Index of /php.ihc-ru.net/manual/ja/


../
feeds/                                             30-Sep-2022 11:08                   -
images/                                            30-Sep-2022 11:08                   -
styles/                                            30-Sep-2022 11:07                   -
toc/                                               30-Sep-2022 11:08                   -
about.formats.php                                  30-Sep-2022 11:08                5198
about.generate.php                                 30-Sep-2022 11:08                3080
about.howtohelp.php                                30-Sep-2022 11:08                3946
about.more.php                                     30-Sep-2022 11:08                2192
about.notes.php                                    30-Sep-2022 11:08                2658
about.php                                          30-Sep-2022 11:08                1939
about.phpversions.php                              30-Sep-2022 11:08                4153
about.prototypes.php                               30-Sep-2022 11:08                7819
about.translations.php                             30-Sep-2022 11:08                3572
aliases.php                                        30-Sep-2022 11:08               29646
apache.configuration.php                           30-Sep-2022 11:08                5338
apache.constants.php                               30-Sep-2022 11:08                1109
apache.installation.php                            30-Sep-2022 11:08                1285
apache.requirements.php                            30-Sep-2022 11:08                1157
apache.resources.php                               30-Sep-2022 11:08                1158
apache.setup.php                                   30-Sep-2022 11:08                1545
apcu.configuration.php                             30-Sep-2022 11:07               16670
apcu.constants.php                                 30-Sep-2022 11:07                5282
apcu.installation.php                              30-Sep-2022 11:07                3608
apcu.requirements.php                              30-Sep-2022 11:07                1143
apcu.resources.php                                 30-Sep-2022 11:07                1144
apcu.setup.php                                     30-Sep-2022 11:07                1503
apcuiterator.construct.php                         30-Sep-2022 11:07                6499
apcuiterator.current.php                           30-Sep-2022 11:07                3072
apcuiterator.gettotalcount.php                     30-Sep-2022 11:07                3262
apcuiterator.gettotalhits.php                      30-Sep-2022 11:07                3380
apcuiterator.gettotalsize.php                      30-Sep-2022 11:07                3305
apcuiterator.key.php                               30-Sep-2022 11:07                2754
apcuiterator.next.php                              30-Sep-2022 11:07                2984
apcuiterator.rewind.php                            30-Sep-2022 11:07                2710
apcuiterator.valid.php                             30-Sep-2022 11:07                2849
appendices.php                                     30-Sep-2022 11:08               12334
appenditerator.append.php                          30-Sep-2022 11:07                5529
appenditerator.construct.php                       30-Sep-2022 11:07               10704
appenditerator.current.php                         30-Sep-2022 11:07                3564
appenditerator.getarrayiterator.php                30-Sep-2022 11:07                3218
appenditerator.getinneriterator.php                30-Sep-2022 11:07                6908
appenditerator.getiteratorindex.php                30-Sep-2022 11:07                6927
appenditerator.key.php                             30-Sep-2022 11:07                7511
appenditerator.next.php                            30-Sep-2022 11:07                3428
appenditerator.rewind.php                          30-Sep-2022 11:07                3420
appenditerator.valid.php                           30-Sep-2022 11:07                3296
array.configuration.php                            30-Sep-2022 11:08                1176
array.constants.php                                30-Sep-2022 11:08                8766
array.installation.php                             30-Sep-2022 11:08                1210
array.requirements.php                             30-Sep-2022 11:08                1150
array.resources.php                                30-Sep-2022 11:08                1151
array.setup.php                                    30-Sep-2022 11:08                1510
array.sorting.php                                  30-Sep-2022 11:08                7102
arrayaccess.offsetexists.php                       30-Sep-2022 11:07                9770
arrayaccess.offsetget.php                          30-Sep-2022 11:07                5141
arrayaccess.offsetset.php                          30-Sep-2022 11:07                5345
arrayaccess.offsetunset.php                        30-Sep-2022 11:07                2909
arrayiterator.append.php                           30-Sep-2022 11:07                3531
arrayiterator.asort.php                            30-Sep-2022 11:07                6289
arrayiterator.construct.php                        30-Sep-2022 11:07                3627
arrayiterator.count.php                            30-Sep-2022 11:07                2916
arrayiterator.current.php                          30-Sep-2022 11:07                5393
arrayiterator.getarraycopy.php                     30-Sep-2022 11:07                3007
arrayiterator.getflags.php                         30-Sep-2022 11:07                3119
arrayiterator.key.php                              30-Sep-2022 11:07                3817
arrayiterator.ksort.php                            30-Sep-2022 11:07                6246
arrayiterator.natcasesort.php                      30-Sep-2022 11:07                4286
arrayiterator.natsort.php                          30-Sep-2022 11:07                4022
arrayiterator.next.php                             30-Sep-2022 11:07                4743
arrayiterator.offsetexists.php                     30-Sep-2022 11:07                3367
arrayiterator.offsetget.php                        30-Sep-2022 11:07                3533
arrayiterator.offsetset.php                        30-Sep-2022 11:07                3787
arrayiterator.offsetunset.php                      30-Sep-2022 11:07                3954
arrayiterator.rewind.php                           30-Sep-2022 11:07                4637
arrayiterator.seek.php                             30-Sep-2022 11:07                2528
arrayiterator.serialize.php                        30-Sep-2022 11:07                2919
arrayiterator.setflags.php                         30-Sep-2022 11:07                4168
arrayiterator.uasort.php                           30-Sep-2022 11:07                5408
arrayiterator.uksort.php                           30-Sep-2022 11:07                5140
arrayiterator.unserialize.php                      30-Sep-2022 11:07                3106
arrayiterator.valid.php                            30-Sep-2022 11:07                4594
arrayobject.append.php                             30-Sep-2022 11:07                5540
arrayobject.asort.php                              30-Sep-2022 11:07                9012
arrayobject.construct.php                          30-Sep-2022 11:07                6134
arrayobject.count.php                              30-Sep-2022 11:07                5501
arrayobject.exchangearray.php                      30-Sep-2022 11:07                5925
arrayobject.getarraycopy.php                       30-Sep-2022 11:07                5355
arrayobject.getflags.php                           30-Sep-2022 11:07                6266
arrayobject.getiterator.php                        30-Sep-2022 11:07                5605
arrayobject.getiteratorclass.php                   30-Sep-2022 11:07                6774
arrayobject.ksort.php                              30-Sep-2022 11:07                8974
arrayobject.natcasesort.php                        30-Sep-2022 11:07                7946
arrayobject.natsort.php                            30-Sep-2022 11:07                7641
arrayobject.offsetexists.php                       30-Sep-2022 11:07                4895
arrayobject.offsetget.php                          30-Sep-2022 11:07                5150
arrayobject.offsetset.php                          30-Sep-2022 11:07                6918
arrayobject.offsetunset.php                        30-Sep-2022 11:07                4273
arrayobject.serialize.php                          30-Sep-2022 11:07                5179
arrayobject.setflags.php                           30-Sep-2022 11:07                6817
arrayobject.setiteratorclass.php                   30-Sep-2022 11:07                5920
arrayobject.uasort.php                             30-Sep-2022 11:07               10271
arrayobject.uksort.php                             30-Sep-2022 11:07                9653
arrayobject.unserialize.php                        30-Sep-2022 11:07                3591
backedenum.from.php                                30-Sep-2022 11:07                6133
backedenum.tryfrom.php                             30-Sep-2022 11:07                6547
bc.configuration.php                               30-Sep-2022 11:07                2417
bc.constants.php                                   30-Sep-2022 11:07                1083
bc.installation.php                                30-Sep-2022 11:07                1568
bc.requirements.php                                30-Sep-2022 11:07                1129
bc.resources.php                                   30-Sep-2022 11:07                1130
bc.setup.php                                       30-Sep-2022 11:07                1505
book.apache.php                                    30-Sep-2022 11:08                3364
book.apcu.php                                      30-Sep-2022 11:07                4736
book.array.php                                     30-Sep-2022 11:08               12338
book.bc.php                                        30-Sep-2022 11:07                2850
book.bson.php                                      30-Sep-2022 11:07               19843
book.bzip2.php                                     30-Sep-2022 11:07                2946
book.calendar.php                                  30-Sep-2022 11:07                4138
book.classobj.php                                  30-Sep-2022 11:08                4833
book.cmark.php                                     30-Sep-2022 11:08                8675
book.com.php                                       30-Sep-2022 11:08                8313
book.componere.php                                 30-Sep-2022 11:07                6132
book.csprng.php                                    30-Sep-2022 11:07                2092
book.ctype.php                                     30-Sep-2022 11:08                3056
book.cubrid.php                                    30-Sep-2022 11:07               13777
book.curl.php                                      30-Sep-2022 11:08                7417
book.datetime.php                                  30-Sep-2022 11:07               17180
book.dba.php                                       30-Sep-2022 11:07                3645
book.dbase.php                                     30-Sep-2022 11:07                3159
book.dio.php                                       30-Sep-2022 11:07                3091
book.dir.php                                       30-Sep-2022 11:07                3327
book.dom.php                                       30-Sep-2022 11:08               19335
book.ds.php                                        30-Sep-2022 11:08               25056
book.eio.php                                       30-Sep-2022 11:07                8893
book.enchant.php                                   30-Sep-2022 11:07                5582
book.errorfunc.php                                 30-Sep-2022 11:07                3555
book.ev.php                                        30-Sep-2022 11:07               13856
book.event.php                                     30-Sep-2022 11:08               23019
book.exec.php                                      30-Sep-2022 11:07                3350
book.exif.php                                      30-Sep-2022 11:07                2485
book.expect.php                                    30-Sep-2022 11:07                2503
book.fann.php                                      30-Sep-2022 11:07               23052
book.fdf.php                                       30-Sep-2022 11:07                6213
book.ffi.php                                       30-Sep-2022 11:07                5580
book.fileinfo.php                                  30-Sep-2022 11:07                3097
book.filesystem.php                                30-Sep-2022 11:07               11159
book.filter.php                                    30-Sep-2022 11:08                3566
book.fpm.php                                       30-Sep-2022 11:08                2021
book.ftp.php                                       30-Sep-2022 11:08                6553
book.funchand.php                                  30-Sep-2022 11:08                3684
book.gearman.php                                   30-Sep-2022 11:08               14759
book.gender.php                                    30-Sep-2022 11:07                2584
book.geoip.php                                     30-Sep-2022 11:07                4548
book.gettext.php                                   30-Sep-2022 11:07                2961
book.gmagick.php                                   30-Sep-2022 11:07               24393
book.gmp.php                                       30-Sep-2022 11:07                6795
book.gnupg.php                                     30-Sep-2022 11:07                5211
book.hash.php                                      30-Sep-2022 11:07                4525
book.hrtime.php                                    30-Sep-2022 11:07                3431
book.ibase.php                                     30-Sep-2022 11:07               13181
book.ibm-db2.php                                   30-Sep-2022 11:07                9281
book.iconv.php                                     30-Sep-2022 11:07                3333
book.igbinary.php                                  30-Sep-2022 11:07                2136
book.image.php                                     30-Sep-2022 11:07               17172
book.imagick.php                                   30-Sep-2022 11:07               67056
book.imap.php                                      30-Sep-2022 11:07               11582
book.info.php                                      30-Sep-2022 11:07                8593
book.inotify.php                                   30-Sep-2022 11:07                2555
book.intl.php                                      30-Sep-2022 11:07               50000
book.json.php                                      30-Sep-2022 11:07                2803
book.ldap.php                                      30-Sep-2022 11:08                9644
book.libxml.php                                    30-Sep-2022 11:08                3079
book.lua.php                                       30-Sep-2022 11:07                2650
book.luasandbox.php                                30-Sep-2022 11:07                5516
book.lzf.php                                       30-Sep-2022 11:07                2153
book.mail.php                                      30-Sep-2022 11:07                2052
book.mailparse.php                                 30-Sep-2022 11:07                4200
book.math.php                                      30-Sep-2022 11:07                6430
book.mbstring.php                                  30-Sep-2022 11:07               10895
book.mcrypt.php                                    30-Sep-2022 11:07                6837
book.memcache.php                                  30-Sep-2022 11:08                4471
book.memcached.php                                 30-Sep-2022 11:08                8966
book.mhash.php                                     30-Sep-2022 11:07                2461
book.misc.php                                      30-Sep-2022 11:07                5727
book.mongodb.php                                   30-Sep-2022 11:07               25588
book.mqseries.php                                  30-Sep-2022 11:08                3137
book.mysql-xdevapi.php                             30-Sep-2022 11:07               32764
book.mysql.php                                     30-Sep-2022 11:07                8351
book.mysqli.php                                    30-Sep-2022 11:07               19738
book.mysqlnd.php                                   30-Sep-2022 11:07                2455
book.network.php                                   30-Sep-2022 11:08                6462
book.oauth.php                                     30-Sep-2022 11:08                7770
book.oci8.php                                      30-Sep-2022 11:07               18537
book.opcache.php                                   30-Sep-2022 11:07                2798
book.openal.php                                    30-Sep-2022 11:07                4747
book.openssl.php                                   30-Sep-2022 11:07               11807
book.outcontrol.php                                30-Sep-2022 11:07                4479
book.parallel.php                                  30-Sep-2022 11:07                5672
book.parle.php                                     30-Sep-2022 11:08                8765
book.password.php                                  30-Sep-2022 11:07                2645
book.pcntl.php                                     30-Sep-2022 11:07                5393
book.pcre.php                                      30-Sep-2022 11:08                3814
book.pdo.php                                       30-Sep-2022 11:07                8384
book.pgsql.php                                     30-Sep-2022 11:07               13535
book.phar.php                                      30-Sep-2022 11:07               17976
book.phpdbg.php                                    30-Sep-2022 11:07                2990
book.posix.php                                     30-Sep-2022 11:07                6591
book.ps.php                                        30-Sep-2022 11:07               10105
book.pspell.php                                    30-Sep-2022 11:07                4642
book.pthreads.php                                  30-Sep-2022 11:07                5382
book.quickhash.php                                 30-Sep-2022 11:08                8829
book.radius.php                                    30-Sep-2022 11:07                5654
book.rar.php                                       30-Sep-2022 11:07                5786
book.readline.php                                  30-Sep-2022 11:07                3760
book.recode.php                                    30-Sep-2022 11:07                2299
book.reflection.php                                30-Sep-2022 11:08               40837
book.rpminfo.php                                   30-Sep-2022 11:07                2339
book.rrd.php                                       30-Sep-2022 11:08                5042
book.runkit7.php                                   30-Sep-2022 11:07                4160
book.scoutapm.php                                  30-Sep-2022 11:08                2156
book.seaslog.php                                   30-Sep-2022 11:07                5106
book.sem.php                                       30-Sep-2022 11:07                4371
book.session.php                                   30-Sep-2022 11:08                8684
book.shmop.php                                     30-Sep-2022 11:07                2862
book.simplexml.php                                 30-Sep-2022 11:08                5719
book.snmp.php                                      30-Sep-2022 11:08                6398
book.soap.php                                      30-Sep-2022 11:08                6424
book.sockets.php                                   30-Sep-2022 11:08                7645
book.sodium.php                                    30-Sep-2022 11:07               19046
book.solr.php                                      30-Sep-2022 11:08               53938
book.spl.php                                       30-Sep-2022 11:07               10336
book.sqlite3.php                                   30-Sep-2022 11:07                7404
book.sqlsrv.php                                    30-Sep-2022 11:07                5276
book.ssdeep.php                                    30-Sep-2022 11:08                2258
book.ssh2.php                                      30-Sep-2022 11:08                6015
book.stats.php                                     30-Sep-2022 11:07               11729
book.stomp.php                                     30-Sep-2022 11:08                4083
book.stream.php                                    30-Sep-2022 11:07               13480
book.strings.php                                   30-Sep-2022 11:08               14021
book.svm.php                                       30-Sep-2022 11:08                3716
book.svn.php                                       30-Sep-2022 11:08                8375
book.swoole.php                                    30-Sep-2022 11:08               37265
book.sync.php                                      30-Sep-2022 11:07                4697
book.taint.php                                     30-Sep-2022 11:08                2497
book.tcpwrap.php                                   30-Sep-2022 11:08                2013
book.tidy.php                                      30-Sep-2022 11:08                7249
book.tokenizer.php                                 30-Sep-2022 11:08                3143
book.trader.php                                    30-Sep-2022 11:07               17429
book.ui.php                                        30-Sep-2022 11:08               27906
book.uodbc.php                                     30-Sep-2022 11:07                7101
book.uopz.php                                      30-Sep-2022 11:07                5170
book.url.php                                       30-Sep-2022 11:08                3141
book.v8js.php                                      30-Sep-2022 11:08                3082
book.var.php                                       30-Sep-2022 11:08                5831
book.var_representation.php                        30-Sep-2022 11:08                2090
book.varnish.php                                   30-Sep-2022 11:08                5764
book.wddx.php                                      30-Sep-2022 11:08                2823
book.win32service.php                              30-Sep-2022 11:08                5355
book.wincache.php                                  30-Sep-2022 11:07                6173
book.wkhtmltox.php                                 30-Sep-2022 11:07                3253
book.xattr.php                                     30-Sep-2022 11:07                2414
book.xdiff.php                                     30-Sep-2022 11:07                4431
book.xhprof.php                                    30-Sep-2022 11:07                2484
book.xlswriter.php                                 30-Sep-2022 11:07                4366
book.xml.php                                       30-Sep-2022 11:08                5692
book.xmldiff.php                                   30-Sep-2022 11:08                3063
book.xmlreader.php                                 30-Sep-2022 11:08                5204
book.xmlrpc.php                                    30-Sep-2022 11:08                3925
book.xmlwriter.php                                 30-Sep-2022 11:08                7122
book.xsl.php                                       30-Sep-2022 11:08                3885
book.yac.php                                       30-Sep-2022 11:07                2523
book.yaconf.php                                    30-Sep-2022 11:08                2087
book.yaf.php                                       30-Sep-2022 11:08               36984
book.yaml.php                                      30-Sep-2022 11:08                2815
book.yar.php                                       30-Sep-2022 11:08                3620
book.yaz.php                                       30-Sep-2022 11:08                4530
book.zip.php                                       30-Sep-2022 11:07               11292
book.zlib.php                                      30-Sep-2022 11:07                5479
book.zmq.php                                       30-Sep-2022 11:08                5460
book.zookeeper.php                                 30-Sep-2022 11:08                6593
bzip2.configuration.php                            30-Sep-2022 11:07                1176
bzip2.constants.php                                30-Sep-2022 11:07                1096
bzip2.examples.php                                 30-Sep-2022 11:07                4227
bzip2.installation.php                             30-Sep-2022 11:07                1428
bzip2.requirements.php                             30-Sep-2022 11:07                1419
bzip2.resources.php                                30-Sep-2022 11:07                1256
bzip2.setup.php                                    30-Sep-2022 11:07                1531
cachingiterator.construct.php                      30-Sep-2022 11:07                2813
cachingiterator.count.php                          30-Sep-2022 11:07                2462
cachingiterator.current.php                        30-Sep-2022 11:07                2870
cachingiterator.getcache.php                       30-Sep-2022 11:07                5653
cachingiterator.getflags.php                       30-Sep-2022 11:07                2527
cachingiterator.getinneriterator.php               30-Sep-2022 11:07                2667
cachingiterator.hasnext.php                        30-Sep-2022 11:07                2533
cachingiterator.key.php                            30-Sep-2022 11:07                2259
cachingiterator.next.php                           30-Sep-2022 11:07                2438
cachingiterator.offsetexists.php                   30-Sep-2022 11:07                2795
cachingiterator.offsetget.php                      30-Sep-2022 11:07                2688
cachingiterator.offsetset.php                      30-Sep-2022 11:07                3042
cachingiterator.offsetunset.php                    30-Sep-2022 11:07                2681
cachingiterator.rewind.php                         30-Sep-2022 11:07                2451
cachingiterator.setflags.php                       30-Sep-2022 11:07                2740
cachingiterator.tostring.php                       30-Sep-2022 11:07                2486
cachingiterator.valid.php                          30-Sep-2022 11:07                2573
calendar.configuration.php                         30-Sep-2022 11:07                1197
calendar.constants.php                             30-Sep-2022 11:07               10565
calendar.installation.php                          30-Sep-2022 11:07                1596
calendar.requirements.php                          30-Sep-2022 11:07                1171
calendar.resources.php                             30-Sep-2022 11:07                1172
calendar.setup.php                                 30-Sep-2022 11:07                1576
callbackfilteriterator.accept.php                  30-Sep-2022 11:07                3477
callbackfilteriterator.construct.php               30-Sep-2022 11:07                4025
cc.license.php                                     30-Sep-2022 11:08               20995
changelog.misc.php                                 30-Sep-2022 11:07                4028
changelog.mysql.php                                30-Sep-2022 11:07                2581
changelog.mysql_xdevapi.php                        30-Sep-2022 11:07                2335
changelog.mysqli.php                               30-Sep-2022 11:07                4118
changelog.strings.php                              30-Sep-2022 11:08               13504
class.addressinfo.php                              30-Sep-2022 11:08                1792
class.apcuiterator.php                             30-Sep-2022 11:07                6891
class.appenditerator.php                           30-Sep-2022 11:07                8229
class.argumentcounterror.php                       30-Sep-2022 11:07                6687
class.arithmeticerror.php                          30-Sep-2022 11:07                6942
class.arrayaccess.php                              30-Sep-2022 11:07               13203
class.arrayiterator.php                            30-Sep-2022 11:07               15946
class.arrayobject.php                              30-Sep-2022 11:07               15302
class.assertionerror.php                           30-Sep-2022 11:07                6687
class.backedenum.php                               30-Sep-2022 11:07                4316
class.badfunctioncallexception.php                 30-Sep-2022 11:07                6794
class.badmethodcallexception.php                   30-Sep-2022 11:07                6824
class.cachingiterator.php                          30-Sep-2022 11:07               16477
class.callbackfilteriterator.php                   30-Sep-2022 11:07               12440
class.closure.php                                  30-Sep-2022 11:07                6652
class.collator.php                                 30-Sep-2022 11:07               25813
class.collectable.php                              30-Sep-2022 11:07                2420
class.com-exception.php                            30-Sep-2022 11:08                6563
class.com.php                                      30-Sep-2022 11:08               13157
class.commonmark-cql.php                           30-Sep-2022 11:08                7559
class.commonmark-interfaces-ivisitable.php         30-Sep-2022 11:08                2877
class.commonmark-interfaces-ivisitor.php           30-Sep-2022 11:08                4246
class.commonmark-node-blockquote.php               30-Sep-2022 11:08                8249
class.commonmark-node-bulletlist.php               30-Sep-2022 11:08               10127
class.commonmark-node-code.php                     30-Sep-2022 11:08                9123
class.commonmark-node-codeblock.php                30-Sep-2022 11:08               10322
class.commonmark-node-customblock.php              30-Sep-2022 11:08                8882
class.commonmark-node-custominline.php             30-Sep-2022 11:08                8862
class.commonmark-node-document.php                 30-Sep-2022 11:08                8213
class.commonmark-node-heading.php                  30-Sep-2022 11:08                9483
class.commonmark-node-htmlblock.php                30-Sep-2022 11:08                9181
class.commonmark-node-htmlinline.php               30-Sep-2022 11:08                9157
class.commonmark-node-image.php                    30-Sep-2022 11:08               10207
class.commonmark-node-item.php                     30-Sep-2022 11:08                8216
class.commonmark-node-linebreak.php                30-Sep-2022 11:08                8230
class.commonmark-node-link.php                     30-Sep-2022 11:08               10200
class.commonmark-node-orderedlist.php              30-Sep-2022 11:08               10861
class.commonmark-node-paragraph.php                30-Sep-2022 11:08                8255
class.commonmark-node-softbreak.php                30-Sep-2022 11:08                8248
class.commonmark-node-text-emphasis.php            30-Sep-2022 11:08                8277
class.commonmark-node-text-strong.php              30-Sep-2022 11:08                8266
class.commonmark-node-text.php                     30-Sep-2022 11:08                9517
class.commonmark-node-thematicbreak.php            30-Sep-2022 11:08                8277
class.commonmark-node.php                          30-Sep-2022 11:08                9154
class.commonmark-parser.php                        30-Sep-2022 11:08                3616
class.compersisthelper.php                         30-Sep-2022 11:08                6794
class.compileerror.php                             30-Sep-2022 11:07                6620
class.componere-abstract-definition.php            30-Sep-2022 11:07                4602
class.componere-definition.php                     30-Sep-2022 11:07                9383
class.componere-method.php                         30-Sep-2022 11:07                4350
class.componere-patch.php                          30-Sep-2022 11:07                7769
class.componere-value.php                          30-Sep-2022 11:07                5214
class.countable.php                                30-Sep-2022 11:07                2599
class.curlfile.php                                 30-Sep-2022 11:08                7663
class.curlhandle.php                               30-Sep-2022 11:08                1798
class.curlmultihandle.php                          30-Sep-2022 11:08                1837
class.curlsharehandle.php                          30-Sep-2022 11:08                1833
class.curlstringfile.php                           30-Sep-2022 11:08                5457
class.dateinterval.php                             30-Sep-2022 11:07               13620
class.dateperiod.php                               30-Sep-2022 11:07               13185
class.datetime.php                                 30-Sep-2022 11:07               21188
class.datetimeimmutable.php                        30-Sep-2022 11:07               20723
class.datetimeinterface.php                        30-Sep-2022 11:07               16985
class.datetimezone.php                             30-Sep-2022 11:07               13216
class.deflatecontext.php                           30-Sep-2022 11:07                1852
class.directory.php                                30-Sep-2022 11:07                5409
class.directoryiterator.php                        30-Sep-2022 11:07               24097
class.divisionbyzeroerror.php                      30-Sep-2022 11:07                6640
class.domainexception.php                          30-Sep-2022 11:07                6711
class.domattr.php                                  30-Sep-2022 11:08               21581
class.domcdatasection.php                          30-Sep-2022 11:08               22943
class.domcharacterdata.php                         30-Sep-2022 11:08               24262
class.domchildnode.php                             30-Sep-2022 11:08                4035
class.domcomment.php                               30-Sep-2022 11:08               21898
class.domdocument.php                              30-Sep-2022 11:08               55766
class.domdocumentfragment.php                      30-Sep-2022 11:08               21117
class.domdocumenttype.php                          30-Sep-2022 11:08               21079
class.domelement.php                               30-Sep-2022 11:08               36309
class.domentity.php                                30-Sep-2022 11:08               21879
class.domentityreference.php                       30-Sep-2022 11:08               17508
class.domexception.php                             30-Sep-2022 11:08                7497
class.domimplementation.php                        30-Sep-2022 11:08                5435
class.domnamednodemap.php                          30-Sep-2022 11:08                6729
