mysql-xdevapi-sqlstatementresult.hasdata.php       30-Sep-2022 11:02                3287
mysql-xdevapi-sqlstatementresult.nextresult.php    30-Sep-2022 11:02                3353
mysql-xdevapi-statement.construct.php              30-Sep-2022 11:02                2875
mysql-xdevapi-statement.getnextresult.php          30-Sep-2022 11:02                3197
mysql-xdevapi-statement.getresult.php              30-Sep-2022 11:02                3160
mysql-xdevapi-statement.hasmoreresults.php         30-Sep-2022 11:02                3110
mysql-xdevapi-table.construct.php                  30-Sep-2022 11:02                3598
mysql-xdevapi-table.count.php                      30-Sep-2022 11:02                5806
mysql-xdevapi-table.delete.php                     30-Sep-2022 11:02                6572
mysql-xdevapi-table.existsindatabase.php           30-Sep-2022 11:02                6270
mysql-xdevapi-table.getname.php                    30-Sep-2022 11:02                5890
mysql-xdevapi-table.getschema.php                  30-Sep-2022 11:02                6053
mysql-xdevapi-table.getsession.php                 30-Sep-2022 11:02                6002
mysql-xdevapi-table.insert.php                     30-Sep-2022 11:02                7153
mysql-xdevapi-table.isview.php                     30-Sep-2022 11:02                6180
mysql-xdevapi-table.select.php                     30-Sep-2022 11:02                7412
mysql-xdevapi-table.update.php                     30-Sep-2022 11:02                6379
mysql-xdevapi-tabledelete.bind.php                 30-Sep-2022 11:02                6972
mysql-xdevapi-tabledelete.construct.php            30-Sep-2022 11:02                6430
mysql-xdevapi-tabledelete.execute.php              30-Sep-2022 11:02                6706
mysql-xdevapi-tabledelete.limit.php                30-Sep-2022 11:02                6955
mysql-xdevapi-tabledelete.orderby.php              30-Sep-2022 11:02                5354
mysql-xdevapi-tabledelete.where.php                30-Sep-2022 11:02                5180
mysql-xdevapi-tableinsert.construct.php            30-Sep-2022 11:02                6205
mysql-xdevapi-tableinsert.execute.php              30-Sep-2022 11:02                6469
mysql-xdevapi-tableinsert.values.php               30-Sep-2022 11:02                6712
mysql-xdevapi-tableselect.bind.php                 30-Sep-2022 11:02                6202
mysql-xdevapi-tableselect.construct.php            30-Sep-2022 11:02                7484
mysql-xdevapi-tableselect.execute.php              30-Sep-2022 11:02                6025
mysql-xdevapi-tableselect.groupby.php              30-Sep-2022 11:02                8056
mysql-xdevapi-tableselect.having.php               30-Sep-2022 11:02                8123
mysql-xdevapi-tableselect.limit.php                30-Sep-2022 11:02                5676
mysql-xdevapi-tableselect.lockexclusive.php        30-Sep-2022 11:02                6772
mysql-xdevapi-tableselect.lockshared.php           30-Sep-2022 11:02                6738
mysql-xdevapi-tableselect.offset.php               30-Sep-2022 11:02                7403
mysql-xdevapi-tableselect.orderby.php              30-Sep-2022 11:02                6323
mysql-xdevapi-tableselect.where.php                30-Sep-2022 11:02                6196
mysql-xdevapi-tableupdate.bind.php                 30-Sep-2022 11:02                5535
mysql-xdevapi-tableupdate.construct.php            30-Sep-2022 11:02                5043
mysql-xdevapi-tableupdate.execute.php              30-Sep-2022 11:02                5342
mysql-xdevapi-tableupdate.limit.php                30-Sep-2022 11:02                5568
mysql-xdevapi-tableupdate.orderby.php              30-Sep-2022 11:02                6095
mysql-xdevapi-tableupdate.set.php                  30-Sep-2022 11:02                5827
mysql-xdevapi-tableupdate.where.php                30-Sep-2022 11:02                5546
mysql-xdevapi-warning.construct.php                30-Sep-2022 11:02                2793
mysql-xdevapi.build.php                            30-Sep-2022 11:02                4193
mysql-xdevapi.configuration.php                    30-Sep-2022 11:02                4610
mysql-xdevapi.constants.php                        30-Sep-2022 11:02                9538
mysql-xdevapi.examples.php                         30-Sep-2022 11:02               10323
mysql-xdevapi.installation.php                     30-Sep-2022 11:02                3164
mysql-xdevapi.requi