class.domnode.php                                  30-Sep-2022 11:08               25718
class.domnodelist.php                              30-Sep-2022 11:08                5473
class.domnotation.php                              30-Sep-2022 11:08               17718
class.domparentnode.php                            30-Sep-2022 11:08                3091
class.domprocessinginstruction.php                 30-Sep-2022 11:08               18858
class.domtext.php                                  30-Sep-2022 11:08               24720
class.domxpath.php                                 30-Sep-2022 11:08                7765
class.dotnet.php                                   30-Sep-2022 11:08                7502
class.ds-collection.php                            30-Sep-2022 11:08                5107
class.ds-deque.php                                 30-Sep-2022 11:08               21387
class.ds-hashable.php                              30-Sep-2022 11:08                4073
class.ds-map.php                                   30-Sep-2022 11:08               22565
class.ds-pair.php                                  30-Sep-2022 11:08                4460
class.ds-priorityqueue.php                         30-Sep-2022 11:08                7909
class.ds-queue.php                                 30-Sep-2022 11:08                7472
class.ds-sequence.php                              30-Sep-2022 11:08               19164
class.ds-set.php                                   30-Sep-2022 11:08               17997
class.ds-stack.php                                 30-Sep-2022 11:08                6909
class.ds-vector.php                                30-Sep-2022 11:08               20954
class.emptyiterator.php                            30-Sep-2022 11:07                3954
class.enchantbroker.php                            30-Sep-2022 11:07                1864
class.enchantdictionary.php                        30-Sep-2022 11:07                1854
class.error.php                                    30-Sep-2022 11:07                9960
class.errorexception.php                           30-Sep-2022 11:07               13029
class.ev.php                                       30-Sep-2022 11:07               40509
class.evcheck.php                                  30-Sep-2022 11:07               10641
class.evchild.php                                  30-Sep-2022 11:07               11947
class.evembed.php                                  30-Sep-2022 11:07                9376
class.event.php                                    30-Sep-2022 11:08               17139
class.eventbase.php                                30-Sep-2022 11:08               13318
class.eventbuffer.php                              30-Sep-2022 11:08               20215
class.eventbufferevent.php                         30-Sep-2022 11:08               33448
class.eventconfig.php                              30-Sep-2022 11:08                6823
class.eventdnsbase.php                             30-Sep-2022 11:08               10164
class.eventhttp.php                                30-Sep-2022 11:08                8484
class.eventhttpconnection.php                      30-Sep-2022 11:08                9456
class.eventhttprequest.php                         30-Sep-2022 11:08               19847
class.eventlistener.php                            30-Sep-2022 11:08               11604
class.eventsslcontext.php                          30-Sep-2022 11:08               16450
class.eventutil.php                                30-Sep-2022 11:08               22323
class.evfork.php                                   30-Sep-2022 11:07                8411
class.evidle.php                                   30-Sep-2022 11:07                9258
class.evio.php                                     30-Sep-2022 11:07               11940
class.evloop.php                                   30-Sep-2022 11:07               29224
class.evperiodic.php                               30-Sep-2022 11:07               13920
class.evprepare.php                                30-Sep-2022 11:07               10792
class.evsignal.php                                 30-Sep-2022 11:07               10963
class.evstat.php                                   30-Sep-2022 11:07               13352
class.evtimer.php                                  30-Sep-2022 11:07               13331
class.evwatcher.php                                30-Sep-2022 11:07                9197
class.exception.php                                30-Sep-2022 11:07               10064
class.fannconnection.php                           30-Sep-2022 11:07                6091
class.ffi-cdata.php                                30-Sep-2022 11:07                5465
class.ffi-ctype.php                                30-Sep-2022 11:07                7842
class.ffi-exception.php                            30-Sep-2022 11:07                6411
class.ffi-parserexception.php                      30-Sep-2022 11:07                6467
class.ffi.php                                      30-Sep-2022 11:07               17739
class.fiber.php                                    30-Sep-2022 11:07                7953
class.fibererror.php                               30-Sep-2022 11:07                7362
class.filesystemiterator.php                       30-Sep-2022 11:07               30382
class.filteriterator.php                           30-Sep-2022 11:07                7845
class.finfo.php                                    30-Sep-2022 11:07                5129
class.ftp-connection.php                           30-Sep-2022 11:08                1832
class.gdfont.php                                   30-Sep-2022 11:07                1750
class.gdimage.php                                  30-Sep-2022 11:07                1747
class.gearmanclient.php                            30-Sep-2022 11:08               29660
class.gearmanexception.php                         30-Sep-2022 11:08                6643
class.gearmanjob.php                               30-Sep-2022 11:08                9841
class.gearmantask.php                              30-Sep-2022 11:08                8156
class.gearmanworker.php                            30-Sep-2022 11:08               11338
class.gender.php                                   30-Sep-2022 11:07               33061
class.generator.php                                30-Sep-2022 11:07                6880
class.globiterator.php                             30-Sep-2022 11:07               26216
class.gmagick.php                                  30-Sep-2022 11:07               77471
class.gmagickdraw.php                              30-Sep-2022 11:07               21819
class.gmagickpixel.php                             30-Sep-2022 11:07                5270
class.gmp.php                                      30-Sep-2022 11:07                3415
class.hashcontext.php                              30-Sep-2022 11:07                3271
class.hrtime-performancecounter.php                30-Sep-2022 11:07                3521
class.hrtime-stopwatch.php                         30-Sep-2022 11:07                6286
class.hrtime-unit.php                              30-Sep-2022 11:07                3848
class.imagick.php                                  30-Sep-2022 11:07              244260
class.imagickdraw.php                              30-Sep-2022 11:07               67654
class.imagickkernel.php                            30-Sep-2022 11:07                5626
class.imagickpixel.php                             30-Sep-2022 11:07               11355
class.imagickpixeliterator.php                     30-Sep-2022 11:07                8601
class.imap-connection.php                          30-Sep-2022 11:07                1837
class.infiniteiterator.php                         30-Sep-2022 11:07                5303
class.inflatecontext.php                           30-Sep-2022 11:07                1820
class.internaliterator.php                         30-Sep-2022 11:07                4873
class.intlbreakiterator.php                        30-Sep-2022 11:07               26582
class.intlcalendar.php                             30-Sep-2022 11:07               59363
class.intlchar.php                                 30-Sep-2022 11:07              342122
class.intlcodepointbreakiterator.php               30-Sep-2022 11:07               18469
class.intldateformatter.php                        30-Sep-2022 11:07               24162
class.intldatepatterngenerator.php                 30-Sep-2022 11:07                4181
class.intlexception.php                            30-Sep-2022 11:07                6873
class.intlgregoriancalendar.php                    30-Sep-2022 11:07               38922
class.intliterator.php                             30-Sep-2022 11:07                5333
class.intlpartsiterator.php                        30-Sep-2022 11:07                6849
class.intlrulebasedbreakiterator.php               30-Sep-2022 11:07               21074
class.intltimezone.php                             30-Sep-2022 11:07               19572
class.invalidargumentexception.php                 30-Sep-2022 11:07                6749
class.iterator.php                                 30-Sep-2022 11:07               12807
class.iteratoraggregate.php                        30-Sep-2022 11:07                6527
class.iteratoriterator.php                         30-Sep-2022 11:07                6402
class.jsonexception.php                            30-Sep-2022 11:07                7189
class.jsonserializable.php                         30-Sep-2022 11:07                2917
class.ldap-connection.php                          30-Sep-2022 11:08                1851
class.ldap-result-entry.php                        30-Sep-2022 11:08                1870
class.ldap-result.php                              30-Sep-2022 11:08                1844
class.lengthexception.php                          30-Sep-2022 11:07                6659
class.libxmlerror.php                              30-Sep-2022 11:08                5265
class.limititerator.php                            30-Sep-2022 11:07               11861
class.locale.php                                   30-Sep-2022 11:07               22422
class.logicexception.php                           30-Sep-2022 11:07                6745
class.lua.php                                      30-Sep-2022 11:07                7202
class.luaclosure.php                               30-Sep-2022 11:07                2661
class.luasandbox.php                               30-Sep-2022 11:07               12400
class.luasandboxerror.php                          30-Sep-2022 11:07                8674
class.luasandboxerrorerror.php                     30-Sep-2022 11:07                6716
class.luasandboxfatalerror.php                     30-Sep-2022 11:07                6838
class.luasandboxfunction.php                       30-Sep-2022 11:07                3625
class.luasandboxmemoryerror.php                    30-Sep-2022 11:07                7038
class.luasandboxruntimeerror.php                   30-Sep-2022 11:07                6858
class.luasandboxsyntaxerror.php                    30-Sep-2022 11:07                6720
class.luasandboxtimeouterror.php                   30-Sep-2022 11:07                7026
class.memcache.php                                 30-Sep-2022 11:08               15690
class.memcached.php                                30-Sep-2022 11:08               36661
class.memcachedexception.php                       30-Sep-2022 11:08                6599
class.messageformatter.php                         30-Sep-2022 11:07               11381
class.mongodb-bson-binary.php                      30-Sep-2022 11:07               13699
class.mongodb-bson-binaryinterface.php             30-Sep-2022 11:07                4475
class.mongodb-bson-dbpointer.php                   30-Sep-2022 11:07                5816
class.mongodb-bson-decimal128.php                  30-Sep-2022 11:07                7525
class.mongodb-bson-decimal128interface.php         30-Sep-2022 11:07                3720
class.mongodb-bson-int64.php                       30-Sep-2022 11:07                6544
class.mongodb-bson-javascript.php                  30-Sep-2022 11:07                8084
class.mongodb-bson-javascriptinterface.php         30-Sep-2022 11:07                4647
class.mongodb-bson-maxkey.php                      30-Sep-2022 11:07                5704
class.mongodb-bson-maxkeyinterface.php             30-Sep-2022 11:07                2147
class.mongodb-bson-minkey.php                      30-Sep-2022 11:07                5695
class.mongodb-bson-minkeyinterface.php             30-Sep-2022 11:07                2128
class.mongodb-bson-objectid.php                    30-Sep-2022 11:07                8808
class.mongodb-bson-objectidinterface.php           30-Sep-2022 11:07                4152
class.mongodb-bson-persistable.php                 30-Sep-2022 11:07                4539
class.mongodb-bson-regex.php                       30-Sep-2022 11:07                7736
class.mongodb-bson-regexinterface.php              30-Sep-2022 11:07                4492
class.mongodb-bson-serializable.php                30-Sep-2022 11:07                3777
class.mongodb-bson-symbol.php                      30-Sep-2022 11:07                5704
class.mongodb-bson-timestamp.php                   30-Sep-2022 11:07                7991
class.mongodb-bson-timestampinterface.php          30-Sep-2022 11:07                4654
class.mongodb-bson-type.php                        30-Sep-2022 11:07                1988
class.mongodb-bson-undefined.php                   30-Sep-2022 11:07                5792
class.mongodb-bson-unserializable.php              30-Sep-2022 11:07                3842
class.mongodb-bson-utcdatetime.php                 30-Sep-2022 11:07                7543
class.mongodb-bson-utcdatetimeinterface.php        30-Sep-2022 11:07                4283
class.mongodb-driver-bulkwrite.php                 30-Sep-2022 11:07               25900
class.mongodb-driver-clientencryption.php          30-Sep-2022 11:07               11798
class.mongodb-driver-command.php                   30-Sep-2022 11:07               15952
class.mongodb-driver-cursor.php                    30-Sep-2022 11:07               27595
class.mongodb-driver-cursorid.php                  30-Sep-2022 11:07                5294
class.mongodb-driver-cursorinterface.php           30-Sep-2022 11:07                5931
class.mongodb-driver-exception-authenticationex..> 30-Sep-2022 11:07                8093
class.mongodb-driver-exception-bulkwriteexcepti..> 30-Sep-2022 11:07                8947
class.mongodb-driver-exception-commandexception..> 30-Sep-2022 11:07                9736
class.mongodb-driver-exception-connectionexcept..> 30-Sep-2022 11:07                8162
class.mongodb-driver-exception-connectiontimeou..> 30-Sep-2022 11:07                8550
class.mongodb-driver-exception-encryptionexcept..> 30-Sep-2022 11:07                8096
class.mongodb-driver-exception-exception.php       30-Sep-2022 11:07                2142
class.mongodb-driver-exception-executiontimeout..> 30-Sep-2022 11:07                9206
class.mongodb-driver-exception-invalidargumente..> 30-Sep-2022 11:07                7299
class.mongodb-driver-exception-logicexception.php  30-Sep-2022 11:07                7183
class.mongodb-driver-exception-runtimeexception..> 30-Sep-2022 11:07               10610
class.mongodb-driver-exception-serverexception.php 30-Sep-2022 11:07                8173
class.mongodb-driver-exception-sslconnectionexc..> 30-Sep-2022 11:07                8439
class.mongodb-driver-exception-unexpectedvaluee..> 30-Sep-2022 11:07                7316
class.mongodb-driver-exception-writeexception.php  30-Sep-2022 11:07               11128
class.mongodb-driver-manager.php                   30-Sep-2022 11:07               19673
class.mongodb-driver-monitoring-commandfailedev..> 30-Sep-2022 11:07                7532
class.mongodb-driver-monitoring-commandstartede..> 30-Sep-2022 11:07                7034
class.mongodb-driver-monitoring-commandsubscrib..> 30-Sep-2022 11:07                6156
class.mongodb-driver-monitoring-commandsucceede..> 30-Sep-2022 11:07                7114
class.mongodb-driver-monitoring-sdamsubscriber.php 30-Sep-2022 11:07               11390
class.mongodb-driver-monitoring-serverchangedev..> 30-Sep-2022 11:07                5576
class.mongodb-driver-monitoring-serverclosedeve..> 30-Sep-2022 11:07                4223
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:07                5457
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:07                4342
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:07                5469
class.mongodb-driver-monitoring-serveropeningev..> 30-Sep-2022 11:07                4243
class.mongodb-driver-monitoring-subscriber.php     30-Sep-2022 11:07                2603
class.mongodb-driver-monitoring-topologychanged..> 30-Sep-2022 11:07                4689
class.mongodb-driver-monitoring-topologyclosede..> 30-Sep-2022 11:07                3300
class.mongodb-driver-monitoring-topologyopening..> 30-Sep-2022 11:07                3314
class.mongodb-driver-query.php                     30-Sep-2022 11:07                3116
class.mongodb-driver-readconcern.php               30-Sep-2022 11:07               16000
class.mongodb-driver-readpreference.php            30-Sep-2022 11:07               18156
class.mongodb-driver-server.php                    30-Sep-2022 11:07               23563
class.mongodb-driver-serverapi.php                 30-Sep-2022 11:07               15129
class.mongodb-driver-serverdescription.php         30-Sep-2022 11:07               14688
class.mongodb-driver-session.php                   30-Sep-2022 11:07               13707
class.mongodb-driver-topologydescription.php       30-Sep-2022 11:07               10192
class.mongodb-driver-writeconcern.php              30-Sep-2022 11:07                9091
class.mongodb-driver-writeconcernerror.php         30-Sep-2022 11:07                4098
class.mongodb-driver-writeerror.php                30-Sep-2022 11:07                4364
class.mongodb-driver-writeresult.php               30-Sep-2022 11:07                7833
class.multipleiterator.php                         30-Sep-2022 11:07               10670
class.mysql-xdevapi-baseresult.php                 30-Sep-2022 11:07                2909
class.mysql-xdevapi-client.php                     30-Sep-2022 11:07                3138
class.mysql-xdevapi-collection.php                 30-Sep-2022 11:07               10355
class.mysql-xdevapi-collectionadd.php              30-Sep-2022 11:07                2932
class.mysql-xdevapi-collectionfind.php             30-Sep-2022 11:07                8448
class.mysql-xdevapi-collectionmodify.php           30-Sep-2022 11:07                9644
class.mysql-xdevapi-collectionremove.php           30-Sep-2022 11:07                5069
class.mysql-xdevapi-columnresult.php               30-Sep-2022 11:07                6270
class.mysql-xdevapi-crudoperationbindable.php      30-Sep-2022 11:07                2918
class.mysql-xdevapi-crudoperationlimitable.php     30-Sep-2022 11:07                2903
class.mysql-xdevapi-crudoperationskippable.php     30-Sep-2022 11:07                2911
class.mysql-xdevapi-crudoperationsortable.php      30-Sep-2022 11:07                2895
class.mysql-xdevapi-databaseobject.php             30-Sep-2022 11:07                3491
class.mysql-xdevapi-docresult.php                  30-Sep-2022 11:07                3854
class.mysql-xdevapi-exception.php                  30-Sep-2022 11:07                2162
class.mysql-xdevapi-executable.php                 30-Sep-2022 11:07                2611
class.mysql-xdevapi-executionstatus.php            30-Sep-2022 11:07                4854
class.mysql-xdevapi-expression.php                 30-Sep-2022 11:07                3175
class.mysql-xdevapi-result.php                     30-Sep-2022 11:07                4216
class.mysql-xdevapi-rowresult.php                  30-Sep-2022 11:07                4852
class.mysql-xdevapi-schema.php                     30-Sep-2022 11:07                7346
class.mysql-xdevapi-schemaobject.php               30-Sep-2022 11:07                2799
class.mysql-xdevapi-session.php                    30-Sep-2022 11:07                8914
class.mysql-xdevapi-sqlstatement.php               30-Sep-2022 11:07                6309
class.mysql-xdevapi-sqlstatementresult.php         30-Sep-2022 11:07                6879
class.mysql-xdevapi-statement.php                  30-Sep-2022 11:07                4688
class.mysql-xdevapi-table.php                      30-Sep-2022 11:07                7610
class.mysql-xdevapi-tabledelete.php                30-Sep-2022 11:07                5053
class.mysql-xdevapi-tableinsert.php                30-Sep-2022 11:07                3496
class.mysql-xdevapi-tableselect.php                30-Sep-2022 11:07                8231
class.mysql-xdevapi-tableupdate.php                30-Sep-2022 11:07                6020
class.mysql-xdevapi-warning.php                    30-Sep-2022 11:07                3738
class.mysqli-driver.php                            30-Sep-2022 11:07                7966
class.mysqli-result.php                            30-Sep-2022 11:07               14102
class.mysqli-sql-exception.php                     30-Sep-2022 11:07                8169
class.mysqli-stmt.php                              30-Sep-2022 11:07               17019
class.mysqli-warning.php                           30-Sep-2022 11:07                4267
class.mysqli.php                                   30-Sep-2022 11:07               33949
class.norewinditerator.php                         30-Sep-2022 11:07                7282
class.normalizer.php                               30-Sep-2022 11:07                8394
class.numberformatter.php                          30-Sep-2022 11:07               41101
class.oauth.php                                    30-Sep-2022 11:08               17418
class.oauthexception.php                           30-Sep-2022 11:08                7730
class.oauthprovider.php                            30-Sep-2022 11:08               11911
class.ocicollection.php                            30-Sep-2022 11:07                6320
class.ocilob.php                                   30-Sep-2022 11:07               13060
class.opensslasymmetrickey.php                     30-Sep-2022 11:07                1941
class.opensslcertificate.php                       30-Sep-2022 11:07                1931
class.opensslcertificatesigningrequest.php         30-Sep-2022 11:07                2018
class.outeriterator.php                            30-Sep-2022 11:07                4393
class.outofboundsexception.php                     30-Sep-2022 11:07                6788
class.outofrangeexception.php                      30-Sep-2022 11:07                6790
class.overflowexception.php                        30-Sep-2022 11:07                6717
class.parallel-channel.php                         30-Sep-2022 11:07                7986
class.parallel-events-event-type.php               30-Sep-2022 11:07                3318
class.parallel-events-event.php                    30-Sep-2022 11:07                3293
class.parallel-events-input.php                    30-Sep-2022 11:07                4542
class.parallel-events.php                          30-Sep-2022 11:07                6657
class.parallel-future.php                          30-Sep-2022 11:07                8229
class.parallel-runtime.php                         30-Sep-2022 11:07                6131
class.parallel-sync.php                            30-Sep-2022 11:07                5209
class.parentiterator.php                           30-Sep-2022 11:07                9687
class.parle-errorinfo.php                          30-Sep-2022 11:08                3702
class.parle-lexer.php                              30-Sep-2022 11:08               11767
class.parle-lexerexception.php                     30-Sep-2022 11:08                6857
class.parle-parser.php                             30-Sep-2022 11:08               14706
class.parle-parserexception.php                    30-Sep-2022 11:08                6839
class.parle-rlexer.php                             30-Sep-2022 11:08               13408
class.parle-rparser.php                            30-Sep-2022 11:08               14857
class.parle-stack.php                              30-Sep-2022 11:08                4649
class.parle-token.php                              30-Sep-2022 11:08                4421
class.parseerror.php                               30-Sep-2022 11:07                7220
class.pdo.php                                      30-Sep-2022 11:07               13254
class.pdoexception.php                             30-Sep-2022 11:07                8556
class.pdostatement.php                             30-Sep-2022 11:07               19896
class.pgsql-connection.php                         30-Sep-2022 11:07                1874
class.pgsql-lob.php                                30-Sep-2022 11:07                1815
class.pgsql-result.php                             30-Sep-2022 11:07                1847
class.phar.php                                     30-Sep-2022 11:07               61578
class.phardata.php                                 30-Sep-2022 11:07               45118
class.pharexception.php                            30-Sep-2022 11:07                6671
class.pharfileinfo.php                             30-Sep-2022 11:07               18672
class.php-user-filter.php                          30-Sep-2022 11:07                6189
class.phptoken.php                                 30-Sep-2022 11:08                8115
class.pool.php                                     30-Sep-2022 11:07                7161
class.pspell-config.php                            30-Sep-2022 11:07                1846
class.pspell-dictionary.php                        30-Sep-2022 11:07                1883
class.quickhashinthash.php                         30-Sep-2022 11:08               12907
class.quickhashintset.php                          30-Sep-2022 11:08               11098
class.quickhashintstringhash.php                   30-Sep-2022 11:08               13721
class.quickhashstringinthash.php                   30-Sep-2022 11:08               11836
class.rangeexception.php                           30-Sep-2022 11:07                6981
class.rararchive.php                               30-Sep-2022 11:07                7370
class.rarentry.php                                 30-Sep-2022 11:07               42158
class.rarexception.php                             30-Sep-2022 11:07                7835
class.recursivearrayiterator.php                   30-Sep-2022 11:07               13885
class.recursivecachingiterator.php                 30-Sep-2022 11:07               13258
class.recursivecallbackfilteriterator.php          30-Sep-2022 11:07               14439
class.recursivedirectoryiterator.php               30-Sep-2022 11:07               29377
class.recursivefilteriterator.php                  30-Sep-2022 11:07                8470
class.recursiveiterator.php                        30-Sep-2022 11:07                4900
class.recursiveiteratoriterator.php                30-Sep-2022 11:07               13528
class.recursiveregexiterator.php                   30-Sep-2022 11:07               13327
class.recursivetreeiterator.php                    30-Sep-2022 11:07               22825
class.reflection.php                               30-Sep-2022 11:08                3237
class.reflectionattribute.php                      30-Sep-2022 11:08                6254
class.reflectionclass.php                          30-Sep-2022 11:08               32277
class.reflectionclassconstant.php                  30-Sep-2022 11:08               13916
class.reflectionenum.php                           30-Sep-2022 11:08               25961
class.reflectionenumbackedcase.php                 30-Sep-2022 11:08               11226
class.reflectionenumunitcase.php                   30-Sep-2022 11:08               11019
class.reflectionexception.php                      30-Sep-2022 11:08                6635
class.reflectionextension.php                      30-Sep-2022 11:08                9410
class.reflectionfiber.php                          30-Sep-2022 11:08                4881
class.reflectionfunction.php                       30-Sep-2022 11:08               17926
class.reflectionfunctionabstract.php               30-Sep-2022 11:08               17832
class.reflectiongenerator.php                      30-Sep-2022 11:08                6232
class.reflectionintersectiontype.php               30-Sep-2022 11:08                3334
class.reflectionmethod.php                         30-Sep-2022 11:08               28093
class.reflectionnamedtype.php                      30-Sep-2022 11:08                3612
class.reflectionobject.php                         30-Sep-2022 11:08               23519
class.reflectionparameter.php                      30-Sep-2022 11:08               14732
class.reflectionproperty.php                       30-Sep-2022 11:08               19761
class.reflectionreference.php                      30-Sep-2022 11:08                3975
class.reflectiontype.php                           30-Sep-2022 11:08                4614
class.reflectionuniontype.php                      30-Sep-2022 11:08                3223
class.reflectionzendextension.php                  30-Sep-2022 11:08                6891
class.reflector.php                                30-Sep-2022 11:08                4063
class.regexiterator.php                            30-Sep-2022 11:07               15809
class.resourcebundle.php                           30-Sep-2022 11:07               10222
class.rrdcreator.php                               30-Sep-2022 11:08                4035
class.rrdgraph.php                                 30-Sep-2022 11:08                3630
class.rrdupdater.php                               30-Sep-2022 11:08                3022
class.runtimeexception.php                         30-Sep-2022 11:07                6666
class.seaslog.php                                  30-Sep-2022 11:07               17880
class.seekableiterator.php                         30-Sep-2022 11:07               12812
class.serializable.php                             30-Sep-2022 11:07                8772
class.sessionhandler.php                           30-Sep-2022 11:08               27736
class.sessionhandlerinterface.php                  30-Sep-2022 11:08               16994
class.sessionidinterface.php                       30-Sep-2022 11:08                3314
class.sessionupdatetimestamphandlerinterface.php   30-Sep-2022 11:08                4340
class.shmop.php                                    30-Sep-2022 11:07                1748
class.simplexmlelement.php                         30-Sep-2022 11:08               12975
class.simplexmliterator.php                        30-Sep-2022 11:08               12757
class.snmp.php                                     30-Sep-2022 11:08               24793
class.snmpexception.php                            30-Sep-2022 11:08                7682
class.soapclient.php                               30-Sep-2022 11:08               29879
class.soapfault.php                                30-Sep-2022 11:08               12768
class.soapheader.php                               30-Sep-2022 11:08                5564
class.soapparam.php                                30-Sep-2022 11:08                3750
class.soapserver.php                               30-Sep-2022 11:08                9348
class.soapvar.php                                  30-Sep-2022 11:08                7059
class.socket.php                                   30-Sep-2022 11:08                1815
class.sodiumexception.php                          30-Sep-2022 11:07                6609
class.solrclient.php                               30-Sep-2022 11:08               21145
class.solrclientexception.php                      30-Sep-2022 11:08                8508
class.solrcollapsefunction.php                     30-Sep-2022 11:08               10425
class.solrdismaxquery.php                          30-Sep-2022 11:08               94829
class.solrdocument.php                             30-Sep-2022 11:08               20234
class.solrdocumentfield.php                        30-Sep-2022 11:08                4475
class.solrexception.php                            30-Sep-2022 11:08                9054
class.solrgenericresponse.php                      30-Sep-2022 11:08               11040
class.solrillegalargumentexception.php             30-Sep-2022 11:08                8664
class.solrillegaloperationexception.php            30-Sep-2022 11:08                8731
class.solrinputdocument.php                        30-Sep-2022 11:08               16737
class.solrmissingmandatoryparameterexception.php   30-Sep-2022 11:08                7855
class.solrmodifiableparams.php                     30-Sep-2022 11:08                7971
class.solrobject.php                               30-Sep-2022 11:08                5512
class.solrparams.php                               30-Sep-2022 11:08                8267
class.solrpingresponse.php                         30-Sep-2022 11:08               10373
class.solrquery.php                                30-Sep-2022 11:08              104069
class.solrqueryresponse.php                        30-Sep-2022 11:08               10982
class.solrresponse.php                             30-Sep-2022 11:08               13147
class.solrserverexception.php                      30-Sep-2022 11:08                8548
class.solrupdateresponse.php                       30-Sep-2022 11:08               11018
class.solrutils.php                                30-Sep-2022 11:08                4542
class.spldoublylinkedlist.php                      30-Sep-2022 11:07               16620
class.splfileinfo.php                              30-Sep-2022 11:07               16149
class.splfileobject.php                            30-Sep-2022 11:07               31203
class.splfixedarray.php                            30-Sep-2022 11:07               17425
class.splheap.php                                  30-Sep-2022 11:07                7665
class.splmaxheap.php                               30-Sep-2022 11:07                6989
class.splminheap.php                               30-Sep-2022 11:07                6999
class.splobjectstorage.php                         30-Sep-2022 11:07               20668
class.splobserver.php                              30-Sep-2022 11:07                2895
class.splpriorityqueue.php                         30-Sep-2022 11:07                9571
class.splqueue.php                                 30-Sep-2022 11:07               12413
class.splstack.php                                 30-Sep-2022 11:07               11433
class.splsubject.php                               30-Sep-2022 11:07                3741
class.spltempfileobject.php                        30-Sep-2022 11:07               25531
class.spoofchecker.php                             30-Sep-2022 11:07               13591
class.sqlite3.php                                  30-Sep-2022 11:07               15807
class.sqlite3result.php                            30-Sep-2022 11:07                5222
class.sqlite3stmt.php                              30-Sep-2022 11:07                7444
class.stomp.php                                    30-Sep-2022 11:08               16979
class.stompexception.php                           30-Sep-2022 11:08                5239
class.stompframe.php                               30-Sep-2022 11:08                4059
class.streamwrapper.php                            30-Sep-2022 11:07               17948
class.stringable.php                               30-Sep-2022 11:07                9271
class.svm.php                                      30-Sep-2022 11:08               15550
class.svmmodel.php                                 30-Sep-2022 11:08                6129
class.swoole-async.php                             30-Sep-2022 11:07                7046
class.swoole-atomic.php                            30-Sep-2022 11:07                4391
class.swoole-buffer.php                            30-Sep-2022 11:07                6503
class.swoole-channel.php                           30-Sep-2022 11:07                3708
class.swoole-client.php                            30-Sep-2022 11:07               14252
class.swoole-connection-iterator.php               30-Sep-2022 11:07                7031
class.swoole-coroutine.php                         30-Sep-2022 11:07               20029
class.swoole-event.php                             30-Sep-2022 11:07                6593
class.swoole-exception.php                         30-Sep-2022 11:07                4133
class.swoole-http-client.php                       30-Sep-2022 11:07               12896
class.swoole-http-request.php                      30-Sep-2022 11:07                2849
class.swoole-http-response.php                     30-Sep-2022 11:07                9457
class.swoole-http-server.php                       30-Sep-2022 11:07               21510
class.swoole-lock.php                              30-Sep-2022 11:07                4429
class.swoole-mmap.php                              30-Sep-2022 11:07                2837
class.swoole-mysql-exception.php                   30-Sep-2022 11:07                4174
class.swoole-mysql.php                             30-Sep-2022 11:07                5114
class.swoole-process.php                           30-Sep-2022 11:07               11847
class.swoole-redis-server.php                      30-Sep-2022 11:08               26078
class.swoole-serialize.php                         30-Sep-2022 11:08                3348
class.swoole-server.php                            30-Sep-2022 11:08               24753
class.swoole-table.php                             30-Sep-2022 11:08               10949
class.swoole-timer.php                             30-Sep-2022 11:08                4474
class.swoole-websocket-frame.php                   30-Sep-2022 11:08                1860
class.swoole-websocket-server.php                  30-Sep-2022 11:08                6988
class.syncevent.php                                30-Sep-2022 11:07                4281
class.syncmutex.php                                30-Sep-2022 11:07                3770
class.syncreaderwriter.php                         30-Sep-2022 11:07                4637
class.syncsemaphore.php                            30-Sep-2022 11:07                4093
class.syncsharedmemory.php                         30-Sep-2022 11:07                4936
class.sysvmessagequeue.php                         30-Sep-2022 11:07                1865
class.sysvsemaphore.php                            30-Sep-2022 11:07                1851
class.sysvsharedmemory.php                         30-Sep-2022 11:07                1856
class.thread.php                                   30-Sep-2022 11:07               10254
class.threaded.php                                 30-Sep-2022 11:07                7996
class.throwable.php                                30-Sep-2022 11:07                7049
class.tidy.php                                     30-Sep-2022 11:08               17813
class.tidynode.php                                 30-Sep-2022 11:08               10752
class.transliterator.php                           30-Sep-2022 11:07                8634
class.traversable.php                              30-Sep-2022 11:07                4267
class.typeerror.php                                30-Sep-2022 11:07                7822
class.uconverter.php                               30-Sep-2022 11:07               32640
class.ui-area.php                                  30-Sep-2022 11:08               11098
class.ui-control.php                               30-Sep-2022 11:08                5201
class.ui-controls-box.php                          30-Sep-2022 11:08                9126
class.ui-controls-button.php                       30-Sep-2022 11:08                6229
class.ui-controls-check.php                        30-Sep-2022 11:08                6955
class.ui-controls-colorbutton.php                  30-Sep-2022 11:08                6265
class.ui-controls-combo.php                        30-Sep-2022 11:08                6201
class.ui-controls-editablecombo.php                30-Sep-2022 11:08                6309
class.ui-controls-entry.php                        30-Sep-2022 11:08                8691
class.ui-controls-form.php                         30-Sep-2022 11:08                7325
class.ui-controls-grid.php                         30-Sep-2022 11:08               11287
class.ui-controls-group.php                        30-Sep-2022 11:08                7799
class.ui-controls-label.php                        30-Sep-2022 11:08                5980
class.ui-controls-multilineentry.php               30-Sep-2022 11:08                8974
class.ui-controls-picker.php                       30-Sep-2022 11:08                6853
class.ui-controls-progress.php                     30-Sep-2022 11:08                5545
class.ui-controls-radio.php                        30-Sep-2022 11:08                6180
class.ui-controls-separator.php                    30-Sep-2022 11:08                6471
class.ui-controls-slider.php                       30-Sep-2022 11:08                6512
class.ui-controls-spin.php                         30-Sep-2022 11:08                6382
class.ui-controls-tab.php                          30-Sep-2022 11:08                8250
class.ui-draw-brush-gradient.php                   30-Sep-2022 11:08                6323
class.ui-draw-brush-lineargradient.php             30-Sep-2022 11:08                5679
class.ui-draw-brush-radialgradient.php             30-Sep-2022 11:08                5807
class.ui-draw-brush.php                            30-Sep-2022 11:08                4171
class.ui-draw-color.php                            30-Sep-2022 11:08                7709
class.ui-draw-line-cap.php                         30-Sep-2022 11:08                2397
class.ui-draw-line-join.php                        30-Sep-2022 11:08                2357
class.ui-draw-matrix.php                           30-Sep-2022 11:08                5410
class.ui-draw-path.php                             30-Sep-2022 11:08                9434
class.ui-draw-pen.php                              30-Sep-2022 11:08                7918
class.ui-draw-stroke.php                           30-Sep-2022 11:08                6089
class.ui-draw-text-font-descriptor.php             30-Sep-2022 11:08                5363
class.ui-draw-text-font-italic.php                 30-Sep-2022 11:08                2587
class.ui-draw-text-font-stretch.php                30-Sep-2022 11:08                3986
class.ui-draw-text-font-weight.php                 30-Sep-2022 11:08                3965
class.ui-draw-text-font.php                        30-Sep-2022 11:08                4486
class.ui-draw-text-layout.php                      30-Sep-2022 11:08                4720
class.ui-exception-invalidargumentexception.php    30-Sep-2022 11:08                6869
class.ui-exception-runtimeexception.php            30-Sep-2022 11:08                6792
class.ui-executor.php                              30-Sep-2022 11:08                4821
class.ui-key.php                                   30-Sep-2022 11:08                9129
class.ui-menu.php                                  30-Sep-2022 11:08                5715
class.ui-menuitem.php                              30-Sep-2022 11:08                3547
class.ui-point.php                                 30-Sep-2022 11:08                5831
class.ui-size.php                                  30-Sep-2022 11:08                5915
class.ui-window.php                                30-Sep-2022 11:08               11807
class.underflowexception.php                       30-Sep-2022 11:07                6749
class.unexpectedvalueexception.php                 30-Sep-2022 11:07                7021
class.unhandledmatcherror.php                      30-Sep-2022 11:07                6634
class.unitenum.php                                 30-Sep-2022 11:07                2954
class.v8js.php                                     30-Sep-2022 11:08                7984
class.v8jsexception.php                            30-Sep-2022 11:08               10161
class.valueerror.php                               30-Sep-2022 11:07                6751
class.variant.php                                  30-Sep-2022 11:08                5781
class.varnishadmin.php                             30-Sep-2022 11:08               10229
class.varnishlog.php                               30-Sep-2022 11:08               28048
class.varnishstat.php                              30-Sep-2022 11:08                2845
class.volatile.php                                 30-Sep-2022 11:07               11576
class.vtiful-kernel-excel.php                      30-Sep-2022 11:07               10218
class.vtiful-kernel-format.php                     30-Sep-2022 11:07               13125
class.weakmap.php                                  30-Sep-2022 11:07                9842
class.weakreference.php                            30-Sep-2022 11:07                5684
class.win32serviceexception.php                    30-Sep-2022 11:08                6946
class.wkhtmltox-image-converter.php                30-Sep-2022 11:07                3786
class.wkhtmltox-pdf-converter.php                  30-Sep-2022 11:07                4135
class.wkhtmltox-pdf-object.php                     30-Sep-2022 11:07                2780
class.worker.php                                   30-Sep-2022 11:07                7821
class.xmldiff-base.php                             30-Sep-2022 11:08                4224
class.xmldiff-dom.php                              30-Sep-2022 11:08                5234
class.xmldiff-file.php                             30-Sep-2022 11:08                4850
class.xmldiff-memory.php                           30-Sep-2022 11:08                4882
class.xmlparser.php                                30-Sep-2022 11:08                1830
class.xmlreader.php                                30-Sep-2022 11:08               32985
class.xmlwriter.php                                30-Sep-2022 11:08               25818
class.xsltprocessor.php                            30-Sep-2022 11:08                9653
class.yac.php                                      30-Sep-2022 11:07                8354
class.yaconf.php                                   30-Sep-2022 11:08                3292
class.yaf-action-abstract.php                      30-Sep-2022 11:08               11704
class.yaf-application.php                          30-Sep-2022 11:08               12748
class.yaf-bootstrap-abstract.php                   30-Sep-2022 11:08                6316
class.yaf-config-abstract.php                      30-Sep-2022 11:08                5102
class.yaf-config-ini.php                           30-Sep-2022 11:08               16819
class.yaf-config-simple.php                        30-Sep-2022 11:08               12020
class.yaf-controller-abstract.php                  30-Sep-2022 11:08               19383
class.yaf-dispatcher.php                           30-Sep-2022 11:08               19966
class.yaf-exception-dispatchfailed.php             30-Sep-2022 11:08                2556
class.yaf-exception-loadfailed-action.php          30-Sep-2022 11:08                2627
class.yaf-exception-loadfailed-controller.php      30-Sep-2022 11:08                2652
class.yaf-exception-loadfailed-module.php          30-Sep-2022 11:08                2616
class.yaf-exception-loadfailed-view.php            30-Sep-2022 11:08                2556
class.yaf-exception-loadfailed.php                 30-Sep-2022 11:08                2530
class.yaf-exception-routerfailed.php               30-Sep-2022 11:08                2541
class.yaf-exception-startuperror.php               30-Sep-2022 11:08                2539
class.yaf-exception-typeerror.php                  30-Sep-2022 11:08                2510
class.yaf-exception.php                            30-Sep-2022 11:08                7540
class.yaf-loader.php                               30-Sep-2022 11:08               19278
class.yaf-plugin-abstract.php                      30-Sep-2022 11:08               18579
class.yaf-registry.php                             30-Sep-2022 11:08                5774
class.yaf-request-abstract.php                     30-Sep-2022 11:08               21550
class.yaf-request-http.php                         30-Sep-2022 11:08               20914
class.yaf-request-simple.php                       30-Sep-2022 11:08               19876
class.yaf-response-abstract.php                    30-Sep-2022 11:08               10678
class.yaf-route-interface.php                      30-Sep-2022 11:08                3501
class.yaf-route-map.php                            30-Sep-2022 11:08                6284
class.yaf-route-regex.php                          30-Sep-2022 11:08                7579
class.yaf-route-rewrite.php                        30-Sep-2022 11:08                6844
class.yaf-route-simple.php                         30-Sep-2022 11:08                6253
class.yaf-route-static.php                         30-Sep-2022 11:08                4821
class.yaf-route-supervar.php                       30-Sep-2022 11:08                4385
class.yaf-router.php                               30-Sep-2022 11:08               12744
class.yaf-session.php                              30-Sep-2022 11:08               11435
class.yaf-view-interface.php                       30-Sep-2022 11:08                5433
class.yaf-view-simple.php                          30-Sep-2022 11:08               10162
class.yar-client-exception.php                     30-Sep-2022 11:08                6015
class.yar-client.php                               30-Sep-2022 11:08                5463
class.yar-concurrent-client.php                    30-Sep-2022 11:08                6152
class.yar-server-exception.php                     30-Sep-2022 11:08                6475
class.yar-server.php                               30-Sep-2022 11:08                3284
class.ziparchive.php                               30-Sep-2022 11:07               40414
class.zmq.php                                      30-Sep-2022 11:08               32595
class.zmqcontext.php                               30-Sep-2022 11:08                5036
class.zmqdevice.php                                30-Sep-2022 11:08                6793
class.zmqpoll.php                                  30-Sep-2022 11:08                4661
class.zmqsocket.php                                30-Sep-2022 11:08                9978
class.zookeeper.php                                30-Sep-2022 11:08               46800
class.zookeeperauthenticationexception.php         30-Sep-2022 11:08                6799
class.zookeeperconfig.php                          30-Sep-2022 11:08                5381
class.zookeeperconnectionexception.php             30-Sep-2022 11:08                6794
class.zookeeperexception.php                       30-Sep-2022 11:08                6660
class.zookeepermarshallingexception.php            30-Sep-2022 11:08                6815
class.zookeepernonodeexception.php                 30-Sep-2022 11:08                6782
class.zookeeperoperationtimeoutexception.php       30-Sep-2022 11:08                6825
class.zookeepersessionexception.php                30-Sep-2022 11:08                6763
classobj.configuration.php                         30-Sep-2022 11:08                1197
classobj.constants.php                             30-Sep-2022 11:08                1140
classobj.examples.php                              30-Sep-2022 11:08               15320
classobj.installation.php                          30-Sep-2022 11:08                1231
classobj.requirements.php                          30-Sep-2022 11:08                1171
classobj.resources.php                             30-Sep-2022 11:08                1172
classobj.setup.php                                 30-Sep-2022 11:08                1568
closure.bind.php                                   30-Sep-2022 11:07                8148
closure.bindto.php                                 30-Sep-2022 11:07                9919
closure.call.php                                   30-Sep-2022 11:07                6598
closure.construct.php                              30-Sep-2022 11:07                2530
closure.fromcallable.php                           30-Sep-2022 11:07                3972
cmark.installation.php                             30-Sep-2022 11:08                1953
cmark.requirements.php                             30-Sep-2022 11:08                1269
cmark.setup.php                                    30-Sep-2022 11:08                1388
collator.asort.php                                 30-Sep-2022 11:07                9154
collator.compare.php                               30-Sep-2022 11:07               10726
collator.construct.php                             30-Sep-2022 11:07                5722
collator.create.php                                30-Sep-2022 11:07                5376
collator.getattribute.php                          30-Sep-2022 11:07                5903
collator.geterrorcode.php                          30-Sep-2022 11:07                5221
collator.geterrormessage.php                       30-Sep-2022 11:07                5289
collator.getlocale.php                             30-Sep-2022 11:07                6619
collator.getsortkey.php                            30-Sep-2022 11:07                6806
collator.getstrength.php                           30-Sep-2022 11:07                4823
collator.setattribute.php                          30-Sep-2022 11:07                6437
collator.setstrength.php                           30-Sep-2022 11:07               14145
collator.sort.php                                  30-Sep-2022 11:07                7876
collator.sortwithsortkeys.php                      30-Sep-2022 11:07                6412
collectable.isgarbage.php                          30-Sep-2022 11:07                2677
com.configuration.php                              30-Sep-2022 11:08                8703
com.constants.php                                  30-Sep-2022 11:08               19650
com.construct.php                                  30-Sep-2022 11:08                8850
com.error-handling.php                             30-Sep-2022 11:08                1601
com.examples.arrays.php                            30-Sep-2022 11:08                2354
com.examples.foreach.php                           30-Sep-2022 11:08                3042
com.examples.php                                   30-Sep-2022 11:08                1394
com.installation.php                               30-Sep-2022 11:08                1735
com.requirements.php                               30-Sep-2022 11:08                1253
com.resources.php                                  30-Sep-2022 11:08                1137
com.setup.php                                      30-Sep-2022 11:08                1507
commonmark-cql.construct.php                       30-Sep-2022 11:08                2121
commonmark-cql.invoke.php                          30-Sep-2022 11:08                3735
commonmark-interfaces-ivisitable.accept.php        30-Sep-2022 11:08                3098
commonmark-interfaces-ivisitor.enter.php           30-Sep-2022 11:08                4093
commonmark-interfaces-ivisitor.leave.php           30-Sep-2022 11:08                4095
commonmark-node-bulletlist.construct.php           30-Sep-2022 11:08                3040
commonmark-node-codeblock.construct.php            30-Sep-2022 11:08                2736
commonmark-node-heading.construct.php              30-Sep-2022 11:08                2597
commonmark-node-image.construct.php                30-Sep-2022 11:08                3119
commonmark-node-link.construct.php                 30-Sep-2022 11:08                3116
commonmark-node-orderedlist.construct.php          30-Sep-2022 11:08                3840
commonmark-node-text.construct.php                 30-Sep-2022 11:08                2620
commonmark-node.accept.php                         30-Sep-2022 11:08                2838
commonmark-node.appendchild.php                    30-Sep-2022 11:08                2716
commonmark-node.insertafter.php                    30-Sep-2022 11:08                2741
commonmark-node.insertbefore.php                   30-Sep-2022 11:08                2739
commonmark-node.prependchild.php                   30-Sep-2022 11:08                2743
commonmark-node.replace.php                        30-Sep-2022 11:08                2687
commonmark-node.unlink.php                         30-Sep-2022 11:08                2376
commonmark-parser.construct.php                    30-Sep-2022 11:08                3272
commonmark-parser.finish.php                       30-Sep-2022 11:08                2431
commonmark-parser.parse.php                        30-Sep-2022 11:08                2561
compersisthelper.construct.php                     30-Sep-2022 11:08                3635
compersisthelper.getcurfilename.php                30-Sep-2022 11:08                3157
compersisthelper.getmaxstreamsize.php              30-Sep-2022 11:08                3259
compersisthelper.initnew.php                       30-Sep-2022 11:08                3056
compersisthelper.loadfromfile.php                  30-Sep-2022 11:08                4243
compersisthelper.loadfromstream.php                30-Sep-2022 11:08                3436
compersisthelper.savetofile.php                    30-Sep-2022 11:08                6200
compersisthelper.savetostream.php                  30-Sep-2022 11:08                3462
componere-abstract-definition.addinterface.php     30-Sep-2022 11:07                3239
componere-abstract-definition.addmethod.php        30-Sep-2022 11:07                4006
componere-abstract-definition.addtrait.php         30-Sep-2022 11:07                3191
componere-abstract-definition.getreflector.php     30-Sep-2022 11:07                2349
componere-definition.addconstant.php               30-Sep-2022 11:07                4292
componere-definition.addproperty.php               30-Sep-2022 11:07                3701
componere-definition.construct.php                 30-Sep-2022 11:07                5452
componere-definition.getclosure.php                30-Sep-2022 11:07                3366
componere-definition.getclosures.php               30-Sep-2022 11:07                2610
componere-definition.isregistered.php              30-Sep-2022 11:07                2172
componere-definition.register.php                  30-Sep-2022 11:07                2396
componere-method.construct.php                     30-Sep-2022 11:07                2177
componere-method.getreflector.php                  30-Sep-2022 11:07                2152
componere-method.setprivate.php                    30-Sep-2022 11:07                2413
componere-method.setprotected.php                  30-Sep-2022 11:07                2428
componere-method.setstatic.php                     30-Sep-2022 11:07                2010
componere-patch.apply.php                          30-Sep-2022 11:07                1817
componere-patch.construct.php                      30-Sep-2022 11:07                3415
componere-patch.derive.php                         30-Sep-2022 11:07                3150
componere-patch.getclosure.php                     30-Sep-2022 11:07                2959
componere-patch.getclosures.php                    30-Sep-2022 11:07                2094
componere-patch.isapplied.php                      30-Sep-2022 11:07                1737
componere-patch.revert.php                         30-Sep-2022 11:07                1814
componere-value.construct.php                      30-Sep-2022 11:07                2610
componere-value.hasdefault.php                     30-Sep-2022 11:07                1781
componere-value.isprivate.php                      30-Sep-2022 11:07                1802
componere-value.isprotected.php                    30-Sep-2022 11:07                1812
componere-value.isstatic.php                       30-Sep-2022 11:07                1796
componere-value.setprivate.php                     30-Sep-2022 11:07                2435
componere-value.setprotected.php                   30-Sep-2022 11:07                2449
componere-value.setstatic.php                      30-Sep-2022 11:07                2026
componere.cast.php                                 30-Sep-2022 11:07                4861
componere.cast_by_ref.php                          30-Sep-2022 11:07                5037
componere.installation.php                         30-Sep-2022 11:07                1325
componere.requirements.php                         30-Sep-2022 11:07                1159
componere.setup.php                                30-Sep-2022 11:07                1427
configuration.changes.modes.php                    30-Sep-2022 11:07                3935
configuration.changes.php                          30-Sep-2022 11:07                9843
configuration.file.per-user.php                    30-Sep-2022 11:07                3436
configuration.file.php                             30-Sep-2022 11:07               11525
configuration.php                                  30-Sep-2022 11:07                1591
configure.about.php                                30-Sep-2022 11:08               13869
configure.php                                      30-Sep-2022 11:08                1421
context.curl.php                                   30-Sep-2022 11:07                9161
context.ftp.php                                    30-Sep-2022 11:07                4527
context.http.php                                   30-Sep-2022 11:07               16768
context.params.php                                 30-Sep-2022 11:07                2630
context.phar.php                                   30-Sep-2022 11:07                2930
context.php                                        30-Sep-2022 11:07                3300
context.socket.php                                 30-Sep-2022 11:07               10699
context.ssl.php                                    30-Sep-2022 11:07               12144
context.zip.php                                    30-Sep-2022 11:07                4538
control-structures.alternative-syntax.php          30-Sep-2022 11:07                7326
control-structures.break.php                       30-Sep-2022 11:07                5500
control-structures.continue.php                    30-Sep-2022 11:07                7813
control-structures.declare.php                     30-Sep-2022 11:07               10911
control-structures.do.while.php                    30-Sep-2022 11:07                5445
control-structures.else.php                        30-Sep-2022 11:07                5089
control-structures.elseif.php                      30-Sep-2022 11:07                7852
control-structures.for.php                         30-Sep-2022 11:07               12917
control-structures.foreach.php                     30-Sep-2022 11:07               23278
control-structures.goto.php                        30-Sep-2022 11:07                7392
control-structures.if.php                          30-Sep-2022 11:07                4784
control-structures.intro.php                       30-Sep-2022 11:07                2568
control-structures.match.php                       30-Sep-2022 11:07               19899
control-structures.switch.php                      30-Sep-2022 11:07               22418
control-structures.while.php                       30-Sep-2022 11:07                4855
copyright.php                                      30-Sep-2022 11:07                2379
countable.count.php                                30-Sep-2022 11:07                5519
csprng.configuration.php                           30-Sep-2022 11:07                1183
csprng.constants.php                               30-Sep-2022 11:07                1109
csprng.installation.php                            30-Sep-2022 11:07                1217
csprng.requirements.php                            30-Sep-2022 11:07                1157
csprng.resources.php                               30-Sep-2022 11:07                1158
csprng.setup.php                                   30-Sep-2022 11:07                1522
ctype.configuration.php                            30-Sep-2022 11:08                1176
ctype.constants.php                                30-Sep-2022 11:08                1100
ctype.installation.php                             30-Sep-2022 11:08                1513
ctype.requirements.php                             30-Sep-2022 11:08                1184
ctype.resources.php                                30-Sep-2022 11:08                1151
ctype.setup.php                                    30-Sep-2022 11:08                1514
cubrid.configuration.php                           30-Sep-2022 11:07                1169
cubrid.constants.php                               30-Sep-2022 11:07               13793
cubrid.examples.php                                30-Sep-2022 11:07               21140
cubrid.installation.php                            30-Sep-2022 11:07                2190
cubrid.requirements.php                            30-Sep-2022 11:07                1235
cubrid.resources.php                               30-Sep-2022 11:07                3049
cubrid.setup.php                                   30-Sep-2022 11:07                1528
cubridmysql.cubrid.php                             30-Sep-2022 11:07                4873
curl.configuration.php                             30-Sep-2022 11:08                2395
curl.constants.php                                 30-Sep-2022 11:08              104550
curl.examples-basic.php                            30-Sep-2022 11:08                4689
curl.examples.php                                  30-Sep-2022 11:08                1329
curl.installation.php                              30-Sep-2022 11:08                2810
curl.requirements.php                              30-Sep-2022 11:08                1467
curl.resources.php                                 30-Sep-2022 11:08                1327
curl.setup.php                                     30-Sep-2022 11:08                1524
curlfile.construct.php                             30-Sep-2022 11:08               21312
curlfile.getfilename.php                           30-Sep-2022 11:08                2087
curlfile.getmimetype.php                           30-Sep-2022 11:08                2091
curlfile.getpostfilename.php                       30-Sep-2022 11:08                2147
curlfile.setmimetype.php                           30-Sep-2022 11:08                2334
curlfile.setpostfilename.php                       30-Sep-2022 11:08                2379
curlstringfile.construct.php                       30-Sep-2022 11:08                7003
dateinterval.construct.php                         30-Sep-2022 11:07               13380
dateinterval.createfromdatestring.php              30-Sep-2022 11:07               15407
dateinterval.format.php                            30-Sep-2022 11:07               14744
dateperiod.construct.php                           30-Sep-2022 11:07               18938
dateperiod.getdateinterval.php                     30-Sep-2022 11:07                4659
dateperiod.getenddate.php                          30-Sep-2022 11:07                7661
dateperiod.getrecurrences.php                      30-Sep-2022 11:07                2630
dateperiod.getstartdate.php                        30-Sep-2022 11:07                5122
datetime.add.php                                   30-Sep-2022 11:07                5058
datetime.configuration.php                         30-Sep-2022 11:07                6067
datetime.constants.php                             30-Sep-2022 11:07                2474
datetime.construct.php                             30-Sep-2022 11:07                5142
datetime.createfromformat.php                      30-Sep-2022 11:07                5470
datetime.createfromimmutable.php                   30-Sep-2022 11:07                4403
datetime.createfrominterface.php                   30-Sep-2022 11:07                5018
datetime.diff.php                                  30-Sep-2022 11:07               14872
datetime.examples-arithmetic.php                   30-Sep-2022 11:07               16398
datetime.examples.php                              30-Sep-2022 11:07                1367
datetime.format.php                                30-Sep-2022 11:07               23414
datetime.formats.compound.php                      30-Sep-2022 11:07               12970
datetime.formats.date.php                          30-Sep-2022 11:07               14986
datetime.formats.php                               30-Sep-2022 11:07                7967
datetime.formats.relative.php                      30-Sep-2022 11:07               17448
datetime.formats.time.php                          30-Sep-2022 11:07                7351
datetime.getlasterrors.php                         30-Sep-2022 11:07                3570
datetime.getoffset.php                             30-Sep-2022 11:07                8290
datetime.gettimestamp.php                          30-Sep-2022 11:07                7107
datetime.gettimezone.php                           30-Sep-2022 11:07                7734
datetime.installation.php                          30-Sep-2022 11:07                1648
datetime.modify.php                                30-Sep-2022 11:07               10527
datetime.requirements.php                          30-Sep-2022 11:07                1171
datetime.resources.php                             30-Sep-2022 11:07                1172
datetime.set-state.php                             30-Sep-2022 11:07                2840
datetime.setdate.php                               30-Sep-2022 11:07                5426
datetime.setisodate.php                            30-Sep-2022 11:07                5576
datetime.settime.php                               30-Sep-2022 11:07                6941
datetime.settimestamp.php                          30-Sep-2022 11:07                5066
datetime.settimezone.php                           30-Sep-2022 11:07                9632
datetime.setup.php                                 30-Sep-2022 11:07                1580
datetime.sub.php                                   30-Sep-2022 11:07                4953
datetime.wakeup.php                                30-Sep-2022 11:07                2955
datetimeimmutable.add.php                          30-Sep-2022 11:07               10826
datetimeimmutable.construct.php                    30-Sep-2022 11:07               18572
datetimeimmutable.createfromformat.php             30-Sep-2022 11:07               46562
datetimeimmutable.createfrominterface.php          30-Sep-2022 11:07                5272
datetimeimmutable.createfrommutable.php            30-Sep-2022 11:07                4561
datetimeimmutable.getlasterrors.php                30-Sep-2022 11:07                4972
datetimeimmutable.modify.php                       30-Sep-2022 11:07                8362
datetimeimmutable.set-state.php                    30-Sep-2022 11:07                2720
datetimeimmutable.setdate.php                      30-Sep-2022 11:07                9336
datetimeimmutable.setisodate.php                   30-Sep-2022 11:07               12992
datetimeimmutable.settime.php                      30-Sep-2022 11:07               12270
datetimeimmutable.settimestamp.php                 30-Sep-2022 11:07                5788
datetimeimmutable.settimezone.php                  30-Sep-2022 11:07                6219
datetimeimmutable.sub.php                          30-Sep-2022 11:07               11056
datetimezone.construct.php                         30-Sep-2022 11:07               10329
datetimezone.getlocation.php                       30-Sep-2022 11:07                5662
datetimezone.getname.php                           30-Sep-2022 11:07                3681
datetimezone.getoffset.php                         30-Sep-2022 11:07                8011
datetimezone.gettransitions.php                    30-Sep-2022 11:07               11240
datetimezone.listabbreviations.php                 30-Sep-2022 11:07                6210
datetimezone.listidentifiers.php                   30-Sep-2022 11:07               14480
dba.configuration.php                              30-Sep-2022 11:07                2184
dba.constants.php                                  30-Sep-2022 11:07                1997
dba.example.php                                    30-Sep-2022 11:07                6880
dba.examples.php                                   30-Sep-2022 11:07                1274
dba.installation.php                               30-Sep-2022 11:07               10873
dba.requirements.php                               30-Sep-2022 11:07                8101
dba.resources.php                                  30-Sep-2022 11:07                1504
dba.setup.php                                      30-Sep-2022 11:07                1510
dbase.configuration.php                            30-Sep-2022 11:07                1176
dbase.constants.php                                30-Sep-2022 11:07                3076
dbase.installation.php                             30-Sep-2022 11:07                1638
dbase.requirements.php                             30-Sep-2022 11:07                1150
dbase.resources.php                                30-Sep-2022 11:07                1425
dbase.setup.php                                    30-Sep-2022 11:07                1532
debugger-about.php                                 30-Sep-2022 11:08                1923
debugger.php                                       30-Sep-2022 11:08                1363
dio.configuration.php                              30-Sep-2022 11:07                1162
dio.constants.php                                  30-Sep-2022 11:07                7268
dio.installation.php                               30-Sep-2022 11:07                2102
dio.requirements.php                               30-Sep-2022 11:07                1136
dio.resources.php                                  30-Sep-2022 11:07                1343
dio.setup.php                                      30-Sep-2022 11:07                1520
dir.configuration.php                              30-Sep-2022 11:07                1162
dir.constants.php                                  30-Sep-2022 11:07                2197
dir.installation.php                               30-Sep-2022 11:07                1196
dir.requirements.php                               30-Sep-2022 11:07                1136
dir.resources.php                                  30-Sep-2022 11:07                1137
dir.setup.php                                      30-Sep-2022 11:07                1519
directory.close.php                                30-Sep-2022 11:07                2234
directory.read.php                                 30-Sep-2022 11:07                2309
directory.rewind.php                               30-Sep-2022 11:07                2245
directoryiterator.construct.php                    30-Sep-2022 11:07                6061
directoryiterator.current.php                      30-Sep-2022 11:07                6389
directoryiterator.getatime.php                     30-Sep-2022 11:07                5804
directoryiterator.getbasename.php                  30-Sep-2022 11:07                6898
directoryiterator.getctime.php                     30-Sep-2022 11:07                5875
directoryiterator.getextension.php                 30-Sep-2022 11:07                6170
directoryiterator.getfilename.php                  30-Sep-2022 11:07                5525
directoryiterator.getgroup.php                     30-Sep-2022 11:07                5967
directoryiterator.getinode.php                     30-Sep-2022 11:07                4756
directoryiterator.getmtime.php                     30-Sep-2022 11:07                5797
directoryiterator.getowner.php                     30-Sep-2022 11:07                5343
directoryiterator.getpath.php                      30-Sep-2022 11:07                4918
directoryiterator.getpathname.php                  30-Sep-2022 11:07                5334
directoryiterator.getperms.php                     30-Sep-2022 11:07                6252
directoryiterator.getsize.php                      30-Sep-2022 11:07                5004
directoryiterator.gettype.php                      30-Sep-2022 11:07                5944
directoryiterator.isdir.php                        30-Sep-2022 11:07                5825
directoryiterator.isdot.php                        30-Sep-2022 11:07                6130
directoryiterator.isexecutable.php                 30-Sep-2022 11:07                5668
directoryiterator.isfile.php                       30-Sep-2022 11:07                6035
directoryiterator.islink.php                       30-Sep-2022 11:07                7601
directoryiterator.isreadable.php                   30-Sep-2022 11:07                5502
directoryiterator.iswritable.php                   30-Sep-2022 11:07                5732
directoryiterator.key.php                          30-Sep-2022 11:07                6838
directoryiterator.next.php                         30-Sep-2022 11:07                5578
directoryiterator.rewind.php                       30-Sep-2022 11:07                5470
directoryiterator.seek.php                         30-Sep-2022 11:07                5389
directoryiterator.tostring.php                     30-Sep-2022 11:07                4718
directoryiterator.valid.php                        30-Sep-2022 11:07                5864
doc.changelog.php                                  30-Sep-2022 11:08              359057
dom.configuration.php                              30-Sep-2022 11:08                1162
dom.constants.php                                  30-Sep-2022 11:08               14606
dom.examples.php                                   30-Sep-2022 11:08                2945
dom.installation.php                               30-Sep-2022 11:08                1341
dom.requirements.php                               30-Sep-2022 11:08                1610
dom.resources.php                                  30-Sep-2022 11:08                1137
dom.setup.php                                      30-Sep-2022 11:08                1499
domattr.construct.php                              30-Sep-2022 11:08                5703
domattr.isid.php                                   30-Sep-2022 11:08                5059
domcdatasection.construct.php                      30-Sep-2022 11:08                5294
domcharacterdata.appenddata.php                    30-Sep-2022 11:08                3741
domcharacterdata.deletedata.php                    30-Sep-2022 11:08                4831
domcharacterdata.insertdata.php                    30-Sep-2022 11:08                4526
domcharacterdata.replacedata.php                   30-Sep-2022 11:08                5133
domcharacterdata.substringdata.php                 30-Sep-2022 11:08                4863
domchildnode.after.php                             30-Sep-2022 11:08                3582
domchildnode.before.php                            30-Sep-2022 11:08                3373
domchildnode.remove.php                            30-Sep-2022 11:08                3171
domchildnode.replacewith.php                       30-Sep-2022 11:08                3799
domcomment.construct.php                           30-Sep-2022 11:08                5202
domdocument.construct.php                          30-Sep-2022 11:08                4372
domdocument.createattribute.php                    30-Sep-2022 11:08                6052
domdocument.createattributens.php                  30-Sep-2022 11:08                7049
domdocument.createcdatasection.php                 30-Sep-2022 11:08                5702
domdocument.createcomment.php                      30-Sep-2022 11:08                6188
domdocument.createdocumentfragment.php             30-Sep-2022 11:08                6095
domdocument.createelement.php                      30-Sep-2022 11:08               11849
domdocument.createelementns.php                    30-Sep-2022 11:08               14389
domdocument.createentityreference.php              30-Sep-2022 11:08                6404
domdocument.createprocessinginstruction.php        30-Sep-2022 11:08                6610
domdocument.createtextnode.php                     30-Sep-2022 11:08                6179
domdocument.getelementbyid.php                     30-Sep-2022 11:08                7674
domdocument.getelementsbytagname.php               30-Sep-2022 11:08                6264
domdocument.getelementsbytagnamens.php             30-Sep-2022 11:08                7782
domdocument.importnode.php                         30-Sep-2022 11:08                9196
domdocument.load.php                               30-Sep-2022 11:08                6563
domdocument.loadhtml.php                           30-Sep-2022 11:08                7218
domdocument.loadhtmlfile.php                       30-Sep-2022 11:08                6924
domdocument.loadxml.php                            30-Sep-2022 11:08                7237
domdocument.normalizedocument.php                  30-Sep-2022 11:08                3054
domdocument.registernodeclass.php                  30-Sep-2022 11:08               21533
domdocument.relaxngvalidate.php                    30-Sep-2022 11:08                3920
domdocument.relaxngvalidatesource.php              30-Sep-2022 11:08                3947
domdocument.save.php                               30-Sep-2022 11:08                7714
domdocument.savehtml.php                           30-Sep-2022 11:08                7565
domdocument.savehtmlfile.php                       30-Sep-2022 11:08                8117
domdocument.savexml.php                            30-Sep-2022 11:08                9158
domdocument.schemavalidate.php                     30-Sep-2022 11:08                4313
domdocument.schemavalidatesource.php               30-Sep-2022 11:08                4377
domdocument.validate.php                           30-Sep-2022 11:08                6151
domdocument.xinclude.php                           30-Sep-2022 11:08                7310
domdocumentfragment.appendxml.php                  30-Sep-2022 11:08                5428
domdocumentfragment.construct.php                  30-Sep-2022 11:08                2104
domelement.construct.php                           30-Sep-2022 11:08                6756
domelement.getattribute.php                        30-Sep-2022 11:08                3471
domelement.getattributenode.php                    30-Sep-2022 11:08                4022
domelement.getattributenodens.php                  30-Sep-2022 11:08                4431
domelement.getattributens.php                      30-Sep-2022 11:08                3957
domelement.getelementsbytagname.php                30-Sep-2022 11:08                3682
domelement.getelementsbytagnamens.php              30-Sep-2022 11:08                4417
domelement.hasattribute.php                        30-Sep-2022 11:08                3690
domelement.hasattributens.php                      30-Sep-2022 11:08                4075
domelement.removeattribute.php                     30-Sep-2022 11:08                3843
domelement.removeattributenode.php                 30-Sep-2022 11:08                4289
domelement.removeattributens.php                   30-Sep-2022 11:08                4280
domelement.setattribute.php                        30-Sep-2022 11:08                6082
domelement.setattributenode.php                    30-Sep-2022 11:08                4069
domelement.setattributenodens.php                  30-Sep-2022 11:08                4035
domelement.setattributens.php                      30-Sep-2022 11:08                4966
domelement.setidattribute.php                      30-Sep-2022 11:08                4499
domelement.setidattributenode.php                  30-Sep-2022 11:08                4541
domelement.setidattributens.php                    30-Sep-2022 11:08                4859
domentityreference.construct.php                   30-Sep-2022 11:08                4906
domimplementation.construct.php                    30-Sep-2022 11:08                2170
domimplementation.createdocument.php               30-Sep-2022 11:08                7132
domimplementation.createdocumenttype.php           30-Sep-2022 11:08                9539
domimplementation.hasfeature.php                   30-Sep-2022 11:08                9946
domnamednodemap.count.php                          30-Sep-2022 11:08                2397
domnamednodemap.getnameditem.php                   30-Sep-2022 11:08                3322
domnamednodemap.getnameditemns.php                 30-Sep-2022 11:08                3755
domnamednodemap.item.php                           30-Sep-2022 11:08                2929
domnode.appendchild.php                            30-Sep-2022 11:08                8841
domnode.c14n.php                                   30-Sep-2022 11:08                4408
domnode.c14nfile.php                               30-Sep-2022 11:08                4701
domnode.clonenode.php                              30-Sep-2022 11:08                2700
domnode.getlineno.php                              30-Sep-2022 11:08                4887
domnode.getnodepath.php                            30-Sep-2022 11:08                5182
domnode.hasattributes.php                          30-Sep-2022 11:08                2876
domnode.haschildnodes.php                          30-Sep-2022 11:08                2760
domnode.insertbefore.php                           30-Sep-2022 11:08                5333
domnode.isdefaultnamespace.php                     30-Sep-2022 11:08                2749
domnode.issamenode.php                             30-Sep-2022 11:08                2708
domnode.issupported.php                            30-Sep-2022 11:08                3643
domnode.lookupnamespaceuri.php                     30-Sep-2022 11:08                3036
domnode.lookupprefix.php                           30-Sep-2022 11:08                3027
domnode.normalize.php                              30-Sep-2022 11:08                2839
domnode.removechild.php                            30-Sep-2022 11:08                6970
domnode.replacechild.php                           30-Sep-2022 11:08                5821
domnodelist.count.php                              30-Sep-2022 11:08                2311
domnodelist.item.php                               30-Sep-2022 11:08                6981
domparentnode.append.php                           30-Sep-2022 11:08                3047
domparentnode.prepend.php                          30-Sep-2022 11:08                3095
domprocessinginstruction.construct.php             30-Sep-2022 11:08                6818
domtext.construct.php                              30-Sep-2022 11:08                4893
domtext.iselementcontentwhitespace.php             30-Sep-2022 11:08                2500
domtext.iswhitespaceinelementcontent.php           30-Sep-2022 11:08                2758
domtext.splittext.php                              30-Sep-2022 11:08                3350
domxpath.construct.php                             30-Sep-2022 11:08                2784
domxpath.evaluate.php                              30-Sep-2022 11:08                7569
domxpath.query.php                                 30-Sep-2022 11:08               12321
domxpath.registernamespace.php                     30-Sep-2022 11:08                3038
domxpath.registerphpfunctions.php                  30-Sep-2022 11:08               14097
dotnet.construct.php                               30-Sep-2022 11:08                2995
ds-collection.clear.php                            30-Sep-2022 11:08                3971
ds-collection.copy.php                             30-Sep-2022 11:08                4417
ds-collection.isempty.php                          30-Sep-2022 11:08                4260
ds-collection.toarray.php                          30-Sep-2022 11:08                4032
ds-deque.allocate.php                              30-Sep-2022 11:08                4606
ds-deque.apply.php                                 30-Sep-2022 11:08                5086
ds-deque.capacity.php                              30-Sep-2022 11:08                3932
ds-deque.clear.php                                 30-Sep-2022 11:08                3853
ds-deque.construct.php                             30-Sep-2022 11:08                4368
ds-deque.contains.php                              30-Sep-2022 11:08                7518
ds-deque.copy.php                                  30-Sep-2022 11:08                4244
ds-deque.count.php                                 30-Sep-2022 11:08                1529
ds-deque.filter.php                                30-Sep-2022 11:08                7539
ds-deque.find.php                                  30-Sep-2022 11:08                5486
ds-deque.first.php                                 30-Sep-2022 11:08                3846
ds-deque.get.php                                   30-Sep-2022 11:08                6702
ds-deque.insert.php                                30-Sep-2022 11:08                7026
ds-deque.isempty.php                               30-Sep-2022 11:08                4107
ds-deque.join.php                                  30-Sep-2022 11:08                5778
ds-deque.jsonserialize.php                         30-Sep-2022 11:08                1811
ds-deque.last.php                                  30-Sep-2022 11:08                3834
ds-deque.map.php                                   30-Sep-2022 11:08                5466
ds-deque.merge.php                                 30-Sep-2022 11:08                4897
ds-deque.pop.php                                   30-Sep-2022 11:08                4331
ds-deque.push.php                                  30-Sep-2022 11:08                4719
ds-deque.reduce.php                                30-Sep-2022 11:08                8706
ds-deque.remove.php                                30-Sep-2022 11:08                4884
ds-deque.reverse.php                               30-Sep-2022 11:08                3689
ds-deque.reversed.php                              30-Sep-2022 11:08                4061
ds-deque.rotate.php                                30-Sep-2022 11:08                5096
ds-deque.set.php                                   30-Sep-2022 11:08                6169
ds-deque.shift.php                                 30-Sep-2022 11:08                4432
ds-deque.slice.php                                 30-Sep-2022 11:08                7244
ds-deque.sort.php                                  30-Sep-2022 11:08                7605
ds-deque.sorted.php                                30-Sep-2022 11:08                7661
ds-deque.sum.php                                   30-Sep-2022 11:08                5173
ds-deque.toarray.php                               30-Sep-2022 11:08                3883
ds-deque.unshift.php                               30-Sep-2022 11:08                4801
ds-hashable.equals.php                             30-Sep-2022 11:08                3385
ds-hashable.hash.php                               30-Sep-2022 11:08                8534
ds-map.allocate.php                                30-Sep-2022 11:08                4472
ds-map.apply.php                                   30-Sep-2022 11:08                5858
ds-map.capacity.php                                30-Sep-2022 11:08                3217
ds-map.clear.php                                   30-Sep-2022 11:08                4409
ds-map.construct.php                               30-Sep-2022 11:08                4900
ds-map.copy.php                                    30-Sep-2022 11:08                4174
ds-map.count.php                                   30-Sep-2022 11:08                1490
ds-map.diff.php                                    30-Sep-2022 11:08                5650
ds-map.filter.php                                  30-Sep-2022 11:08                8404
ds-map.first.php                                   30-Sep-2022 11:08                4134
ds-map.get.php                                     30-Sep-2022 11:08                8717
ds-map.haskey.php                                  30-Sep-2022 11:08                4644
ds-map.hasvalue.php                                30-Sep-2022 11:08                4688
ds-map.intersect.php                               30-Sep-2022 11:08                6173
ds-map.isempty.php                                 30-Sep-2022 11:08                4359
ds-map.jsonserialize.php                           30-Sep-2022 11:08                1789
ds-map.keys.php                                    30-Sep-2022 11:08                4011
ds-map.ksort.php                                   30-Sep-2022 11:08                8337
ds-map.ksorted.php                                 30-Sep-2022 11:08                8455
ds-map.last.php                                    30-Sep-2022 11:08                4119
ds-map.map.php                                     30-Sep-2022 11:08                6506
ds-map.merge.php                                   30-Sep-2022 11:08                5808
ds-map.pairs.php                                   30-Sep-2022 11:08                4402
ds-map.put.php                                     30-Sep-2022 11:08               14888
ds-map.putall.php                                  30-Sep-2022 11:08                5452
ds-map.reduce.php                                  30-Sep-2022 11:08                9756
ds-map.remove.php                                  30-Sep-2022 11:08                7129
ds-map.reverse.php                                 30-Sep-2022 11:08                4171
ds-map.reversed.php                                30-Sep-2022 11:08                4301
ds-map.skip.php                                    30-Sep-2022 11:08                4608
ds-map.slice.php                                   30-Sep-2022 11:08                8145
ds-map.sort.php                                    30-Sep-2022 11:08                8255
ds-map.sorted.php                                  30-Sep-2022 11:08                8434
ds-map.sum.php                                     30-Sep-2022 11:08                5700
ds-map.toarray.php                                 30-Sep-2022 11:08                4842
ds-map.union.php                                   30-Sep-2022 11:08                6157
ds-map.values.php                                  30-Sep-2022 11:08                4005
ds-map.xor.php                                     30-Sep-2022 11:08                5712
ds-pair.clear.php                                  30-Sep-2022 11:08                3749
ds-pair.construct.php                              30-Sep-2022 11:08                2630
ds-pair.copy.php                                   30-Sep-2022 11:08                4163
ds-pair.isempty.php                                30-Sep-2022 11:08                4052
ds-pair.jsonserialize.php                          30-Sep-2022 11:08                1809
ds-pair.toarray.php                                30-Sep-2022 11:08                3808
ds-priorityqueue.allocate.php                      30-Sep-2022 11:08                4772
ds-priorityqueue.capacity.php                      30-Sep-2022 11:08                3426
ds-priorityqueue.clear.php                         30-Sep-2022 11:08                4520
ds-priorityqueue.construct.php                     30-Sep-2022 11:08                2944
ds-priorityqueue.copy.php                          30-Sep-2022 11:08                4547
ds-priorityqueue.count.php                         30-Sep-2022 11:08                1638
ds-priorityqueue.isempty.php                       30-Sep-2022 11:08                5027
ds-priorityqueue.jsonserialize.php                 30-Sep-2022 11:08                1929
ds-priorityqueue.peek.php                          30-Sep-2022 11:08                4834
ds-priorityqueue.pop.php                           30-Sep-2022 11:08                5606
ds-priorityqueue.push.php                          30-Sep-2022 11:08                5601
ds-priorityqueue.toarray.php                       30-Sep-2022 11:08                4994
ds-queue.allocate.php                              30-Sep-2022 11:08                4801
ds-queue.capacity.php                              30-Sep-2022 11:08                3938
ds-queue.clear.php                                 30-Sep-2022 11:08                3838
ds-queue.construct.php                             30-Sep-2022 11:08                4366
ds-queue.copy.php                                  30-Sep-2022 11:08                4381
ds-queue.count.php                                 30-Sep-2022 11:08                1526
ds-queue.isempty.php                               30-Sep-2022 11:08                4123
ds-queue.jsonserialize.php                         30-Sep-2022 11:08                1817
ds-queue.peek.php                                  30-Sep-2022 11:08                4418
ds-queue.pop.php                                   30-Sep-2022 11:08                4952
ds-queue.push.php                                  30-Sep-2022 11:08                4754
ds-queue.toarray.php                               30-Sep-2022 11:08                4045
ds-sequence.allocate.php                           30-Sep-2022 11:08                4508
ds-sequence.apply.php                              30-Sep-2022 11:08                5201
ds-sequence.capacity.php                           30-Sep-2022 11:08                4497
ds-sequence.contains.php                           30-Sep-2022 11:08                7645
ds-sequence.filter.php                             30-Sep-2022 11:08                7678
ds-sequence.find.php                               30-Sep-2022 11:08                5598
ds-sequence.first.php                              30-Sep-2022 11:08                3961
ds-sequence.get.php                                30-Sep-2022 11:08                6830
ds-sequence.insert.php                             30-Sep-2022 11:08                7145
ds-sequence.join.php                               30-Sep-2022 11:08                5874
ds-sequence.last.php                               30-Sep-2022 11:08                3928
ds-sequence.map.php                                30-Sep-2022 11:08                5595
ds-sequence.merge.php                              30-Sep-2022 11:08                5023
ds-sequence.pop.php                                30-Sep-2022 11:08                4443
ds-sequence.push.php                               30-Sep-2022 11:08                4841
ds-sequence.reduce.php                             30-Sep-2022 11:08                8825
ds-sequence.remove.php                             30-Sep-2022 11:08                4996
ds-sequence.reverse.php                            30-Sep-2022 11:08                3802
ds-sequence.reversed.php                           30-Sep-2022 11:08                4184
ds-sequence.rotate.php                             30-Sep-2022 11:08                5233
ds-sequence.set.php                                30-Sep-2022 11:08                6293
ds-sequence.shift.php                              30-Sep-2022 11:08                4544
ds-sequence.slice.php                              30-Sep-2022 11:08                7409
ds-sequence.sort.php                               30-Sep-2022 11:08                7732
ds-sequence.sorted.php                             30-Sep-2022 11:08                7788
ds-sequence.sum.php                                30-Sep-2022 11:08                5298
ds-sequence.unshift.php                            30-Sep-2022 11:08                4912
ds-set.add.php                                     30-Sep-2022 11:08               13070
ds-set.allocate.php                                30-Sep-2022 11:08                4485
ds-set.capacity.php                                30-Sep-2022 11:08                3891
ds-set.clear.php                                   30-Sep-2022 11:08                3784
ds-set.construct.php                               30-Sep-2022 11:08                4320
ds-set.contains.php                                30-Sep-2022 11:08                7474
ds-set.copy.php                                    30-Sep-2022 11:08                4320
ds-set.count.php                                   30-Sep-2022 11:08                1490
ds-set.diff.php                                    30-Sep-2022 11:08                4880
ds-set.filter.php                                  30-Sep-2022 11:08                7487
ds-set.first.php                                   30-Sep-2022 11:08                3799
ds-set.get.php                                     30-Sep-2022 11:08                6646
ds-set.intersect.php                               30-Sep-2022 11:08                5111
ds-set.isempty.php                                 30-Sep-2022 11:08                4065
ds-set.join.php                                    30-Sep-2022 11:08                5724
ds-set.jsonserialize.php                           30-Sep-2022 11:08                1783
ds-set.last.php                                    30-Sep-2022 11:08                3800
ds-set.merge.php                                   30-Sep-2022 11:08                4823
ds-set.reduce.php                                  30-Sep-2022 11:08                8652
ds-set.remove.php                                  30-Sep-2022 11:08                5230
ds-set.reverse.php                                 30-Sep-2022 11:08                3637
ds-set.reversed.php                                30-Sep-2022 11:08                3999
ds-set.slice.php                                   30-Sep-2022 11:08                7158
ds-set.sort.php                                    30-Sep-2022 11:08                7541
ds-set.sorted.php                                  30-Sep-2022 11:08                7597
ds-set.sum.php                                     30-Sep-2022 11:08                5113
ds-set.toarray.php                                 30-Sep-2022 11:08                3829
ds-set.union.php                                   30-Sep-2022 11:08                5074
ds-set.xor.php                                     30-Sep-2022 11:08                5046
ds-stack.allocate.php                              30-Sep-2022 11:08                2709
ds-stack.capacity.php                              30-Sep-2022 11:08                2085
ds-stack.clear.php                                 30-Sep-2022 11:08                3834
ds-stack.construct.php                             30-Sep-2022 11:08                4332
ds-stack.copy.php                                  30-Sep-2022 11:08                4381
ds-stack.count.php                                 30-Sep-2022 11:08                1526
ds-stack.isempty.php                               30-Sep-2022 11:08                4123
ds-stack.jsonserialize.php                         30-Sep-2022 11:08                1817
ds-stack.peek.php                                  30-Sep-2022 11:08                4412
ds-stack.pop.php                                   30-Sep-2022 11:08                4946
ds-stack.push.php                                  30-Sep-2022 11:08                4754
ds-stack.toarray.php                               30-Sep-2022 11:08                3870
ds-vector.allocate.php                             30-Sep-2022 11:08                4425
ds-vector.apply.php                                30-Sep-2022 11:08                5112
ds-vector.capacity.php                             30-Sep-2022 11:08                4402
ds-vector.clear.php                                30-Sep-2022 11:08                3865
ds-vector.construct.php                            30-Sep-2022 11:08                4400
ds-vector.contains.php                             30-Sep-2022 11:08                7548
ds-vector.copy.php                                 30-Sep-2022 11:08                4405
ds-vector.count.php                                30-Sep-2022 11:08                1543
ds-vector.filter.php                               30-Sep-2022 11:08                7573
ds-vector.find.php                                 30-Sep-2022 11:08                5511
ds-vector.first.php                                30-Sep-2022 11:08                3872
ds-vector.get.php                                  30-Sep-2022 11:08                6733
ds-vector.insert.php                               30-Sep-2022 11:08                7056
ds-vector.isempty.php                              30-Sep-2022 11:08                4131
ds-vector.join.php                                 30-Sep-2022 11:08                5805
ds-vector.jsonserialize.php                        30-Sep-2022 11:08                1825
ds-vector.last.php                                 30-Sep-2022 11:08                3859
ds-vector.map.php                                  30-Sep-2022 11:08                5498
ds-vector.merge.php                                30-Sep-2022 11:08                4928
ds-vector.pop.php                                  30-Sep-2022 11:08                4356
ds-vector.push.php                                 30-Sep-2022 11:08                4748
ds-vector.reduce.php                               30-Sep-2022 11:08                8734
ds-vector.remove.php                               30-Sep-2022 11:08                4909
ds-vector.reverse.php                              30-Sep-2022 11:08                3715
ds-vector.reversed.php                             30-Sep-2022 11:08                4091
ds-vector.rotate.php                               30-Sep-2022 11:08                5130
ds-vector.set.php                                  30-Sep-2022 11:08                6200
ds-vector.shift.php                                30-Sep-2022 11:08                4457
ds-vector.slice.php                                30-Sep-2022 11:08                7290
ds-vector.sort.php                                 30-Sep-2022 11:08                7637
ds-vector.sorted.php                               30-Sep-2022 11:08                7693
ds-vector.sum.php                                  30-Sep-2022 11:08                5203
ds-vector.toarray.php                              30-Sep-2022 11:08                3908
ds-vector.unshift.php                              30-Sep-2022 11:08                4831
ds.constants.php                                   30-Sep-2022 11:08                1097
ds.examples.php                                    30-Sep-2022 11:08                4901
ds.installation.php                                30-Sep-2022 11:08                2482
ds.requirements.php                                30-Sep-2022 11:08                1160
ds.setup.php                                       30-Sep-2022 11:08                1364
eio.configuration.php                              30-Sep-2022 11:07                1160
eio.constants.php                                  30-Sep-2022 11:07               16343
eio.examples.php                                   30-Sep-2022 11:07               29622
eio.installation.php                               30-Sep-2022 11:07                1804
eio.requirements.php                               30-Sep-2022 11:07                1347
eio.resources.php                                  30-Sep-2022 11:07                1237
eio.setup.php                                      30-Sep-2022 11:07                1512
emptyiterator.current.php                          30-Sep-2022 11:07                2785
emptyiterator.key.php                              30-Sep-2022 11:07                2749
emptyiterator.next.php                             30-Sep-2022 11:07                2372
emptyiterator.rewind.php                           30-Sep-2022 11:07                2394
emptyiterator.valid.php                            30-Sep-2022 11:07                2396
enchant.configuration.php                          30-Sep-2022 11:07                1190
enchant.constants.php                              30-Sep-2022 11:07                2597
enchant.examples.php                               30-Sep-2022 11:07                5818
enchant.installation.php                           30-Sep-2022 11:07                3684
enchant.requirements.php                           30-Sep-2022 11:07                1872
enchant.resources.php                              30-Sep-2022 11:07                1365
enchant.setup.php                                  30-Sep-2022 11:07                1558
error.clone.php                                    30-Sep-2022 11:07                2878
error.construct.php                                30-Sep-2022 11:07                3298
error.getcode.php                                  30-Sep-2022 11:07                4044
error.getfile.php                                  30-Sep-2022 11:07                3773
error.getline.php                                  30-Sep-2022 11:07                4034
error.getmessage.php                               30-Sep-2022 11:07                3872
error.getprevious.php                              30-Sep-2022 11:07                6945
error.gettrace.php                                 30-Sep-2022 11:07                4277
error.gettraceasstring.php                         30-Sep-2022 11:07                4186
error.tostring.php                                 30-Sep-2022 11:07                3878
errorexception.construct.php                       30-Sep-2022 11:07                5503
errorexception.getseverity.php                     30-Sep-2022 11:07                4375
errorfunc.configuration.php                        30-Sep-2022 11:07               24743
errorfunc.constants.php                            30-Sep-2022 11:07               10004
errorfunc.examples.php                             30-Sep-2022 11:07               23785
errorfunc.installation.php                         30-Sep-2022 11:07                1238
errorfunc.requirements.php                         30-Sep-2022 11:07                1178
errorfunc.resources.php                            30-Sep-2022 11:07                1179
errorfunc.setup.php                                30-Sep-2022 11:07                1574
ev.backend.php                                     30-Sep-2022 11:07                3535
ev.configuration.php                               30-Sep-2022 11:07                1155
ev.depth.php                                       30-Sep-2022 11:07                3353
ev.embeddablebackends.php                          30-Sep-2022 11:07                7027
ev.examples.php                                    30-Sep-2022 11:07               47916
ev.feedsignal.php                                  30-Sep-2022 11:07                3502
ev.feedsignalevent.php                             30-Sep-2022 11:07                3177
ev.global.constants.php                            30-Sep-2022 11:07                1275
ev.installation.php                                30-Sep-2022 11:07                1795
ev.iteration.php                                   30-Sep-2022 11:07                2657
ev.now.php                                         30-Sep-2022 11:07                3044
ev.nowupdate.php                                   30-Sep-2022 11:07                3287
ev.periodic-modes.php                              30-Sep-2022 11:07                8667
ev.recommendedbackends.php                         30-Sep-2022 11:07                7970
ev.requirements.php                                30-Sep-2022 11:07                1271
ev.resources.php                                   30-Sep-2022 11:07                1137
ev.resume.php                                      30-Sep-2022 11:07                3914
ev.run.php                                         30-Sep-2022 11:07                5023
ev.setup.php                                       30-Sep-2022 11:07                1466
ev.sleep.php                                       30-Sep-2022 11:07                2313
ev.stop.php                                        30-Sep-2022 11:07                2865
ev.supportedbackends.php                           30-Sep-2022 11:07                7010
ev.suspend.php                                     30-Sep-2022 11:07                3589
ev.time.php                                        30-Sep-2022 11:07                2604
ev.verify.php                                      30-Sep-2022 11:07                2254
ev.watcher-callbacks.php                           30-Sep-2022 11:07                4677
ev.watchers.php                                    30-Sep-2022 11:07                3944
evcheck.construct.php                              30-Sep-2022 11:07                3747
evcheck.createstopped.php                          30-Sep-2022 11:07                3665
evchild.construct.php                              30-Sep-2022 11:07                6999
evchild.createstopped.php                          30-Sep-2022 11:07                5049
evchild.set.php                                    30-Sep-2022 11:07                3051
evembed.construct.php                              30-Sep-2022 11:07                8830
evembed.createstopped.php                          30-Sep-2022 11:07                4831
evembed.set.php                                    30-Sep-2022 11:07                2497
evembed.sweep.php                                  30-Sep-2022 11:07                3109
event.add.php                                      30-Sep-2022 11:08               11105
event.addsignal.php                                30-Sep-2022 11:08                1673
event.addtimer.php                                 30-Sep-2022 11:08                1682
event.callbacks.php                                30-Sep-2022 11:08                5402
event.configuration.php                            30-Sep-2022 11:08                1176
event.construct.php                                30-Sep-2022 11:08                4734
event.constructing.signal.events.php               30-Sep-2022 11:08                6847
event.del.php                                      30-Sep-2022 11:08                2476
event.delsignal.php                                30-Sep-2022 11:08                1673
event.deltimer.php                                 30-Sep-2022 11:08                1670
event.examples.php                                 30-Sep-2022 11:08              198913
event.flags.php                                    30-Sep-2022 11:08                2314
event.free.php                                     30-Sep-2022 11:08                2929
event.getsupportedmethods.php                      30-Sep-2022 11:08                2595
event.installation.php                             30-Sep-2022 11:08                1822
event.pending.php                                  30-Sep-2022 11:08                2651
event.persistence.php                              30-Sep-2022 11:08                2752
event.requirements.php                             30-Sep-2022 11:08                1433
event.resources.php                                30-Sep-2022 11:08                1135
event.set.php                                      30-Sep-2022 11:08                4507
event.setpriority.php                              30-Sep-2022 11:08                2375
event.settimer.php                                 30-Sep-2022 11:08                4019
event.setup.php                                    30-Sep-2022 11:08                1505
event.signal.php                                   30-Sep-2022 11:08                4224
event.timer.php                                    30-Sep-2022 11:08                3559
eventbase.construct.php                            30-Sep-2022 11:08                2783
eventbase.dispatch.php                             30-Sep-2022 11:08                3220
eventbase.exit.php                                 30-Sep-2022 11:08                2883
eventbase.free.php                                 30-Sep-2022 11:08                3284
eventbase.getfeatures.php                          30-Sep-2022 11:08                5976
eventbase.getmethod.php                            30-Sep-2022 11:08                4614
eventbase.gettimeofdaycached.php                   30-Sep-2022 11:08                2640
eventbase.gotexit.php                              30-Sep-2022 11:08                3212
eventbase.gotstop.php                              30-Sep-2022 11:08                3184
eventbase.loop.php                                 30-Sep-2022 11:08                3442
eventbase.priorityinit.php                         30-Sep-2022 11:08                2860
eventbase.reinit.php                               30-Sep-2022 11:08                2251
eventbase.stop.php                                 30-Sep-2022 11:08                2744
eventbuffer.add.php                                30-Sep-2022 11:08                2859
eventbuffer.addbuffer.php                          30-Sep-2022 11:08                3271
eventbuffer.appendfrom.php                         30-Sep-2022 11:08                4858
eventbuffer.construct.php                          30-Sep-2022 11:08                2145
eventbuffer.copyout.php                            30-Sep-2022 11:08                3798
eventbuffer.drain.php                              30-Sep-2022 11:08                3351
eventbuffer.enablelocking.php                      30-Sep-2022 11:08                2863
eventbuffer.expand.php                             30-Sep-2022 11:08                2648
eventbuffer.freeze.php                             30-Sep-2022 11:08                2908
eventbuffer.lock.php                               30-Sep-2022 11:08                3005
eventbuffer.prepend.php                            30-Sep-2022 11:08                3364
eventbuffer.prependbuffer.php                      30-Sep-2022 11:08                3586
eventbuffer.pullup.php                             30-Sep-2022 11:08                4553
eventbuffer.read.php                               30-Sep-2022 11:08                4825
eventbuffer.readfrom.php                           30-Sep-2022 11:08                4305
eventbuffer.readline.php                           30-Sep-2022 11:08                4129
eventbuffer.search.php                             30-Sep-2022 11:08                8693
eventbuffer.searcheol.php                          30-Sep-2022 11:08                4624
eventbuffer.substr.php                             30-Sep-2022 11:08                3291
eventbuffer.unfreeze.php                           30-Sep-2022 11:08                2922
eventbuffer.unlock.php                             30-Sep-2022 11:08                2704
eventbuffer.write.php                              30-Sep-2022 11:08                3358
eventbufferevent.about.callbacks.php               30-Sep-2022 11:08                5612
eventbufferevent.close.php                         30-Sep-2022 11:08                2457
eventbufferevent.connect.php                       30-Sep-2022 11:08               27046
eventbufferevent.connecthost.php                   30-Sep-2022 11:08               18508
eventbufferevent.construct.php                     30-Sep-2022 11:08                6878
eventbufferevent.createpair.php                    30-Sep-2022 11:08                4031
eventbufferevent.disable.php                       30-Sep-2022 11:08                3158
eventbufferevent.enable.php                        30-Sep-2022 11:08                3422
eventbufferevent.free.php                          30-Sep-2022 11:08                2764
eventbufferevent.getdnserrorstring.php             30-Sep-2022 11:08                3063
eventbufferevent.getenabled.php                    30-Sep-2022 11:08                3029
eventbufferevent.getinput.php                      30-Sep-2022 11:08                5188
eventbufferevent.getoutput.php                     30-Sep-2022 11:08                8344
eventbufferevent.read.php                          30-Sep-2022 11:08                2959
eventbufferevent.readbuffer.php                    30-Sep-2022 11:08                3108
eventbufferevent.setcallbacks.php                  30-Sep-2022 11:08                4595
eventbufferevent.setpriority.php                   30-Sep-2022 11:08                2757
eventbufferevent.settimeouts.php                   30-Sep-2022 11:08                2928
eventbufferevent.setwatermark.php                  30-Sep-2022 11:08                3814
eventbufferevent.sslerror.php                      30-Sep-2022 11:08                6330
eventbufferevent.sslfilter.php                     30-Sep-2022 11:08               41004
eventbufferevent.sslgetcipherinfo.php              30-Sep-2022 11:08                2832
eventbufferevent.sslgetciphername.php              30-Sep-2022 11:08                2718
eventbufferevent.sslgetcipherversion.php           30-Sep-2022 11:08                2747
eventbufferevent.sslgetprotocol.php                30-Sep-2022 11:08                2676
eventbufferevent.sslrenegotiate.php                30-Sep-2022 11:08                2799
eventbufferevent.sslsocket.php                     30-Sep-2022 11:08                5497
eventbufferevent.write.php                         30-Sep-2022 11:08                3044
eventbufferevent.writebuffer.php                   30-Sep-2022 11:08                3226
eventconfig.avoidmethod.php                        30-Sep-2022 11:08                4270
eventconfig.construct.php                          30-Sep-2022 11:08                4508
eventconfig.requirefeatures.php                    30-Sep-2022 11:08                6088
eventconfig.setflags.php                           30-Sep-2022 11:08                3163
eventconfig.setmaxdispatchinterval.php             30-Sep-2022 11:08                4282
eventdnsbase.addnameserverip.php                   30-Sep-2022 11:08                2782
eventdnsbase.addsearch.php                         30-Sep-2022 11:08                2463
eventdnsbase.clearsearch.php                       30-Sep-2022 11:08                2794
eventdnsbase.construct.php                         30-Sep-2022 11:08                3214
eventdnsbase.countnameservers.php                  30-Sep-2022 11:08                2483
eventdnsbase.loadhosts.php                         30-Sep-2022 11:08                2655
eventdnsbase.parseresolvconf.php                   30-Sep-2022 11:08                4073
eventdnsbase.setoption.php                         30-Sep-2022 11:08                3173
eventdnsbase.setsearchndots.php                    30-Sep-2022 11:08                2719
eventhttp.accept.php                               30-Sep-2022 11:08               13273
eventhttp.addserveralias.php                       30-Sep-2022 11:08                6467
eventhttp.bind.php                                 30-Sep-2022 11:08                7873
eventhttp.construct.php                            30-Sep-2022 11:08               19938
eventhttp.removeserveralias.php                    30-Sep-2022 11:08                3054
eventhttp.setallowedmethods.php                    30-Sep-2022 11:08                3304
eventhttp.setcallback.php                          30-Sep-2022 11:08               19779
eventhttp.setdefaultcallback.php                   30-Sep-2022 11:08                7833
eventhttp.setmaxbodysize.php                       30-Sep-2022 11:08                2828
eventhttp.setmaxheaderssize.php                    30-Sep-2022 11:08                2740
eventhttp.settimeout.php                           30-Sep-2022 11:08                2418
eventhttpconnection.construct.php                  30-Sep-2022 11:08                5209
eventhttpconnection.getbase.php                    30-Sep-2022 11:08                2564
eventhttpconnection.getpeer.php                    30-Sep-2022 11:08                2878
eventhttpconnection.makerequest.php                30-Sep-2022 11:08               12575
eventhttpconnection.setclosecallback.php           30-Sep-2022 11:08               11788
eventhttpconnection.setlocaladdress.php            30-Sep-2022 11:08                3125
eventhttpconnection.setlocalport.php               30-Sep-2022 11:08                3015
eventhttpconnection.setmaxbodysize.php             30-Sep-2022 11:08                3050
eventhttpconnection.setmaxheaderssize.php          30-Sep-2022 11:08                3071
eventhttpconnection.setretries.php                 30-Sep-2022 11:08                2648
eventhttpconnection.settimeout.php                 30-Sep-2022 11:08                2545
eventhttprequest.addheader.php                     30-Sep-2022 11:08                3666
eventhttprequest.cancel.php                        30-Sep-2022 11:08                2818
eventhttprequest.clearheaders.php                  30-Sep-2022 11:08                2779
eventhttprequest.closeconnection.php               30-Sep-2022 11:08                2373
eventhttprequest.construct.php                     30-Sep-2022 11:08               12689
eventhttprequest.findheader.php                    30-Sep-2022 11:08                3348
eventhttprequest.free.php                          30-Sep-2022 11:08                2281
eventhttprequest.getbufferevent.php                30-Sep-2022 11:08                3684
eventhttprequest.getcommand.php                    30-Sep-2022 11:08                2655
eventhttprequest.getconnection.php                 30-Sep-2022 11:08                4453
eventhttprequest.gethost.php                       30-Sep-2022 11:08                2821
eventhttprequest.getinputbuffer.php                30-Sep-2022 11:08                2768
eventhttprequest.getinputheaders.php               30-Sep-2022 11:08                2801
eventhttprequest.getoutputbuffer.php               30-Sep-2022 11:08                2827
eventhttprequest.getoutputheaders.php              30-Sep-2022 11:08                2785
eventhttprequest.getresponsecode.php               30-Sep-2022 11:08                3118
eventhttprequest.geturi.php                        30-Sep-2022 11:08                3029
eventhttprequest.removeheader.php                  30-Sep-2022 11:08                3359
eventhttprequest.senderror.php                     30-Sep-2022 11:08                5671
eventhttprequest.sendreply.php                     30-Sep-2022 11:08                3926
eventhttprequest.sendreplychunk.php                30-Sep-2022 11:08                3408
eventhttprequest.sendreplyend.php                  30-Sep-2022 11:08                3027
eventhttprequest.sendreplystart.php                30-Sep-2022 11:08                4181
eventlistener.construct.php                        30-Sep-2022 11:08               27640
eventlistener.disable.php                          30-Sep-2022 11:08                2680
eventlistener.enable.php                           30-Sep-2022 11:08                2666
eventlistener.getbase.php                          30-Sep-2022 11:08                2294
eventlistener.getsocketname.php                    30-Sep-2022 11:08                3195
eventlistener.setcallback.php                      30-Sep-2022 11:08                5705
eventlistener.seterrorcallback.php                 30-Sep-2022 11:08                4227
eventsslcontext.construct.php                      30-Sep-2022 11:08                5801
eventutil.construct.php                            30-Sep-2022 11:08                2334
eventutil.getlastsocketerrno.php                   30-Sep-2022 11:08                3221
eventutil.getlastsocketerror.php                   30-Sep-2022 11:08                3086
eventutil.getsocketfd.php                          30-Sep-2022 11:08                3129
eventutil.getsocketname.php                        30-Sep-2022 11:08                3643
eventutil.setsocketoption.php                      30-Sep-2022 11:08                5502
eventutil.sslrandpoll.php                          30-Sep-2022 11:08                2323
evfork.construct.php                               30-Sep-2022 11:07                3715
evfork.createstopped.php                           30-Sep-2022 11:07                3860
evidle.construct.php                               30-Sep-2022 11:07                3662
evidle.createstopped.php                           30-Sep-2022 11:07                4014
evio.construct.php                                 30-Sep-2022 11:07                4710
evio.createstopped.php                             30-Sep-2022 11:07                5080
evio.set.php                                       30-Sep-2022 11:07                2775
evloop.backend.php                                 30-Sep-2022 11:07                2659
evloop.check.php                                   30-Sep-2022 11:07                3116
evloop.child.php                                   30-Sep-2022 11:07                3478
evloop.construct.php                               30-Sep-2022 11:07                3902
evloop.defaultloop.php                             30-Sep-2022 11:07                4493
evloop.embed.php                                   30-Sep-2022 11:07                3571
evloop.fork.php                                    30-Sep-2022 11:07                3310
evloop.idle.php                                    30-Sep-2022 11:07                3314
evloop.invokepending.php                           30-Sep-2022 11:07                2188
evloop.io.php                                      30-Sep-2022 11:07                3733
evloop.loopfork.php                                30-Sep-2022 11:07                2488
evloop.now.php                                     30-Sep-2022 11:07                2775
evloop.nowupdate.php                               30-Sep-2022 11:07                3132
evloop.periodic.php                                30-Sep-2022 11:07                3772
evloop.prepare.php                                 30-Sep-2022 11:07                3332
evloop.resume.php                                  30-Sep-2022 11:07                2826
evloop.run.php                                     30-Sep-2022 11:07                4756
evloop.signal.php                                  30-Sep-2022 11:07                3559
evloop.stat.php                                    30-Sep-2022 11:07                3680
evloop.stop.php                                    30-Sep-2022 11:07                2927
evloop.suspend.php                                 30-Sep-2022 11:07                2813
evloop.timer.php                                   30-Sep-2022 11:07                3699
evloop.verify.php                                  30-Sep-2022 11:07                2564
evperiodic.again.php                               30-Sep-2022 11:07                2531
evperiodic.at.php                                  30-Sep-2022 11:07                2562
evperiodic.construct.php                           30-Sep-2022 11:07               10134
evperiodic.createstopped.php                       30-Sep-2022 11:07                5636
evperiodic.set.php                                 30-Sep-2022 11:07                3033
evprepare.construct.php                            30-Sep-2022 11:07                3544
evprepare.createstopped.php                        30-Sep-2022 11:07                4462
evsignal.construct.php                             30-Sep-2022 11:07                5468
evsignal.createstopped.php                         30-Sep-2022 11:07                4734
evsignal.set.php                                   30-Sep-2022 11:07                2387
evstat.attr.php                                    30-Sep-2022 11:07                8656
evstat.construct.php                               30-Sep-2022 11:07                7396
evstat.createstopped.php                           30-Sep-2022 11:07                5030
evstat.prev.php                                    30-Sep-2022 11:07                2914
evstat.set.php                                     30-Sep-2022 11:07                2708
evstat.stat.php                                    30-Sep-2022 11:07                2834
evtimer.again.php                                  30-Sep-2022 11:07                3026
evtimer.construct.php                              30-Sep-2022 11:07               13508
evtimer.createstopped.php                          30-Sep-2022 11:07                8479
evtimer.set.php                                    30-Sep-2022 11:07                2850
evwatcher.clear.php                                30-Sep-2022 11:07                2751
evwatcher.construct.php                            30-Sep-2022 11:07                2093
evwatcher.feed.php                                 30-Sep-2022 11:07                2500
evwatcher.getloop.php                              30-Sep-2022 11:07                2293
evwatcher.invoke.php                               30-Sep-2022 11:07                2507
evwatcher.keepalive.php                            30-Sep-2022 11:07                5100
evwatcher.setcallback.php                          30-Sep-2022 11:07                2520
evwatcher.start.php                                30-Sep-2022 11:07                2473
evwatcher.stop.php                                 30-Sep-2022 11:07                2442
example.xml-external-entity.php                    30-Sep-2022 11:08               26365
example.xml-map-tags.php                           30-Sep-2022 11:08                9213
example.xml-structure.php                          30-Sep-2022 11:08                7021
example.xmlwriter-namespace.php                    30-Sep-2022 11:08                5499
example.xmlwriter-oop.php                          30-Sep-2022 11:08                3448
example.xmlwriter-simple.php                       30-Sep-2022 11:08                8909
exception.clone.php                                30-Sep-2022 11:07                2914
exception.construct.php                            30-Sep-2022 11:07                3660
exception.getcode.php                              30-Sep-2022 11:07                4451
exception.getfile.php                              30-Sep-2022 11:07                3886
exception.getline.php                              30-Sep-2022 11:07                4137
exception.getmessage.php                           30-Sep-2022 11:07                3967
exception.getprevious.php                          30-Sep-2022 11:07                7192
exception.gettrace.php                             30-Sep-2022 11:07                4363
exception.gettraceasstring.php                     30-Sep-2022 11:07                4287
exception.tostring.php                             30-Sep-2022 11:07                3988
exec.configuration.php                             30-Sep-2022 11:07                1169
exec.constants.php                                 30-Sep-2022 11:07                1127
exec.installation.php                              30-Sep-2022 11:07                1203
exec.requirements.php                              30-Sep-2022 11:07                1143
exec.resources.php                                 30-Sep-2022 11:07                1343
exec.setup.php                                     30-Sep-2022 11:07                1532
exif.configuration.php                             30-Sep-2022 11:07                7586
exif.constants.php                                 30-Sep-2022 11:07                1978
exif.installation.php                              30-Sep-2022 11:07                1811
exif.requirements.php                              30-Sep-2022 11:07                1998
exif.resources.php                                 30-Sep-2022 11:07                1144
exif.setup.php                                     30-Sep-2022 11:07                1526
expect.configuration.php                           30-Sep-2022 11:07                5352
expect.constants.php                               30-Sep-2022 11:07                3358
expect.examples-usage.php                          30-Sep-2022 11:07               17248
expect.examples.php                                30-Sep-2022 11:07                1326
expect.installation.php                            30-Sep-2022 11:07                2540
expect.requirements.php                            30-Sep-2022 11:07                1327
expect.resources.php                               30-Sep-2022 11:07                1424
expect.setup.php                                   30-Sep-2022 11:07                1551
ext-weakmap.construct.php                          30-Sep-2022 11:07                1891
extensions.alphabetical.php                        30-Sep-2022 11:08               20722
extensions.membership.php                          30-Sep-2022 11:08               20586
extensions.php                                     30-Sep-2022 11:08                1672
extensions.state.php                               30-Sep-2022 11:08                2718
fann.configuration.php                             30-Sep-2022 11:07                1169
fann.constants.php                                 30-Sep-2022 11:07               17673
fann.examples-1.php                                30-Sep-2022 11:07                9018
fann.examples.php                                  30-Sep-2022 11:07                1284
fann.installation.php                              30-Sep-2022 11:07                5014
fann.requirements.php                              30-Sep-2022 11:07                1141
fann.resources.php                                 30-Sep-2022 11:07                1100
fann.setup.php                                     30-Sep-2022 11:07                1496
fannconnection.construct.php                       30-Sep-2022 11:07                2810
fannconnection.getfromneuron.php                   30-Sep-2022 11:07                2288
fannconnection.gettoneuron.php                     30-Sep-2022 11:07                2276
fannconnection.getweight.php                       30-Sep-2022 11:07                2244
fannconnection.setweight.php                       30-Sep-2022 11:07                2819
faq.build.php                                      30-Sep-2022 11:08               27019
faq.com.php                                        30-Sep-2022 11:08               13899
faq.databases.php                                  30-Sep-2022 11:08                9306
faq.general.php                                    30-Sep-2022 11:08                5402
faq.html.php                                       30-Sep-2022 11:08               22624
faq.installation.php                               30-Sep-2022 11:08               29426
faq.mailinglist.php                                30-Sep-2022 11:08               12949
faq.misc.php                                       30-Sep-2022 11:08                5054
faq.obtaining.php                                  30-Sep-2022 11:08               11815
faq.passwords.php                                  30-Sep-2022 11:08               11477
faq.php                                            30-Sep-2022 11:08                2065
faq.using.php                                      30-Sep-2022 11:08               23702
fdf.configuration.php                              30-Sep-2022 11:07                1162
fdf.constants.php                                  30-Sep-2022 11:07                6373
fdf.examples.php                                   30-Sep-2022 11:07                6498
fdf.installation.php                               30-Sep-2022 11:07                3929
fdf.requirements.php                               30-Sep-2022 11:07                1568
fdf.resources.php                                  30-Sep-2022 11:07                1757
fdf.setup.php                                      30-Sep-2022 11:07                1505
features.commandline.differences.php               30-Sep-2022 11:07               12954
features.commandline.ini.php                       30-Sep-2022 11:07                2297
features.commandline.interactive.php               30-Sep-2022 11:07                9865
features.commandline.introduction.php              30-Sep-2022 11:07                7063
features.commandline.io-streams.php                30-Sep-2022 11:07                6328
features.commandline.options.php                   30-Sep-2022 11:07               28380
features.commandline.php                           30-Sep-2022 11:07                2027
features.commandline.usage.php                     30-Sep-2022 11:07               16575
features.commandline.webserver.php                 30-Sep-2022 11:07               14599
features.connection-handling.php                   30-Sep-2022 11:07                6533
features.cookies.php                               30-Sep-2022 11:07                3233
features.dtrace.dtrace.php                         30-Sep-2022 11:07               15528
features.dtrace.introduction.php                   30-Sep-2022 11:07                4165
features.dtrace.php                                30-Sep-2022 11:07                1646
features.dtrace.systemtap.php                      30-Sep-2022 11:07                8410
features.file-upload.common-pitfalls.php           30-Sep-2022 11:07                5766
features.file-upload.errors.php                    30-Sep-2022 11:07                4246
features.file-upload.errors.seealso.php            30-Sep-2022 11:07                1367
features.file-upload.multiple.php                  30-Sep-2022 11:07                7372
features.file-upload.php                           30-Sep-2022 11:07                1929
features.file-upload.post-method.php               30-Sep-2022 11:07               18573
features.file-upload.put-method.php                30-Sep-2022 11:07                6615
features.gc.collecting-cycles.php                  30-Sep-2022 11:07                9707
features.gc.performance-considerations.php         30-Sep-2022 11:07               15687
features.gc.php                                    30-Sep-2022 11:07                1772
features.gc.refcounting-basics.php                 30-Sep-2022 11:07               23028
features.http-auth.php                             30-Sep-2022 11:07               25966
features.persistent-connections.php                30-Sep-2022 11:07               10214
features.php                                       30-Sep-2022 11:07                4230
features.remote-files.php                          30-Sep-2022 11:07                8793
features.session.security.management.php           30-Sep-2022 11:08               30778
features.sessions.php                              30-Sep-2022 11:07                1559
features.xforms.php                                30-Sep-2022 11:07                5883
ffi-ctype.getalignment.php                         30-Sep-2022 11:07                2306
ffi-ctype.getarrayelementtype.php                  30-Sep-2022 11:07                2450
ffi-ctype.getarraylength.php                       30-Sep-2022 11:07                2349
ffi-ctype.getattributes.php                        30-Sep-2022 11:07                2325
ffi-ctype.getenumkind.php                          30-Sep-2022 11:07                2301
ffi-ctype.getfuncabi.php                           30-Sep-2022 11:07                2309
ffi-ctype.getfuncparametercount.php                30-Sep-2022 11:07                2415
ffi-ctype.getfuncparametertype.php                 30-Sep-2022 11:07                2643
ffi-ctype.getfuncreturntype.php                    30-Sep-2022 11:07                2432
ffi-ctype.getkind.php                              30-Sep-2022 11:07                2263
ffi-ctype.getname.php                              30-Sep-2022 11:07                2267
ffi-ctype.getpointertype.php                       30-Sep-2022 11:07                2376
ffi-ctype.getsize.php                              30-Sep-2022 11:07                2281
ffi-ctype.getstructfieldnames.php                  30-Sep-2022 11:07                2391
ffi-ctype.getstructfieldoffset.php                 30-Sep-2022 11:07                2579
ffi-ctype.getstructfieldtype.php                   30-Sep-2022 11:07                2599
ffi.addr.php                                       30-Sep-2022 11:07                2744
ffi.alignof.php                                    30-Sep-2022 11:07                2816
ffi.arraytype.php                                  30-Sep-2022 11:07                4435
ffi.cast.php                                       30-Sep-2022 11:07                4881
ffi.cdef.php                                       30-Sep-2022 11:07                4124
ffi.configuration.php                              30-Sep-2022 11:07                4068
ffi.constants.php                                  30-Sep-2022 11:07                1080
ffi.examples-basic.php                             30-Sep-2022 11:07               17219
ffi.examples-callback.php                          30-Sep-2022 11:07                5057
ffi.examples-complete.php                          30-Sep-2022 11:07                5816
ffi.examples.php                                   30-Sep-2022 11:07                1441
ffi.free.php                                       30-Sep-2022 11:07                2359
ffi.installation.php                               30-Sep-2022 11:07                1395
ffi.isnull.php                                     30-Sep-2022 11:07                2345
ffi.load.php                                       30-Sep-2022 11:07                4133
ffi.memcmp.php                                     30-Sep-2022 11:07                3735
ffi.memcpy.php                                     30-Sep-2022 11:07                3101
ffi.memset.php                                     30-Sep-2022 11:07                2943
ffi.new.php                                        30-Sep-2022 11:07                5266
ffi.requirements.php                               30-Sep-2022 11:07                1237
ffi.resources.php                                  30-Sep-2022 11:07                1137
ffi.scope.php                                      30-Sep-2022 11:07                3045
ffi.setup.php                                      30-Sep-2022 11:07                1494
ffi.sizeof.php                                     30-Sep-2022 11:07                2657
ffi.string.php                                     30-Sep-2022 11:07                3633
ffi.type.php                                       30-Sep-2022 11:07                3509
ffi.typeof.php                                     30-Sep-2022 11:07                2808
fiber.construct.php                                30-Sep-2022 11:07                2400
fiber.getcurrent.php                               30-Sep-2022 11:07                2460
fiber.getreturn.php                                30-Sep-2022 11:07                2709
fiber.isrunning.php                                30-Sep-2022 11:07                2729
fiber.isstarted.php                                30-Sep-2022 11:07                2223
fiber.issuspended.php                              30-Sep-2022 11:07                2227
fiber.isterminated.php                             30-Sep-2022 11:07                2320
fiber.resume.php                                   30-Sep-2022 11:07                3545
fiber.start.php                                    30-Sep-2022 11:07                3235
fiber.suspend.php                                  30-Sep-2022 11:07                4543
fiber.throw.php                                    30-Sep-2022 11:07                3446
fibererror.construct.php                           30-Sep-2022 11:07                2244
fileinfo.configuration.php                         30-Sep-2022 11:07                1197
fileinfo.constants.php                             30-Sep-2022 11:07                5145
fileinfo.installation.php                          30-Sep-2022 11:07                1836
fileinfo.requirements.php                          30-Sep-2022 11:07                1171
fileinfo.resources.php                             30-Sep-2022 11:07                1422
fileinfo.setup.php                                 30-Sep-2022 11:07                1570
filesystem.configuration.php                       30-Sep-2022 11:07                7476
filesystem.constants.php                           30-Sep-2022 11:07                9079
filesystem.installation.php                        30-Sep-2022 11:07                1245
filesystem.requirements.php                        30-Sep-2022 11:07                1185
filesystem.resources.php                           30-Sep-2022 11:07                1419
filesystem.setup.php                               30-Sep-2022 11:07                1611
filesystemiterator.construct.php                   30-Sep-2022 11:07                7285
filesystemiterator.current.php                     30-Sep-2022 11:07                5487
filesystemiterator.getflags.php                    30-Sep-2022 11:07                3220
filesystemiterator.key.php                         30-Sep-2022 11:07                5372
filesystemiterator.next.php                        30-Sep-2022 11:07                4590
filesystemiterator.rewind.php                      30-Sep-2022 11:07                5149
filesystemiterator.setflags.php                    30-Sep-2022 11:07                6763
filter.configuration.php                           30-Sep-2022 11:08                5214
filter.constants.php                               30-Sep-2022 11:08               19061
filter.examples.php                                30-Sep-2022 11:08                1377
filter.examples.sanitization.php                   30-Sep-2022 11:08                6022
filter.examples.validation.php                     30-Sep-2022 11:08               11214
filter.filters.flags.php                           30-Sep-2022 11:08               12159
filter.filters.misc.php                            30-Sep-2022 11:08                1934
filter.filters.php                                 30-Sep-2022 11:08                1586
filter.filters.sanitize.php                        30-Sep-2022 11:08               11505
filter.filters.validate.php                        30-Sep-2022 11:08               12569
filter.installation.php                            30-Sep-2022 11:08                1357
filter.requirements.php                            30-Sep-2022 11:08                1157
filter.resources.php                               30-Sep-2022 11:08                1156
filter.setup.php                                   30-Sep-2022 11:08                1537
filteriterator.accept.php                          30-Sep-2022 11:07                5502
filteriterator.construct.php                       30-Sep-2022 11:07                3132
filteriterator.current.php                         30-Sep-2022 11:07                3124
filteriterator.getinneriterator.php                30-Sep-2022 11:07                2580
filteriterator.key.php                             30-Sep-2022 11:07                3064
filteriterator.next.php                            30-Sep-2022 11:07                2982
filteriterator.rewind.php                          30-Sep-2022 11:07                3186
filteriterator.valid.php                           30-Sep-2022 11:07                2564
filters.compression.php                            30-Sep-2022 11:08               17388
filters.convert.php                                30-Sep-2022 11:08               12799
filters.encryption.php                             30-Sep-2022 11:08               46370
filters.php                                        30-Sep-2022 11:08                3778
filters.string.php                                 30-Sep-2022 11:08               10908
finfo.buffer.php                                   30-Sep-2022 11:07                2465
finfo.construct.php                                30-Sep-2022 11:07                2811
finfo.file.php                                     30-Sep-2022 11:07                2456
finfo.set-flags.php                                30-Sep-2022 11:07                1975
fpm.observability.php                              30-Sep-2022 11:08                1422
fpm.setup.php                                      30-Sep-2022 11:08                1297
fpm.status.php                                     30-Sep-2022 11:08               11338
ftp.configuration.php                              30-Sep-2022 11:08                1162
ftp.constants.php                                  30-Sep-2022 11:08                4218
ftp.examples-basic.php                             30-Sep-2022 11:08                5277
ftp.examples.php                                   30-Sep-2022 11:08                1300
ftp.installation.php                               30-Sep-2022 11:08                1580
ftp.requirements.php                               30-Sep-2022 11:08                1136
ftp.resources.php                                  30-Sep-2022 11:08                1534
ftp.setup.php                                      30-Sep-2022 11:08                1506
funchand.configuration.php                         30-Sep-2022 11:08                1197
funchand.constants.php                             30-Sep-2022 11:08                1135
funchand.installation.php                          30-Sep-2022 11:08                1231
funchand.requirements.php                          30-Sep-2022 11:08                1171
funchand.resources.php                             30-Sep-2022 11:08                1172
funchand.setup.php                                 30-Sep-2022 11:08                1552
funcref.php                                        30-Sep-2022 11:08               14142
function.abs.php                                   30-Sep-2022 11:07                5110
function.acos.php                                  30-Sep-2022 11:07                3516
function.acosh.php                                 30-Sep-2022 11:07                3405
function.addcslashes.php                           30-Sep-2022 11:08                8491
function.addslashes.php                            30-Sep-2022 11:08                6763
function.apache-child-terminate.php                30-Sep-2022 11:08                3522
function.apache-get-modules.php                    30-Sep-2022 11:08                3357
function.apache-get-version.php                    30-Sep-2022 11:08                3818
function.apache-getenv.php                         30-Sep-2022 11:08                4991
function.apache-lookup-uri.php                     30-Sep-2022 11:08                6033
function.apache-note.php                           30-Sep-2022 11:08                7139
function.apache-request-headers.php                30-Sep-2022 11:08                5899
function.apache-response-headers.php               30-Sep-2022 11:08                4394
function.apache-setenv.php                         30-Sep-2022 11:08                5453
function.apcu-add.php                              30-Sep-2022 11:07                8675
function.apcu-cache-info.php                       30-Sep-2022 11:07                6786
function.apcu-cas.php                              30-Sep-2022 11:07                8905
function.apcu-clear-cache.php                      30-Sep-2022 11:07                2546
function.apcu-dec.php                              30-Sep-2022 11:07                8006
function.apcu-delete.php                           30-Sep-2022 11:07                5982
function.apcu-enabled.php                          30-Sep-2022 11:07                2240
function.apcu-entry.php                            30-Sep-2022 11:07                9343
function.apcu-exists.php                           30-Sep-2022 11:07                7109
function.apcu-fetch.php                            30-Sep-2022 11:07                5876
function.apcu-inc.php                              30-Sep-2022 11:07                7997
function.apcu-key-info.php                         30-Sep-2022 11:07                4866
function.apcu-sma-info.php                         30-Sep-2022 11:07                4389
function.apcu-store.php                            30-Sep-2022 11:07                7403
function.array-change-key-case.php                 30-Sep-2022 11:08                5563
function.array-chunk.php                           30-Sep-2022 11:08                7440
function.array-column.php                          30-Sep-2022 11:08               18479
function.array-combine.php                         30-Sep-2022 11:08                7081
function.array-count-values.php                    30-Sep-2022 11:08                5561
function.array-diff-assoc.php                      30-Sep-2022 11:08               11438
function.array-diff-key.php                        30-Sep-2022 11:08               13310
function.array-diff-uassoc.php                     30-Sep-2022 11:08               12265
function.array-diff-ukey.php                       30-Sep-2022 11:08               12337
function.array-diff.php                            30-Sep-2022 11:08               12709
function.array-fill-keys.php                       30-Sep-2022 11:08                5315
function.array-fill.php                            30-Sep-2022 11:08                9501
function.array-filter.php                          30-Sep-2022 11:08               17278
function.array-flip.php                            30-Sep-2022 11:08                7058
function.array-intersect-assoc.php                 30-Sep-2022 11:08                9193
function.array-intersect-key.php                   30-Sep-2022 11:08               10542
function.array-intersect-uassoc.php                30-Sep-2022 11:08                8689
function.array-intersect-ukey.php                  30-Sep-2022 11:08               12116
function.array-intersect.php                       30-Sep-2022 11:08                7050
function.array-is-list.php                         30-Sep-2022 11:08                7020
function.array-key-exists.php                      30-Sep-2022 11:08                8829
function.array-key-first.php                       30-Sep-2022 11:08                7435
function.array-key-last.php                        30-Sep-2022 11:08                3190
function.array-keys.php                            30-Sep-2022 11:08                8467
function.array-map.php                             30-Sep-2022 11:08               28736
function.array-merge-recursive.php                 30-Sep-2022 11:08                7054
function.array-merge.php                           30-Sep-2022 11:08               12877
function.array-multisort.php                       30-Sep-2022 11:08               24332
function.array-pad.php                             30-Sep-2022 11:08                7161
function.array-pop.php                             30-Sep-2022 11:08                5714
function.array-product.php                         30-Sep-2022 11:08                4257
function.array-push.php                            30-Sep-2022 11:08                7375
function.array-rand.php                            30-Sep-2022 11:08                7671
function.array-reduce.php                          30-Sep-2022 11:08               10456
function.array-replace-recursive.php               30-Sep-2022 11:08               11474
function.array-replace.php                         30-Sep-2022 11:08                6863
function.array-reverse.php                         30-Sep-2022 11:08                5878
function.array-search.php                          30-Sep-2022 11:08                8440
function.array-shift.php                           30-Sep-2022 11:08                5796
function.array-slice.php                           30-Sep-2022 11:08               13904
function.array-splice.php                          30-Sep-2022 11:08               18134
function.array-sum.php                             30-Sep-2022 11:08                5051
function.array-udiff-assoc.php                     30-Sep-2022 11:08               14980
function.array-udiff-uassoc.php                    30-Sep-2022 11:08               16634
function.array-udiff.php                           30-Sep-2022 11:08               29620
function.array-uintersect-assoc.php                30-Sep-2022 11:08                8248
function.array-uintersect-uassoc.php               30-Sep-2022 11:08                8589
function.array-uintersect.php                      30-Sep-2022 11:08                7788
function.array-unique.php                          30-Sep-2022 11:08                9636
function.array-unshift.php                         30-Sep-2022 11:08                6324
function.array-values.php                          30-Sep-2022 11:08                4538
function.array-walk-recursive.php                  30-Sep-2022 11:08                7644
function.array-walk.php                            30-Sep-2022 11:08               14617
function.array.php                                 30-Sep-2022 11:08               12714
function.arsort.php                                30-Sep-2022 11:08                8435
function.asin.php                                  30-Sep-2022 11:07                3508
function.asinh.php                                 30-Sep-2022 11:07                3395
function.asort.php                                 30-Sep-2022 11:08                8435
function.assert-options.php                        30-Sep-2022 11:07               12167
function.assert.php                                30-Sep-2022 11:07               28021
function.atan.php                                  30-Sep-2022 11:07                3551
function.atan2.php                                 30-Sep-2022 11:07                3358
function.atanh.php                                 30-Sep-2022 11:07                3454
function.autoload.php                              30-Sep-2022 11:08                3187
function.base-convert.php                          30-Sep-2022 11:07                6549
function.base64-decode.php                         30-Sep-2022 11:08                5033
function.base64-encode.php                         30-Sep-2022 11:08                4861
function.basename.php                              30-Sep-2022 11:07                7701
function.bcadd.php                                 30-Sep-2022 11:07                5681
function.bccomp.php                                30-Sep-2022 11:07                5580
function.bcdiv.php                                 30-Sep-2022 11:07                5152
function.bcmod.php                                 30-Sep-2022 11:07                7402
function.bcmul.php                                 30-Sep-2022 11:07                7248
function.bcpow.php                                 30-Sep-2022 11:07                7321
function.bcpowmod.php                              30-Sep-2022 11:07                7281
function.bcscale.php                               30-Sep-2022 11:07                5561
function.bcsqrt.php                                30-Sep-2022 11:07                4768
function.bcsub.php                                 30-Sep-2022 11:07                5126
function.bin2hex.php                               30-Sep-2022 11:08                4424
function.bind-textdomain-codeset.php               30-Sep-2022 11:07                4512
function.bindec.php                                30-Sep-2022 11:07               15868
function.bindtextdomain.php                        30-Sep-2022 11:07                5423
function.boolval.php                               30-Sep-2022 11:08               10676
function.bzclose.php                               30-Sep-2022 11:07                2963
function.bzcompress.php                            30-Sep-2022 11:07                4995
function.bzdecompress.php                          30-Sep-2022 11:07                6349
function.bzerrno.php                               30-Sep-2022 11:07                3121
function.bzerror.php                               30-Sep-2022 11:07                4354
function.bzerrstr.php                              30-Sep-2022 11:07                3138
function.bzflush.php                               30-Sep-2022 11:07                3365
function.bzopen.php                                30-Sep-2022 11:07                5090
function.bzread.php                                30-Sep-2022 11:07                6702
function.bzwrite.php                               30-Sep-2022 11:07                6234
function.cal-days-in-month.php                     30-Sep-2022 11:07                4497
function.cal-from-jd.php                           30-Sep-2022 11:07                6883
function.cal-info.php                              30-Sep-2022 11:07                5819
function.cal-to-jd.php                             30-Sep-2022 11:07                5570
function.call-user-func-array.php                  30-Sep-2022 11:08               14395
function.call-user-func.php                        30-Sep-2022 11:08               15146
function.ceil.php                                  30-Sep-2022 11:07                4981
function.chdir.php                                 30-Sep-2022 11:07                5576
function.checkdate.php                             30-Sep-2022 11:07                5390
function.checkdnsrr.php                            30-Sep-2022 11:08                5158
function.chgrp.php                                 30-Sep-2022 11:07                6871
function.chmod.php                                 30-Sep-2022 11:07                9241
function.chop.php                                  30-Sep-2022 11:08                2026
function.chown.php                                 30-Sep-2022 11:07                6886
function.chr.php                                   30-Sep-2022 11:08                9368
function.chroot.php                                30-Sep-2022 11:07                4655
function.chunk-split.php                           30-Sep-2022 11:08                5171
function.class-alias.php                           30-Sep-2022 11:08                7510
function.class-exists.php                          30-Sep-2022 11:08                7228
function.class-implements.php                      30-Sep-2022 11:07                6465
function.class-parents.php                         30-Sep-2022 11:07                6059
function.class-uses.php                            30-Sep-2022 11:07                6201
function.clearstatcache.php                        30-Sep-2022 11:07               11137
function.cli-get-process-title.php                 30-Sep-2022 11:07                4466
function.cli-set-process-title.php                 30-Sep-2022 11:07                5777
function.closedir.php                              30-Sep-2022 11:07                5042
function.closelog.php                              30-Sep-2022 11:08                2965
function.com-create-guid.php                       30-Sep-2022 11:08                2789
function.com-event-sink.php                        30-Sep-2022 11:08               10988
function.com-get-active-object.php                 30-Sep-2022 11:08                5976
function.com-load-typelib.php                      30-Sep-2022 11:08                5370
function.com-message-pump.php                      30-Sep-2022 11:08                4030
function.com-print-typeinfo.php                    30-Sep-2022 11:08                5004
function.commonmark-parse.php                      30-Sep-2022 11:08                3503
function.commonmark-render-html.php                30-Sep-2022 11:08                3969
function.commonmark-render-latex.php               30-Sep-2022 11:08                4245
function.commonmark-render-man.php                 30-Sep-2022 11:08                4227
function.commonmark-render-xml.php                 30-Sep-2022 11:08                3926
function.commonmark-render.php                     30-Sep-2022 11:08                4173
function.compact.php                               30-Sep-2022 11:08                7899
function.connection-aborted.php                    30-Sep-2022 11:07                3170
function.connection-status.php                     30-Sep-2022 11:07                3229
function.constant.php                              30-Sep-2022 11:07                7852
function.convert-cyr-string.php                    30-Sep-2022 11:08                5106
function.convert-uudecode.php                      30-Sep-2022 11:08                4383
function.convert-uuencode.php                      30-Sep-2022 11:08                5471
function.copy.php                                  30-Sep-2022 11:07                5907
function.cos.php                                   30-Sep-2022 11:07                3978
function.cosh.php                                  30-Sep-2022 11:07                3326
function.count-chars.php                           30-Sep-2022 11:08                7431
function.count.php                                 30-Sep-2022 11:08               16776
function.crc32.php                                 30-Sep-2022 11:08                7444
function.create-function.php                       30-Sep-2022 11:08               33918
function.crypt.php                                 30-Sep-2022 11:08               19836
function.ctype-alnum.php                           30-Sep-2022 11:08                6746
function.ctype-alpha.php                           30-Sep-2022 11:08                7130
function.ctype-cntrl.php                           30-Sep-2022 11:08                6765
function.ctype-digit.php                           30-Sep-2022 11:08                9123
function.ctype-graph.php                           30-Sep-2022 11:08                7477
function.ctype-lower.php                           30-Sep-2022 11:08                6965
function.ctype-print.php                           30-Sep-2022 11:08                7500
function.ctype-punct.php                           30-Sep-2022 11:08                6767
function.ctype-space.php                           30-Sep-2022 11:08                7621
function.ctype-upper.php                           30-Sep-2022 11:08                6900
function.ctype-xdigit.php                          30-Sep-2022 11:08                6599
function.cubrid-affected-rows.php                  30-Sep-2022 11:07                9272
function.cubrid-bind.php                           30-Sep-2022 11:07               21439
function.cubrid-client-encoding.php                30-Sep-2022 11:07                5129
function.cubrid-close-prepare.php                  30-Sep-2022 11:07                6648
function.cubrid-close-request.php                  30-Sep-2022 11:07                6659
function.cubrid-close.php                          30-Sep-2022 11:07                6471
function.cubrid-col-get.php                        30-Sep-2022 11:07                8460
function.cubrid-col-size.php                       30-Sep-2022 11:07                8580
function.cubrid-column-names.php                   30-Sep-2022 11:07                8626
function.cubrid-column-types.php                   30-Sep-2022 11:07                8606
function.cubrid-commit.php                         30-Sep-2022 11:07               16176
function.cubrid-connect-with-url.php               30-Sep-2022 11:07               15505
function.cubrid-connect.php                        30-Sep-2022 11:07               12116
function.cubrid-current-oid.php                    30-Sep-2022 11:07                5867
function.cubrid-data-seek.php                      30-Sep-2022 11:07                7220
function.cubrid-db-name.php                        30-Sep-2022 11:07                6366
function.cubrid-disconnect.php                     30-Sep-2022 11:07                7447
function.cubrid-drop.php                           30-Sep-2022 11:07               11543
function.cubrid-errno.php                          30-Sep-2022 11:07                6912
function.cubrid-error-code-facility.php            30-Sep-2022 11:07                5952
function.cubrid-error-code.php                     30-Sep-2022 11:07                5887
function.cubrid-error-msg.php                      30-Sep-2022 11:07                5285
function.cubrid-error.php                          30-Sep-2022 11:07                6470
function.cubrid-execute.php                        30-Sep-2022 11:07               14273
function.cubrid-fetch-array.php                    30-Sep-2022 11:07                9906
function.cubrid-fetch-assoc.php                    30-Sep-2022 11:07                9116
function.cubrid-fetch-field.php                    30-Sep-2022 11:07               14165
function.cubrid-fetch-lengths.php                  30-Sep-2022 11:07                5995
function.cubrid-fetch-object.php                   30-Sep-2022 11:07               12235
function.cubrid-fetch-row.php                      30-Sep-2022 11:07                9000
function.cubrid-fetch.php                          30-Sep-2022 11:07               10185
function.cubrid-field-flags.php                    30-Sep-2022 11:07                7660
function.cubrid-field-len.php                      30-Sep-2022 11:07                8241
function.cubrid-field-name.php                     30-Sep-2022 11:07                7075
function.cubrid-field-seek.php                     30-Sep-2022 11:07               10815
function.cubrid-field-table.php                    30-Sep-2022 11:07                7298
function.cubrid-field-type.php                     30-Sep-2022 11:07                7360
function.cubrid-free-result.php                    30-Sep-2022 11:07                5665
function.cubrid-get-autocommit.php                 30-Sep-2022 11:07                3519
function.cubrid-get-charset.php                    30-Sep-2022 11:07                4869
function.cubrid-get-class-name.php                 30-Sep-2022 11:07                6168
function.cubrid-get-client-info.php                30-Sep-2022 11:07                8243
function.cubrid-get-db-parameter.php               30-Sep-2022 11:07               14383
function.cubrid-get-query-timeout.php              30-Sep-2022 11:07                6602
function.cubrid-get-server-info.php                30-Sep-2022 11:07                8475
function.cubrid-get.php                            30-Sep-2022 11:07               10004
function.cubrid-insert-id.php                      30-Sep-2022 11:07                7080
function.cubrid-is-instance.php                    30-Sep-2022 11:07                7321
function.cubrid-list-dbs.php                       30-Sep-2022 11:07                4343
function.cubrid-load-from-glo.php                  30-Sep-2022 11:07                6800
function.cubrid-lob-close.php                      30-Sep-2022 11:07                7237
function.cubrid-lob-export.php                     30-Sep-2022 11:07                7694
function.cubrid-lob-get.php                        30-Sep-2022 11:07                7599
function.cubrid-lob-send.php                       30-Sep-2022 11:07                6900
function.cubrid-lob-size.php                       30-Sep-2022 11:07                5741
function.cubrid-lob2-bind.php                      30-Sep-2022 11:07                9645
function.cubrid-lob2-close.php                     30-Sep-2022 11:07                3179
function.cubrid-lob2-export.php                    30-Sep-2022 11:07                8662
function.cubrid-lob2-import.php                    30-Sep-2022 11:07                8526
function.cubrid-lob2-new.php                       30-Sep-2022 11:07                3683
function.cubrid-lob2-read.php                      30-Sep-2022 11:07               14368
function.cubrid-lob2-seek.php                      30-Sep-2022 11:07               11216
function.cubrid-lob2-seek64.php                    30-Sep-2022 11:07               12756
function.cubrid-lob2-size.php                      30-Sep-2022 11:07                4216
function.cubrid-lob2-size64.php                    30-Sep-2022 11:07                4394
function.cubrid-lob2-tell.php                      30-Sep-2022 11:07                4235
function.cubrid-lob2-tell64.php                    30-Sep-2022 11:07                4431
function.cubrid-lob2-write.php                     30-Sep-2022 11:07               14307
function.cubrid-lock-read.php                      30-Sep-2022 11:07                9129
function.cubrid-lock-write.php                     30-Sep-2022 11:07                9547
function.cubrid-move-cursor.php                    30-Sep-2022 11:07                9274
function.cubrid-new-glo.php                        30-Sep-2022 11:07                6946
function.cubrid-next-result.php                    30-Sep-2022 11:07               17209
function.cubrid-num-cols.php                       30-Sep-2022 11:07                5877
function.cubrid-num-fields.php                     30-Sep-2022 11:07                5560
function.cubrid-num-rows.php                       30-Sep-2022 11:07                7076
function.cubrid-pconnect-with-url.php              30-Sep-2022 11:07               14944
function.cubrid-pconnect.php                       30-Sep-2022 11:07               12004
function.cubrid-ping.php                           30-Sep-2022 11:07                6214
function.cubrid-prepare.php                        30-Sep-2022 11:07               10302
function.cubrid-put.php                            30-Sep-2022 11:07               11439
function.cubrid-query.php                          30-Sep-2022 11:07               15193
function.cubrid-real-escape-string.php             30-Sep-2022 11:07                8085
function.cubrid-result.php                         30-Sep-2022 11:07                7285
function.cubrid-rollback.php                       30-Sep-2022 11:07               15456
function.cubrid-save-to-glo.php                    30-Sep-2022 11:07                6704
function.cubrid-schema.php                         30-Sep-2022 11:07               20213
function.cubrid-send-glo.php                       30-Sep-2022 11:07                6137
function.cubrid-seq-drop.php                       30-Sep-2022 11:07                9648
function.cubrid-seq-insert.php                     30-Sep-2022 11:07               10103
function.cubrid-seq-put.php                        30-Sep-2022 11:07               10030
function.cubrid-set-add.php                        30-Sep-2022 11:07                9403
function.cubrid-set-autocommit.php                 30-Sep-2022 11:07                3932
function.cubrid-set-db-parameter.php               30-Sep-2022 11:07                7930
function.cubrid-set-drop.php                       30-Sep-2022 11:07                9380
function.cubrid-set-query-timeout.php              30-Sep-2022 11:07                3276
function.cubrid-unbuffered-query.php               30-Sep-2022 11:07                7088
function.cubrid-version.php                        30-Sep-2022 11:07                8866
function.curl-close.php                            30-Sep-2022 11:08                6276
function.curl-copy-handle.php                      30-Sep-2022 11:08                6540
function.curl-errno.php                            30-Sep-2022 11:08                6167
function.curl-error.php                            30-Sep-2022 11:08                6131
function.curl-escape.php                           30-Sep-2022 11:08                7682
function.curl-exec.php                             30-Sep-2022 11:08                7337
function.curl-getinfo.php                          30-Sep-2022 11:08               31026
function.curl-init.php                             30-Sep-2022 11:08                7368
function.curl-multi-add-handle.php                 30-Sep-2022 11:08               10684
function.curl-multi-close.php                      30-Sep-2022 11:08               10033
function.curl-multi-errno.php                      30-Sep-2022 11:08                3866
function.curl-multi-exec.php                       30-Sep-2022 11:08               10703
function.curl-multi-getcontent.php                 30-Sep-2022 11:08                4039
function.curl-multi-info-read.php                  30-Sep-2022 11:08               12397
function.curl-multi-init.php                       30-Sep-2022 11:08                9226
function.curl-multi-remove-handle.php              30-Sep-2022 11:08                5519
function.curl-multi-select.php                     30-Sep-2022 11:08                4353
function.curl-multi-setopt.php                     30-Sep-2022 11:08               10819
function.curl-multi-strerror.php                   30-Sep-2022 11:08                7356
function.curl-pause.php                            30-Sep-2022 11:08                3638
function.curl-reset.php                            30-Sep-2022 11:08                6644
function.curl-setopt-array.php                     30-Sep-2022 11:08                7889
function.curl-setopt.php                           30-Sep-2022 11:08              137667
function.curl-share-close.php                      30-Sep-2022 11:08                8301
function.curl-share-errno.php                      30-Sep-2022 11:08                3929
function.curl-share-init.php                       30-Sep-2022 11:08                7897
function.curl-share-setopt.php                     30-Sep-2022 11:08               10504
function.curl-share-strerror.php                   30-Sep-2022 11:08                3301
function.curl-strerror.php                         30-Sep-2022 11:08                6246
function.curl-unescape.php                         30-Sep-2022 11:08                8179
function.curl-version.php                          30-Sep-2022 11:08                7373
function.curl_upkeep.php                           30-Sep-2022 11:08                7111
function.current.php                               30-Sep-2022 11:08               10839
function.date-add.php                              30-Sep-2022 11:07                1719
function.date-create-from-format.php               30-Sep-2022 11:07                1894
function.date-create-immutable-from-format.php     30-Sep-2022 11:07                2006
function.date-create-immutable.php                 30-Sep-2022 11:07                1898
function.date-create.php                           30-Sep-2022 11:07                4380
function.date-date-set.php                         30-Sep-2022 11:07                1778
function.date-default-timezone-get.php             30-Sep-2022 11:07                7253
function.date-default-timezone-set.php             30-Sep-2022 11:07                5789
function.date-diff.php                             30-Sep-2022 11:07                1738
function.date-format.php                           30-Sep-2022 11:07                1746
function.date-get-last-errors.php                  30-Sep-2022 11:07                1875
function.date-interval-create-from-date-string.php 30-Sep-2022 11:07                2022
function.date-interval-format.php                  30-Sep-2022 11:07                1873
function.date-isodate-set.php                      30-Sep-2022 11:07                1801
function.date-modify.php                           30-Sep-2022 11:07                1750
function.date-offset-get.php                       30-Sep-2022 11:07                1794
function.date-parse-from-format.php                30-Sep-2022 11:07               13781
function.date-parse.php                            30-Sep-2022 11:07               19673
function.date-sub.php                              30-Sep-2022 11:07                2283
function.date-sun-info.php                         30-Sep-2022 11:07               16374
function.date-sunrise.php                          30-Sep-2022 11:07               13470
function.date-sunset.php                           30-Sep-2022 11:07               13455
function.date-time-set.php                         30-Sep-2022 11:07                1764
function.date-timestamp-get.php                    30-Sep-2022 11:07                1823
function.date-timestamp-set.php                    30-Sep-2022 11:07                1831
function.date-timezone-get.php                     30-Sep-2022 11:07                1820
function.date-timezone-set.php                     30-Sep-2022 11:07                1792
function.date.php                                  30-Sep-2022 11:07               23797
function.db2-autocommit.php                        30-Sep-2022 11:07               10963
function.db2-bind-param.php                        30-Sep-2022 11:07               23592
function.db2-client-info.php                       30-Sep-2022 11:07               12815
function.db2-close.php                             30-Sep-2022 11:07                5615
function.db2-column-privileges.php                 30-Sep-2022 11:07                8418
function.db2-columns.php                           30-Sep-2022 11:07               10544
function.db2-commit.php                            30-Sep-2022 11:07                3666
function.db2-conn-error.php                        30-Sep-2022 11:07                6806
function.db2-conn-errormsg.php                     30-Sep-2022 11:07                6551
function.db2-connect.php                           30-Sep-2022 11:07               43092
function.db2-cursor-type.php                       30-Sep-2022 11:07                3224
function.db2-escape-string.php                     30-Sep-2022 11:07                8050
function.db2-exec.php                              30-Sep-2022 11:07               29485
function.db2-execute.php                           30-Sep-2022 11:07               28390
function.db2-fetch-array.php                       30-Sep-2022 11:07               11831
function.db2-fetch-assoc.php                       30-Sep-2022 11:07               11788
function.db2-fetch-both.php                        30-Sep-2022 11:07               12421
function.db2-fetch-object.php                      30-Sep-2022 11:07                9552
function.db2-fetch-row.php                         30-Sep-2022 11:07               17228
function.db2-field-display-size.php                30-Sep-2022 11:07                4880
function.db2-field-name.php                        30-Sep-2022 11:07                4753
function.db2-field-num.php                         30-Sep-2022 11:07                4761
function.db2-field-precision.php                   30-Sep-2022 11:07                4785
function.db2-field-scale.php                       30-Sep-2022 11:07                4755
function.db2-field-type.php                        30-Sep-2022 11:07                4775
function.db2-field-width.php                       30-Sep-2022 11:07                4995
function.db2-foreign-keys.php                      30-Sep-2022 11:07                8853
function.db2-free-result.php                       30-Sep-2022 11:07                3347
function.db2-free-stmt.php                         30-Sep-2022 11:07                3354
function.db2-get-option.php                        30-Sep-2022 11:07               25649
function.db2-last-insert-id.php                    30-Sep-2022 11:07                8556
function.db2-lob-read.php                          30-Sep-2022 11:07               17878
function.db2-next-result.php                       30-Sep-2022 11:07                9213
function.db2-num-fields.php                        30-Sep-2022 11:07                7332
function.db2-num-rows.php                          30-Sep-2022 11:07                4489
function.db2-pclose.php                            30-Sep-2022 11:07                5810
function.db2-pconnect.php                          30-Sep-2022 11:07               35145
function.db2-prepare.php                           30-Sep-2022 11:07               11314
function.db2-primary-keys.php                      30-Sep-2022 11:07                7496
function.db2-procedure-columns.php                 30-Sep-2022 11:07               11904
function.db2-procedures.php                        30-Sep-2022 11:07                8226
function.db2-result.php                            30-Sep-2022 11:07                8170
function.db2-rollback.php                          30-Sep-2022 11:07                9977
function.db2-server-info.php                       30-Sep-2022 11:07               25228
function.db2-set-option.php                        30-Sep-2022 11:07               72617
function.db2-special-columns.php                   30-Sep-2022 11:07                9949
function.db2-statistics.php                        30-Sep-2022 11:07               12857
function.db2-stmt-error.php                        30-Sep-2022 11:07                4420
function.db2-stmt-errormsg.php                     30-Sep-2022 11:07                4011
function.db2-table-privileges.php                  30-Sep-2022 11:07                8225
function.db2-tables.php                            30-Sep-2022 11:07                8279
function.dba-close.php                             30-Sep-2022 11:07                3228
function.dba-delete.php                            30-Sep-2022 11:07                3972
function.dba-exists.php                            30-Sep-2022 11:07                4013
function.dba-fetch.php                             30-Sep-2022 11:07                5555
function.dba-firstkey.php                          30-Sep-2022 11:07                3583
function.dba-handlers.php                          30-Sep-2022 11:07                5571
function.dba-insert.php                            30-Sep-2022 11:07                4614
function.dba-key-split.php                         30-Sep-2022 11:07                3625
function.dba-list.php                              30-Sep-2022 11:07                2274
function.dba-nextkey.php                           30-Sep-2022 11:07                3452
function.dba-open.php                              30-Sep-2022 11:07               12309
function.dba-optimize.php                          30-Sep-2022 11:07                3068
function.dba-popen.php                             30-Sep-2022 11:07                6546
function.dba-replace.php                           30-Sep-2022 11:07                4388
function.dba-sync.php                              30-Sep-2022 11:07                3143
function.dbase-add-record.php                      30-Sep-2022 11:07                6763
function.dbase-close.php                           30-Sep-2022 11:07                4997
function.dbase-create.php                          30-Sep-2022 11:07                7977
function.dbase-delete-record.php                   30-Sep-2022 11:07                4597
function.dbase-get-header-info.php                 30-Sep-2022 11:07                6825
function.dbase-get-record-with-names.php           30-Sep-2022 11:07                8755
function.dbase-get-record.php                      30-Sep-2022 11:07                5375
function.dbase-numfields.php                       30-Sep-2022 11:07                5723
function.dbase-numrecords.php                      30-Sep-2022 11:07                7031
function.dbase-open.php                            30-Sep-2022 11:07                6198
function.dbase-pack.php                            30-Sep-2022 11:07                6174
function.dbase-replace-record.php                  30-Sep-2022 11:07                9320
function.dcgettext.php                             30-Sep-2022 11:07                3274
function.dcngettext.php                            30-Sep-2022 11:07                3793
function.debug-backtrace.php                       30-Sep-2022 11:07                9648
function.debug-print-backtrace.php                 30-Sep-2022 11:07                6636
function.debug-zval-dump.php                       30-Sep-2022 11:08               10683
function.decbin.php                                30-Sep-2022 11:07                8776
function.dechex.php                                30-Sep-2022 11:07                7260
function.decoct.php                                30-Sep-2022 11:07                4883
function.define.php                                30-Sep-2022 11:07               11721
function.defined.php                               30-Sep-2022 11:07                5302
function.deflate-add.php                           30-Sep-2022 11:07                5426
function.deflate-init.php                          30-Sep-2022 11:07                7806
function.deg2rad.php                               30-Sep-2022 11:07                3930
function.delete.php                                30-Sep-2022 11:07                2587
function.dgettext.php                              30-Sep-2022 11:07                3052
function.die.php                                   30-Sep-2022 11:07                1525
function.dio-close.php                             30-Sep-2022 11:07                3980
function.dio-fcntl.php                             30-Sep-2022 11:07                9353
function.dio-open.php                              30-Sep-2022 11:07                7978
function.dio-read.php                              30-Sep-2022 11:07                3481
function.dio-seek.php                              30-Sep-2022 11:07                7231
function.dio-stat.php                              30-Sep-2022 11:07                4214
function.dio-tcsetattr.php                         30-Sep-2022 11:07                7184
function.dio-truncate.php                          30-Sep-2022 11:07                3621
function.dio-write.php                             30-Sep-2022 11:07                3711
function.dir.php                                   30-Sep-2022 11:07                7121
function.dirname.php                               30-Sep-2022 11:07               10233
function.disk-free-space.php                       30-Sep-2022 11:07                5658
function.disk-total-space.php                      30-Sep-2022 11:07                5345
function.diskfreespace.php                         30-Sep-2022 11:07                1771
function.dl.php                                    30-Sep-2022 11:07               10567
function.dngettext.php                             30-Sep-2022 11:07                3569
function.dns-check-record.php                      30-Sep-2022 11:08                1740
function.dns-get-mx.php                            30-Sep-2022 11:08                1710
function.dns-get-record.php                        30-Sep-2022 11:08               23547
function.dom-import-simplexml.php                  30-Sep-2022 11:08                7261
function.doubleval.php                             30-Sep-2022 11:08                1678
function.each.php                                  30-Sep-2022 11:08               11930
function.easter-date.php                           30-Sep-2022 11:07               12048
function.easter-days.php                           30-Sep-2022 11:07                7224
function.echo.php                                  30-Sep-2022 11:08               19923
function.eio-busy.php                              30-Sep-2022 11:07                4566
function.eio-cancel.php                            30-Sep-2022 11:07                7599
function.eio-chmod.php                             30-Sep-2022 11:07                6085
function.eio-chown.php                             30-Sep-2022 11:07                6211
function.eio-close.php                             30-Sep-2022 11:07                5593
function.eio-custom.php                            30-Sep-2022 11:07               10653
function.eio-dup2.php                              30-Sep-2022 11:07                5720
function.eio-event-loop.php                        30-Sep-2022 11:07                5935
function.eio-fallocate.php                         30-Sep-2022 11:07                7271
function.eio-fchmod.php                            30-Sep-2022 11:07                6156
function.eio-fchown.php                            30-Sep-2022 11:07                6405
function.eio-fdatasync.php                         30-Sep-2022 11:07                5510
function.eio-fstat.php                             30-Sep-2022 11:07               11971
function.eio-fstatvfs.php                          30-Sep-2022 11:07                5631
function.eio-fsync.php                             30-Sep-2022 11:07                5656
function.eio-ftruncate.php                         30-Sep-2022 11:07                6119
function.eio-futime.php                            30-Sep-2022 11:07                6379
function.eio-get-event-stream.php                  30-Sep-2022 11:07                8622
function.eio-get-last-error.php                    30-Sep-2022 11:07                3129
function.eio-grp-add.php                           30-Sep-2022 11:07               12220
function.eio-grp-cancel.php                        30-Sep-2022 11:07                3111
function.eio-grp-limit.php                         30-Sep-2022 11:07                2956
function.eio-grp.php                               30-Sep-2022 11:07               12447
function.eio-init.php                              30-Sep-2022 11:07                2627
function.eio-link.php                              30-Sep-2022 11:07               12789
function.eio-lstat.php                             30-Sep-2022 11:07                9962
function.eio-mkdir.php                             30-Sep-2022 11:07                9302
function.eio-mknod.php                             30-Sep-2022 11:07               11453
function.eio-nop.php                               30-Sep-2022 11:07                5152
function.eio-npending.php                          30-Sep-2022 11:07                3056
function.eio-nready.php                            30-Sep-2022 11:07                2706
function.eio-nreqs.php                             30-Sep-2022 11:07                5602
function.eio-nthreads.php                          30-Sep-2022 11:07                3497
function.eio-open.php                              30-Sep-2022 11:07               11969
function.eio-poll.php                              30-Sep-2022 11:07                5873
function.eio-read.php                              30-Sep-2022 11:07               13304
function.eio-readahead.php                         30-Sep-2022 11:07                6112
function.eio-readdir.php                           30-Sep-2022 11:07               16191
function.eio-readlink.php                          30-Sep-2022 11:07               12527
function.eio-realpath.php                          30-Sep-2022 11:07                5122
function.eio-rename.php                            30-Sep-2022 11:07                9359
function.eio-rmdir.php                             30-Sep-2022 11:07                8298
function.eio-seek.php                              30-Sep-2022 11:07                6724
function.eio-sendfile.php                          30-Sep-2022 11:07                6554
function.eio-set-max-idle.php                      30-Sep-2022 11:07                3093
function.eio-set-max-parallel.php                  30-Sep-2022 11:07                3133
function.eio-set-max-poll-reqs.php                 30-Sep-2022 11:07                2394
function.eio-set-max-poll-time.php                 30-Sep-2022 11:07                2469
function.eio-set-min-parallel.php                  30-Sep-2022 11:07                3121
function.eio-stat.php                              30-Sep-2022 11:07                9961
function.eio-statvfs.php                           30-Sep-2022 11:07                8275
function.eio-symlink.php                           30-Sep-2022 11:07               11003
function.eio-sync-file-range.php                   30-Sep-2022 11:07                6976
function.eio-sync.php                              30-Sep-2022 11:07                2807
function.eio-syncfs.php                            30-Sep-2022 11:07                5120
function.eio-truncate.php                          30-Sep-2022 11:07                5929
function.eio-unlink.php                            30-Sep-2022 11:07                5158
function.eio-utime.php                             30-Sep-2022 11:07                5901
function.eio-write.php                             30-Sep-2022 11:07                6742
function.empty.php                                 30-Sep-2022 11:08                9953
function.enchant-broker-describe.php               30-Sep-2022 11:07                6151
function.enchant-broker-dict-exists.php            30-Sep-2022 11:07                5813
function.enchant-broker-free-dict.php              30-Sep-2022 11:07                4919
function.enchant-broker-free.php                   30-Sep-2022 11:07                4438
function.enchant-broker-get-dict-path.php          30-Sep-2022 11:07                5281
function.enchant-broker-get-error.php              30-Sep-2022 11:07                3725
function.enchant-broker-init.php                   30-Sep-2022 11:07                3561
function.enchant-broker-list-dicts.php             30-Sep-2022 11:07                6974
function.enchant-broker-request-dict.php           30-Sep-2022 11:07                7348
function.enchant-broker-request-pwl-dict.php       30-Sep-2022 11:07                5652
function.enchant-broker-set-dict-path.php          30-Sep-2022 11:07                5476
function.enchant-broker-set-ordering.php           30-Sep-2022 11:07                4841
function.enchant-dict-add-to-personal.php          30-Sep-2022 11:07                2212
function.enchant-dict-add-to-session.php           30-Sep-2022 11:07                4582
function.enchant-dict-add.php                      30-Sep-2022 11:07                6447
function.enchant-dict-check.php                    30-Sep-2022 11:07                4120
function.enchant-dict-describe.php                 30-Sep-2022 11:07                6627
function.enchant-dict-get-error.php                30-Sep-2022 11:07                3948
function.enchant-dict-is-added.php                 30-Sep-2022 11:07                4509
function.enchant-dict-is-in-session.php            30-Sep-2022 11:07                2198
function.enchant-dict-quick-check.php              30-Sep-2022 11:07                8238
function.enchant-dict-store-replacement.php        30-Sep-2022 11:07                4688
function.enchant-dict-suggest.php                  30-Sep-2022 11:07                7804
function.end.php                                   30-Sep-2022 11:08                6145
function.enum-exists.php                           30-Sep-2022 11:08                5291
function.error-clear-last.php                      30-Sep-2022 11:07                4588
function.error-get-last.php                        30-Sep-2022 11:07                4915
function.error-log.php                             30-Sep-2022 11:07               11141
function.error-reporting.php                       30-Sep-2022 11:07                9084
function.escapeshellarg.php                        30-Sep-2022 11:07                5621
function.escapeshellcmd.php                        30-Sep-2022 11:07                8038
function.eval.php                                  30-Sep-2022 11:07                9311
function.exec.php                                  30-Sep-2022 11:07                9483
function.exif-imagetype.php                        30-Sep-2022 11:07                8593
function.exif-read-data.php                        30-Sep-2022 11:07               23435
function.exif-tagname.php                          30-Sep-2022 11:07                4603
function.exif-thumbnail.php                        30-Sep-2022 11:07                8994
function.exit.php                                  30-Sep-2022 11:07                9594
function.exp.php                                   30-Sep-2022 11:07                4144
function.expect-expectl.php                        30-Sep-2022 11:07               11872
function.expect-popen.php                          30-Sep-2022 11:07                4606
function.explode.php                               30-Sep-2022 11:08               15354
function.expm1.php                                 30-Sep-2022 11:07                3249
function.extension-loaded.php                      30-Sep-2022 11:07                5732
function.extract.php                               30-Sep-2022 11:08               13713
function.ezmlm-hash.php                            30-Sep-2022 11:07                4597
function.fann-cascadetrain-on-data.php             30-Sep-2022 11:07                6096
function.fann-cascadetrain-on-file.php             30-Sep-2022 11:07                5168
function.fann-clear-scaling-params.php             30-Sep-2022 11:07                2493
function.fann-copy.php                             30-Sep-2022 11:07                3068
function.fann-create-from-file.php                 30-Sep-2022 11:07                3075
function.fann-create-shortcut-array.php            30-Sep-2022 11:07                3926
function.fann-create-shortcut.php                  30-Sep-2022 11:07                4838
function.fann-create-sparse-array.php              30-Sep-2022 11:07                4511
function.fann-create-sparse.php                    30-Sep-2022 11:07                5161
function.fann-create-standard-array.php            30-Sep-2022 11:07                4239
function.fann-create-standard.php                  30-Sep-2022 11:07                4906
function.fann-create-train-from-callback.php       30-Sep-2022 11:07                9190
function.fann-create-train.php                     30-Sep-2022 11:07                4374
function.fann-descale-input.php                    30-Sep-2022 11:07                3523
function.fann-descale-output.php                   30-Sep-2022 11:07                3539
function.fann-descale-train.php                    30-Sep-2022 11:07                3484
function.fann-destroy-train.php                    30-Sep-2022 11:07                2450
function.fann-destroy.php                          30-Sep-2022 11:07                2480
function.fann-duplicate-train-data.php             30-Sep-2022 11:07                2617
function.fann-get-activation-function.php          30-Sep-2022 11:07                5002
function.fann-get-activation-steepness.php         30-Sep-2022 11:07                5415
function.fann-get-bias-array.php                   30-Sep-2022 11:07                2433
function.fann-get-bit-fail-limit.php               30-Sep-2022 11:07                3550
function.fann-get-bit-fail.php                     30-Sep-2022 11:07                4773
function.fann-get-cascade-activation-functions-..> 30-Sep-2022 11:07                3662
function.fann-get-cascade-activation-functions.php 30-Sep-2022 11:07                4118
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:07                3718
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:07                3869
function.fann-get-cascade-candidate-change-frac..> 30-Sep-2022 11:07                4990
function.fann-get-cascade-candidate-limit.php      30-Sep-2022 11:07                3350
function.fann-get-cascade-candidate-stagnation-..> 30-Sep-2022 11:07                4101
function.fann-get-cascade-max-cand-epochs.php      30-Sep-2022 11:07                3232
function.fann-get-cascade-max-out-epochs.php       30-Sep-2022 11:07                3153
function.fann-get-cascade-min-cand-epochs.php      30-Sep-2022 11:07                3569
function.fann-get-cascade-min-out-epochs.php       30-Sep-2022 11:07                3526
function.fann-get-cascade-num-candidate-groups.php 30-Sep-2022 11:07                3630
function.fann-get-cascade-num-candidates.php       30-Sep-2022 11:07                5824
function.fann-get-cascade-output-change-fractio..> 30-Sep-2022 11:07                4918
function.fann-get-cascade-output-stagnation-epo..> 30-Sep-2022 11:07                4044
function.fann-get-cascade-weight-multiplier.php    30-Sep-2022 11:07                3308
function.fann-get-connection-array.php             30-Sep-2022 11:07                2460
function.fann-get-connection-rate.php              30-Sep-2022 11:07                2531
function.fann-get-errno.php                        30-Sep-2022 11:07                2968
function.fann-get-errstr.php                       30-Sep-2022 11:07                2971
function.fann-get-layer-array.php                  30-Sep-2022 11:07                2534
function.fann-get-learning-momentum.php            30-Sep-2022 11:07                3574
function.fann-get-learning-rate.php                30-Sep-2022 11:07                3396
function.fann-get-mse.php                          30-Sep-2022 11:07                3013
function.fann-get-network-type.php                 30-Sep-2022 11:07                2501
function.fann-get-num-input.php                    30-Sep-2022 11:07                2388
function.fann-get-num-layers.php                   30-Sep-2022 11:07                2443
function.fann-get-num-output.php                   30-Sep-2022 11:07                2407
function.fann-get-quickprop-decay.php              30-Sep-2022 11:07                3165
function.fann-get-quickprop-mu.php                 30-Sep-2022 11:07                3058
function.fann-get-rprop-decrease-factor.php        30-Sep-2022 11:07                3119
function.fann-get-rprop-delta-max.php              30-Sep-2022 11:07                3196
function.fann-get-rprop-delta-min.php              30-Sep-2022 11:07                2992
function.fann-get-rprop-delta-zero.php             30-Sep-2022 11:07                3395
function.fann-get-rprop-increase-factor.php        30-Sep-2022 11:07                3144
function.fann-get-sarprop-step-error-shift.php     30-Sep-2022 11:07                3486
function.fann-get-sarprop-step-error-threshold-..> 30-Sep-2022 11:07                3638
function.fann-get-sarprop-temperature.php          30-Sep-2022 11:07                3400
function.fann-get-sarprop-weight-decay-shift.php   30-Sep-2022 11:07                3467
function.fann-get-total-connections.php            30-Sep-2022 11:07                2580
function.fann-get-total-neurons.php                30-Sep-2022 11:07                2627
function.fann-get-train-error-function.php         30-Sep-2022 11:07                3335
function.fann-get-train-stop-function.php          30-Sep-2022 11:07                3323
function.fann-get-training-algorithm.php           30-Sep-2022 11:07                3495
function.fann-init-weights.php                     30-Sep-2022 11:07                4135
function.fann-length-train-data.php                30-Sep-2022 11:07                2579
function.fann-merge-train-data.php                 30-Sep-2022 11:07                2824
function.fann-num-input-train-data.php             30-Sep-2022 11:07                3304
function.fann-num-output-train-data.php            30-Sep-2022 11:07                3302
function.fann-print-error.php                      30-Sep-2022 11:07                2792
function.fann-randomize-weights.php                30-Sep-2022 11:07                3644
function.fann-read-train-from-file.php             30-Sep-2022 11:07                4917
function.fann-reset-errno.php                      30-Sep-2022 11:07                2983
function.fann-reset-errstr.php                     30-Sep-2022 11:07                2964
function.fann-reset-mse.php                        30-Sep-2022 11:07                3273
function.fann-run.php                              30-Sep-2022 11:07                2643
function.fann-save-train.php                       30-Sep-2022 11:07                3250
function.fann-save.php                             30-Sep-2022 11:07                4059
function.fann-scale-input-train-data.php           30-Sep-2022 11:07                3840
function.fann-scale-input.php                      30-Sep-2022 11:07                3537
function.fann-scale-output-train-data.php          30-Sep-2022 11:07                3868
function.fann-scale-output.php                     30-Sep-2022 11:07                3541
function.fann-scale-train-data.php                 30-Sep-2022 11:07                3838
function.fann-scale-train.php                      30-Sep-2022 11:07                3502
function.fann-set-activation-function-hidden.php   30-Sep-2022 11:07                4262
function.fann-set-activation-function-layer.php    30-Sep-2022 11:07                4722
function.fann-set-activation-function-output.php   30-Sep-2022 11:07                4278
function.fann-set-activation-function.php          30-Sep-2022 11:07                5986
function.fann-set-activation-steepness-hidden.php  30-Sep-2022 11:07                4563
function.fann-set-activation-steepness-layer.php   30-Sep-2022 11:07                4974
function.fann-set-activation-steepness-output.php  30-Sep-2022 11:07                4544
function.fann-set-activation-steepness.php         30-Sep-2022 11:07                5816
function.fann-set-bit-fail-limit.php               30-Sep-2022 11:07                3206
function.fann-set-callback.php                     30-Sep-2022 11:07                5260
function.fann-set-cascade-activation-functions.php 30-Sep-2022 11:07                3877
function.fann-set-cascade-activation-steepnesse..> 30-Sep-2022 11:07                4090
function.fann-set-cascade-candidate-change-frac..> 30-Sep-2022 11:07                3557
function.fann-set-cascade-candidate-limit.php      30-Sep-2022 11:07                3364
function.fann-set-cascade-candidate-stagnation-..> 30-Sep-2022 11:07                3619
function.fann-set-cascade-max-cand-epochs.php      30-Sep-2022 11:07                3365
function.fann-set-cascade-max-out-epochs.php       30-Sep-2022 11:07                3316
function.fann-set-cascade-min-cand-epochs.php      30-Sep-2022 11:07                3707
function.fann-set-cascade-min-out-epochs.php       30-Sep-2022 11:07                3689
function.fann-set-cascade-num-candidate-groups.php 30-Sep-2022 11:07                3450
function.fann-set-cascade-output-change-fractio..> 30-Sep-2022 11:07                3514
function.fann-set-cascade-output-stagnation-epo..> 30-Sep-2022 11:07                3580
function.fann-set-cascade-weight-multiplier.php    30-Sep-2022 11:07                3349
function.fann-set-error-log.php                    30-Sep-2022 11:07                2748
function.fann-set-input-scaling-params.php         30-Sep-2022 11:07                4139
function.fann-set-learning-momentum.php            30-Sep-2022 11:07                3605
function.fann-set-learning-rate.php                30-Sep-2022 11:07                3531
function.fann-set-output-scaling-params.php        30-Sep-2022 11:07                4159
function.fann-set-quickprop-decay.php              30-Sep-2022 11:07                3277
function.fann-set-quickprop-mu.php                 30-Sep-2022 11:07                3132
function.fann-set-rprop-decrease-factor.php        30-Sep-2022 11:07                3334
function.fann-set-rprop-delta-max.php              30-Sep-2022 11:07                3461
function.fann-set-rprop-delta-min.php              30-Sep-2022 11:07                3252
function.fann-set-rprop-delta-zero.php             30-Sep-2022 11:07                3664
function.fann-set-rprop-increase-factor.php        30-Sep-2022 11:07                3360
function.fann-set-sarprop-step-error-shift.php     30-Sep-2022 11:07                3757
function.fann-set-sarprop-step-error-threshold-..> 30-Sep-2022 11:07                3951
function.fann-set-sarprop-temperature.php          30-Sep-2022 11:07                3668
function.fann-set-sarprop-weight-decay-shift.php   30-Sep-2022 11:07                3751
function.fann-set-scaling-params.php               30-Sep-2022 11:07                5083
function.fann-set-train-error-function.php         30-Sep-2022 11:07                3546
function.fann-set-train-stop-function.php          30-Sep-2022 11:07                3534
function.fann-set-training-algorithm.php           30-Sep-2022 11:07                3482
function.fann-set-weight-array.php                 30-Sep-2022 11:07                2981
function.fann-set-weight.php                       30-Sep-2022 11:07                3321
function.fann-shuffle-train-data.php               30-Sep-2022 11:07                2650
function.fann-subset-train-data.php                30-Sep-2022 11:07                3885
function.fann-test-data.php                        30-Sep-2022 11:07                3956
function.fann-test.php                             30-Sep-2022 11:07                4248
function.fann-train-epoch.php                      30-Sep-2022 11:07                4315
function.fann-train-on-data.php                    30-Sep-2022 11:07                6122
function.fann-train-on-file.php                    30-Sep-2022 11:07                6116
function.fann-train.php                            30-Sep-2022 11:07                4308
function.fastcgi-finish-request.php                30-Sep-2022 11:08                2582
function.fbird-add-user.php                        30-Sep-2022 11:07                2349
function.fbird-affected-rows.php                   30-Sep-2022 11:07                2367
function.fbird-backup.php                          30-Sep-2022 11:07                1750
function.fbird-blob-add.php                        30-Sep-2022 11:07                2720
function.fbird-blob-cancel.php                     30-Sep-2022 11:07                3513
function.fbird-blob-close.php                      30-Sep-2022 11:07                2751
function.fbird-blob-create.php                     30-Sep-2022 11:07                2751
function.fbird-blob-echo.php                       30-Sep-2022 11:07                2539
function.fbird-blob-get.php                        30-Sep-2022 11:07                2532
function.fbird-blob-import.php                     30-Sep-2022 11:07                2747
function.fbird-blob-info.php                       30-Sep-2022 11:07                1782
function.fbird-blob-open.php                       30-Sep-2022 11:07                2529
function.fbird-close.php                           30-Sep-2022 11:07                2290
function.fbird-commit-ret.php                      30-Sep-2022 11:07                1775
function.fbird-commit.php                          30-Sep-2022 11:07                1743
function.fbird-connect.php                         30-Sep-2022 11:07                2296
function.fbird-db-info.php                         30-Sep-2022 11:07                1756
function.fbird-delete-user.php                     30-Sep-2022 11:07                2364
function.fbird-drop-db.php                         30-Sep-2022 11:07                2312
function.fbird-errcode.php                         30-Sep-2022 11:07                2110
function.fbird-errmsg.php                          30-Sep-2022 11:07                2103
function.fbird-execute.php                         30-Sep-2022 11:07                2115
function.fbird-fetch-assoc.php                     30-Sep-2022 11:07                2380
function.fbird-fetch-object.php                    30-Sep-2022 11:07                2391
function.fbird-fetch-row.php                       30-Sep-2022 11:07                2368
function.fbird-field-info.php                      30-Sep-2022 11:07                2185
function.fbird-free-event-handler.php              30-Sep-2022 11:07                2289
function.fbird-free-query.php                      30-Sep-2022 11:07                1811
function.fbird-free-result.php                     30-Sep-2022 11:07                1796
function.fbird-gen-id.php                          30-Sep-2022 11:07                1753
function.fbird-maintain-db.php                     30-Sep-2022 11:07                1798
function.fbird-modify-user.php                     30-Sep-2022 11:07                2380
function.fbird-name-result.php                     30-Sep-2022 11:07                2363
function.fbird-num-fields.php                      30-Sep-2022 11:07                2174
function.fbird-num-params.php                      30-Sep-2022 11:07                2358
function.fbird-param-info.php                      30-Sep-2022 11:07                2363
function.fbird-pconnect.php                        30-Sep-2022 11:07                2313
function.fbird-prepare.php                         30-Sep-2022 11:07                1746
function.fbird-query.php                           30-Sep-2022 11:07                2679
function.fbird-restore.php                         30-Sep-2022 11:07                1753
function.fbird-rollback-ret.php                    30-Sep-2022 11:07                1805
function.fbird-rollback.php                        30-Sep-2022 11:07                1777
function.fbird-server-info.php                     30-Sep-2022 11:07                1808
function.fbird-service-attach.php                  30-Sep-2022 11:07                1847
function.fbird-service-detach.php                  30-Sep-2022 11:07                1859
function.fbird-set-event-handler.php               30-Sep-2022 11:07                2473
function.fbird-trans.php                           30-Sep-2022 11:07                1752
function.fbird-wait-event.php                      30-Sep-2022 11:07                2398
function.fclose.php                                30-Sep-2022 11:07                4431
function.fdatasync.php                             30-Sep-2022 11:07                6086
function.fdf-add-doc-javascript.php                30-Sep-2022 11:07                5342
function.fdf-add-template.php                      30-Sep-2022 11:07                2565
function.fdf-close.php                             30-Sep-2022 11:07                3036
function.fdf-create.php                            30-Sep-2022 11:07                5703
function.fdf-enum-values.php                       30-Sep-2022 11:07                2421
function.fdf-errno.php                             30-Sep-2022 11:07                2817
function.fdf-error.php                             30-Sep-2022 11:07                3161
function.fdf-get-ap.php                            30-Sep-2022 11:07                3877
function.fdf-get-attachment.php                    30-Sep-2022 11:07                6212
function.fdf-get-encoding.php                      30-Sep-2022 11:07                3345
function.fdf-get-file.php                          30-Sep-2022 11:07                3111
function.fdf-get-flags.php                         30-Sep-2022 11:07                2172
function.fdf-get-opt.php                           30-Sep-2022 11:07                2314
function.fdf-get-status.php                        30-Sep-2022 11:07                3106
function.fdf-get-value.php                         30-Sep-2022 11:07                4579
function.fdf-get-version.php                       30-Sep-2022 11:07                3636
function.fdf-header.php                            30-Sep-2022 11:07                2333
function.fdf-next-field-name.php                   30-Sep-2022 11:07                5436
function.fdf-open-string.php                       30-Sep-2022 11:07                4978
function.fdf-open.php                              30-Sep-2022 11:07                6095
function.fdf-remove-item.php                       30-Sep-2022 11:07                2198
function.fdf-save-string.php                       30-Sep-2022 11:07                5639
function.fdf-save.php                              30-Sep-2022 11:07                3989
function.fdf-set-ap.php                            30-Sep-2022 11:07                4092
function.fdf-set-encoding.php                      30-Sep-2022 11:07                3624
function.fdf-set-file.php                          30-Sep-2022 11:07                6964
function.fdf-set-flags.php                         30-Sep-2022 11:07                4095
function.fdf-set-javascript-action.php             30-Sep-2022 11:07                4312
function.fdf-set-on-import-javascript.php          30-Sep-2022 11:07                3047
function.fdf-set-opt.php                           30-Sep-2022 11:07                4332
function.fdf-set-status.php                        30-Sep-2022 11:07                3602
function.fdf-set-submit-form-action.php            30-Sep-2022 11:07                4562
function.fdf-set-target-frame.php                  30-Sep-2022 11:07                3605
function.fdf-set-value.php                         30-Sep-2022 11:07                5298
function.fdf-set-version.php                       30-Sep-2022 11:07                3967
function.fdiv.php                                  30-Sep-2022 11:07                6141
function.feof.php                                  30-Sep-2022 11:07                8083
function.fflush.php                                30-Sep-2022 11:07                5707
function.fgetc.php                                 30-Sep-2022 11:07                6750
function.fgetcsv.php                               30-Sep-2022 11:07               13747
function.fgets.php                                 30-Sep-2022 11:07                8965
function.fgetss.php                                30-Sep-2022 11:07               10127
function.file-exists.php                           30-Sep-2022 11:07                7519
function.file-get-contents.php                     30-Sep-2022 11:07               18887
function.file-put-contents.php                     30-Sep-2022 11:07               13559
function.file.php                                  30-Sep-2022 11:07               11755
function.fileatime.php                             30-Sep-2022 11:07                7253
function.filectime.php                             30-Sep-2022 11:07                7164
function.filegroup.php                             30-Sep-2022 11:07                5834
function.fileinode.php                             30-Sep-2022 11:07                5369
function.filemtime.php                             30-Sep-2022 11:07                6860
function.fileowner.php                             30-Sep-2022 11:07                5662
function.fileperms.php                             30-Sep-2022 11:07               18460
function.filesize.php                              30-Sep-2022 11:07                5876
function.filetype.php                              30-Sep-2022 11:07                6794
function.filter-has-var.php                        30-Sep-2022 11:08                2868
function.filter-id.php                             30-Sep-2022 11:08                2810
function.filter-input-array.php                    30-Sep-2022 11:08               14501
function.filter-input.php                          30-Sep-2022 11:08                8080
function.filter-list.php                           30-Sep-2022 11:08                3692
function.filter-var-array.php                      30-Sep-2022 11:08               13759
function.filter-var.php                            30-Sep-2022 11:08               13924
function.finfo-buffer.php                          30-Sep-2022 11:07                7816
function.finfo-close.php                           30-Sep-2022 11:07                3541
function.finfo-file.php                            30-Sep-2022 11:07                8522
function.finfo-open.php                            30-Sep-2022 11:07               10190
function.finfo-set-flags.php                       30-Sep-2022 11:07                4613
function.floatval.php                              30-Sep-2022 11:08                6214
function.flock.php                                 30-Sep-2022 11:07               13683
function.floor.php                                 30-Sep-2022 11:07                5153
function.flush.php                                 30-Sep-2022 11:07                5496
function.fmod.php                                  30-Sep-2022 11:07                4911
function.fnmatch.php                               30-Sep-2022 11:07                8050
function.fopen.php                                 30-Sep-2022 11:07               25060
function.forward-static-call-array.php             30-Sep-2022 11:08               10301
function.forward-static-call.php                   30-Sep-2022 11:08                9735
function.fpassthru.php                             30-Sep-2022 11:07                7777
function.fpm-get-status.php                        30-Sep-2022 11:08                2605
function.fprintf.php                               30-Sep-2022 11:08               19516
function.fputcsv.php                               30-Sep-2022 11:07               10723
function.fputs.php                                 30-Sep-2022 11:07                1659
function.fread.php                                 30-Sep-2022 11:07               15536
function.frenchtojd.php                            30-Sep-2022 11:07                3973
function.fscanf.php                                30-Sep-2022 11:07                9703
function.fseek.php                                 30-Sep-2022 11:07                8077
function.fsockopen.php                             30-Sep-2022 11:08               18053
function.fstat.php                                 30-Sep-2022 11:07                6111
function.fsync.php                                 30-Sep-2022 11:07                5854
function.ftell.php                                 30-Sep-2022 11:07                6385
function.ftok.php                                  30-Sep-2022 11:07                3655
function.ftp-alloc.php                             30-Sep-2022 11:08                8653
function.ftp-append.php                            30-Sep-2022 11:08                4350
function.ftp-cdup.php                              30-Sep-2022 11:08                6775
function.ftp-chdir.php                             30-Sep-2022 11:08                7757
function.ftp-chmod.php                             30-Sep-2022 11:08                7268
function.ftp-close.php                             30-Sep-2022 11:08                6109
function.ftp-connect.php                           30-Sep-2022 11:08                6776
function.ftp-delete.php                            30-Sep-2022 11:08                6332
function.ftp-exec.php                              30-Sep-2022 11:08                6953
function.ftp-fget.php                              30-Sep-2022 11:08               10365
function.ftp-fput.php                              30-Sep-2022 11:08                9699
function.ftp-get-option.php                        30-Sep-2022 11:08                6096
function.ftp-get.php                               30-Sep-2022 11:08                9590
function.ftp-login.php                             30-Sep-2022 11:08                6973
function.ftp-mdtm.php                              30-Sep-2022 11:08                7484
function.ftp-mkdir.php                             30-Sep-2022 11:08                7110
function.ftp-mlsd.php                              30-Sep-2022 11:08                9284
function.ftp-nb-continue.php                       30-Sep-2022 11:08                5654
function.ftp-nb-fget.php                           30-Sep-2022 11:08               10844
function.ftp-nb-fput.php                           30-Sep-2022 11:08               10635
function.ftp-nb-get.php                            30-Sep-2022 11:08               15121
function.ftp-nb-put.php                            30-Sep-2022 11:08               12378
function.ftp-nlist.php                             30-Sep-2022 11:08                7049
function.ftp-pasv.php                              30-Sep-2022 11:08                7602
function.ftp-put.php                               30-Sep-2022 11:08                9195
function.ftp-pwd.php                               30-Sep-2022 11:08                6178
function.ftp-quit.php                              30-Sep-2022 11:08                1653
function.ftp-raw.php                               30-Sep-2022 11:08                5727
function.ftp-rawlist.php                           30-Sep-2022 11:08                8243
function.ftp-rename.php                            30-Sep-2022 11:08                7340
function.ftp-rmdir.php                             30-Sep-2022 11:08                6713
function.ftp-set-option.php                        30-Sep-2022 11:08                7529
function.ftp-site.php                              30-Sep-2022 11:08                7104
function.ftp-size.php                              30-Sep-2022 11:08                7118
function.ftp-ssl-connect.php                       30-Sep-2022 11:08                9505
function.ftp-systype.php                           30-Sep-2022 11:08                5692
function.ftruncate.php                             30-Sep-2022 11:07                6491
function.func-get-arg.php                          30-Sep-2022 11:08               11809
function.func-get-args.php                         30-Sep-2022 11:08               12659
function.func-num-args.php                         30-Sep-2022 11:08                5884
function.function-exists.php                       30-Sep-2022 11:08                6143
function.fwrite.php                                30-Sep-2022 11:07               16000
function.gc-collect-cycles.php                     30-Sep-2022 11:07                2540
function.gc-disable.php                            30-Sep-2022 11:07                2557
function.gc-enable.php                             30-Sep-2022 11:07                2534
function.gc-enabled.php                            30-Sep-2022 11:07                3255
function.gc-mem-caches.php                         30-Sep-2022 11:07                2526
function.gc-status.php                             30-Sep-2022 11:07                5985
function.gd-info.php                               30-Sep-2022 11:07                8909
function.geoip-asnum-by-name.php                   30-Sep-2022 11:07                4119
function.geoip-continent-code-by-name.php          30-Sep-2022 11:07                5737
function.geoip-country-code-by-name.php            30-Sep-2022 11:07                5476
function.geoip-country-code3-by-name.php           30-Sep-2022 11:07                5003
function.geoip-country-name-by-name.php            30-Sep-2022 11:07                4962
function.geoip-database-info.php                   30-Sep-2022 11:07                4317
function.geoip-db-avail.php                        30-Sep-2022 11:07                4573
function.geoip-db-filename.php                     30-Sep-2022 11:07                4185
function.geoip-db-get-all-info.php                 30-Sep-2022 11:07                6926
function.geoip-domain-by-name.php                  30-Sep-2022 11:07                4474
function.geoip-id-by-name.php                      30-Sep-2022 11:07                5878
function.geoip-isp-by-name.php                     30-Sep-2022 11:07                4472
function.geoip-netspeedcell-by-name.php            30-Sep-2022 11:07                5215
function.geoip-org-by-name.php                     30-Sep-2022 11:07                4484
function.geoip-record-by-name.php                  30-Sep-2022 11:07                7810
function.geoip-region-by-name.php                  30-Sep-2022 11:07                5117
function.geoip-region-name-by-code.php             30-Sep-2022 11:07                7332
function.geoip-setup-custom-directory.php          30-Sep-2022 11:07                4195
function.geoip-time-zone-by-country-and-region.php 30-Sep-2022 11:07                7601
function.get-browser.php                           30-Sep-2022 11:07                8453
function.get-called-class.php                      30-Sep-2022 11:08                5099
function.get-cfg-var.php                           30-Sep-2022 11:07                3751
function.get-class-methods.php                     30-Sep-2022 11:08                7421
function.get-class-vars.php                        30-Sep-2022 11:08               10501
function.get-class.php                             30-Sep-2022 11:08               13310
function.get-current-user.php                      30-Sep-2022 11:07                4381
function.get-debug-type.php                        30-Sep-2022 11:08                9873
function.get-declared-classes.php                  30-Sep-2022 11:08                5548
function.get-declared-interfaces.php               30-Sep-2022 11:08                4399
function.get-declared-traits.php                   30-Sep-2022 11:08                2957
function.get-defined-constants.php                 30-Sep-2022 11:07                7576
function.get-defined-functions.php                 30-Sep-2022 11:08                7008
function.get-defined-vars.php                      30-Sep-2022 11:08                6340
function.get-extension-funcs.php                   30-Sep-2022 11:07                5535
function.get-headers.php                           30-Sep-2022 11:08                9057
function.get-html-translation-table.php            30-Sep-2022 11:08               13851
function.get-include-path.php                      30-Sep-2022 11:07                4389
function.get-included-files.php                    30-Sep-2022 11:07                6274
function.get-loaded-extensions.php                 30-Sep-2022 11:07                5544
function.get-magic-quotes-gpc.php                  30-Sep-2022 11:07                4171
function.get-magic-quotes-runtime.php              30-Sep-2022 11:07                4911
function.get-mangled-object-vars.php               30-Sep-2022 11:08                8430
function.get-meta-tags.php                         30-Sep-2022 11:08                8081
function.get-object-vars.php                       30-Sep-2022 11:08                6454
function.get-parent-class.php                      30-Sep-2022 11:08                8162
function.get-required-files.php                    30-Sep-2022 11:07                1829
function.get-resource-id.php                       30-Sep-2022 11:08                4666
function.get-resource-type.php                     30-Sep-2022 11:08                5307
function.get-resources.php                         30-Sep-2022 11:07                7967
function.getallheaders.php                         30-Sep-2022 11:08                4888
function.getcwd.php                                30-Sep-2022 11:07                5542
function.getdate.php                               30-Sep-2022 11:07                9158
function.getenv.php                                30-Sep-2022 11:07                7811
function.gethostbyaddr.php                         30-Sep-2022 11:08                4411
function.gethostbyname.php                         30-Sep-2022 11:08                4629
function.gethostbynamel.php                        30-Sep-2022 11:08                5178
function.gethostname.php                           30-Sep-2022 11:08                4026
function.getimagesize.php                          30-Sep-2022 11:07               18396
function.getimagesizefromstring.php                30-Sep-2022 11:07                5589
function.getlastmod.php                            30-Sep-2022 11:07                5343
function.getmxrr.php                               30-Sep-2022 11:08                6140
function.getmygid.php                              30-Sep-2022 11:07                3459
function.getmyinode.php                            30-Sep-2022 11:07                3461
function.getmypid.php                              30-Sep-2022 11:07                3844
function.getmyuid.php                              30-Sep-2022 11:07                3423
function.getopt.php                                30-Sep-2022 11:07               16184
function.getprotobyname.php                        30-Sep-2022 11:08                4672
function.getprotobynumber.php                      30-Sep-2022 11:08                3181
function.getrandmax.php                            30-Sep-2022 11:07                2933
function.getrusage.php                             30-Sep-2022 11:07               12111
function.getservbyname.php                         30-Sep-2022 11:08                6599
function.getservbyport.php                         30-Sep-2022 11:08                3762
function.gettext.php                               30-Sep-2022 11:07                5982
function.gettimeofday.php                          30-Sep-2022 11:07                4531
function.gettype.php                               30-Sep-2022 11:08                9475
function.glob.php                                  30-Sep-2022 11:07               10341
function.gmdate.php                                30-Sep-2022 11:07                7725
function.gmmktime.php                              30-Sep-2022 11:07               10519
function.gmp-abs.php                               30-Sep-2022 11:07                4305
function.gmp-add.php                               30-Sep-2022 11:07                4474
function.gmp-and.php                               30-Sep-2022 11:07                4997
function.gmp-binomial.php                          30-Sep-2022 11:07                3746
function.gmp-clrbit.php                            30-Sep-2022 11:07                5777
function.gmp-cmp.php                               30-Sep-2022 11:07                5394
function.gmp-com.php                               30-Sep-2022 11:07                3786
function.gmp-div-q.php                             30-Sep-2022 11:07                9727
function.gmp-div-qr.php                            30-Sep-2022 11:07                6322
function.gmp-div-r.php                             30-Sep-2022 11:07                5771
function.gmp-div.php                               30-Sep-2022 11:07                1672
function.gmp-divexact.php                          30-Sep-2022 11:07                5684
function.gmp-export.php                            30-Sep-2022 11:07                5421
function.gmp-fact.php                              30-Sep-2022 11:07                4804
function.gmp-gcd.php                               30-Sep-2022 11:07                4951
function.gmp-gcdext.php                            30-Sep-2022 11:07                9496
function.gmp-hamdist.php                           30-Sep-2022 11:07                6331
function.gmp-import.php                            30-Sep-2022 11:07                5885
function.gmp-init.php                              30-Sep-2022 11:07                5493
function.gmp-intval.php                            30-Sep-2022 11:07                5161
function.gmp-invert.php                            30-Sep-2022 11:07                5087
function.gmp-jacobi.php                            30-Sep-2022 11:07                5455
function.gmp-kronecker.php                         30-Sep-2022 11:07                3732
function.gmp-lcm.php                               30-Sep-2022 11:07                3531
function.gmp-legendre.php                          30-Sep-2022 11:07                5471
function.gmp-mod.php                               30-Sep-2022 11:07                4655
function.gmp-mul.php                               30-Sep-2022 11:07                4691
function.gmp-neg.php                               30-Sep-2022 11:07                4294
function.gmp-nextprime.php                         30-Sep-2022 11:07                5007
function.gmp-or.php                                30-Sep-2022 11:07                5231
function.gmp-perfect-power.php                     30-Sep-2022 11:07                3127
function.gmp-perfect-square.php                    30-Sep-2022 11:07                5419
function.gmp-popcount.php                          30-Sep-2022 11:07                4769
function.gmp-pow.php                               30-Sep-2022 11:07                5702
function.gmp-powm.php                              30-Sep-2022 11:07                5496
function.gmp-prob-prime.php                        30-Sep-2022 11:07                5726
function.gmp-random-bits.php                       30-Sep-2022 11:07                4578
function.gmp-random-range.php                      30-Sep-2022 11:07                5482
function.gmp-random-seed.php                       30-Sep-2022 11:07                6732
function.gmp-random.php                            30-Sep-2022 11:07                5447
function.gmp-root.php                              30-Sep-2022 11:07                2948
function.gmp-rootrem.php                           30-Sep-2022 11:07                3090
function.gmp-scan0.php                             30-Sep-2022 11:07                5479
function.gmp-scan1.php                             30-Sep-2022 11:07                5531
function.gmp-setbit.php                            30-Sep-2022 11:07               12252
function.gmp-sign.php                              30-Sep-2022 11:07                4934
function.gmp-sqrt.php                              30-Sep-2022 11:07                4868
function.gmp-sqrtrem.php                           30-Sep-2022 11:07                6396
function.gmp-strval.php                            30-Sep-2022 11:07                4491
function.gmp-sub.php                               30-Sep-2022 11:07                4784
function.gmp-testbit.php                           30-Sep-2022 11:07                5719
function.gmp-xor.php                               30-Sep-2022 11:07                5247
function.gmstrftime.php                            30-Sep-2022 11:07                9275
function.gnupg-adddecryptkey.php                   30-Sep-2022 11:07                5106
function.gnupg-addencryptkey.php                   30-Sep-2022 11:07                4709
function.gnupg-addsignkey.php                      30-Sep-2022 11:07                5131
function.gnupg-cleardecryptkeys.php                30-Sep-2022 11:07                4297
function.gnupg-clearencryptkeys.php                30-Sep-2022 11:07                4305
function.gnupg-clearsignkeys.php                   30-Sep-2022 11:07                4247
function.gnupg-decrypt.php                         30-Sep-2022 11:07                5937
function.gnupg-decryptverify.php                   30-Sep-2022 11:07                6979
function.gnupg-deletekey.php                       30-Sep-2022 11:07                4922
function.gnupg-encrypt.php                         30-Sep-2022 11:07                5850
function.gnupg-encryptsign.php                     30-Sep-2022 11:07                6788
function.gnupg-export.php                          30-Sep-2022 11:07                5006
function.gnupg-getengineinfo.php                   30-Sep-2022 11:07                5553
function.gnupg-geterror.php                        30-Sep-2022 11:07                4172
function.gnupg-geterrorinfo.php                    30-Sep-2022 11:07                5652
function.gnupg-getprotocol.php                     30-Sep-2022 11:07                4312
function.gnupg-gettrustlist.php                    30-Sep-2022 11:07                5044
function.gnupg-import.php                          30-Sep-2022 11:07                5271
function.gnupg-init.php                            30-Sep-2022 11:07                7225
function.gnupg-keyinfo.php                         30-Sep-2022 11:07                5203
function.gnupg-listsignatures.php                  30-Sep-2022 11:07                5246
function.gnupg-setarmor.php                        30-Sep-2022 11:07                5609
function.gnupg-seterrormode.php                    30-Sep-2022 11:07                5473
function.gnupg-setsignmode.php                     30-Sep-2022 11:07                5394
function.gnupg-sign.php                            30-Sep-2022 11:07                6086
function.gnupg-verify.php                          30-Sep-2022 11:07                8276
function.grapheme-extract.php                      30-Sep-2022 11:07                9002
function.grapheme-stripos.php                      30-Sep-2022 11:07                8632
function.grapheme-stristr.php                      30-Sep-2022 11:07                8113
function.grapheme-strlen.php                       30-Sep-2022 11:07                5619
function.grapheme-strpos.php                       30-Sep-2022 11:07                8216
function.grapheme-strripos.php                     30-Sep-2022 11:07                8041
function.grapheme-strrpos.php                      30-Sep-2022 11:07                7622
function.grapheme-strstr.php                       30-Sep-2022 11:07                7645
function.grapheme-substr.php                       30-Sep-2022 11:07                8202
function.gregoriantojd.php                         30-Sep-2022 11:07                8039
function.gzclose.php                               30-Sep-2022 11:07                4250
function.gzcompress.php                            30-Sep-2022 11:07                5950
function.gzdecode.php                              30-Sep-2022 11:07                3630
function.gzdeflate.php                             30-Sep-2022 11:07                5560
function.gzencode.php                              30-Sep-2022 11:07                6993
function.gzeof.php                                 30-Sep-2022 11:07                4171
function.gzfile.php                                30-Sep-2022 11:07                4745
function.gzgetc.php                                30-Sep-2022 11:07                4791
function.gzgets.php                                30-Sep-2022 11:07                6332
function.gzgetss.php                               30-Sep-2022 11:07                6293
function.gzinflate.php                             30-Sep-2022 11:07                5507
function.gzopen.php                                30-Sep-2022 11:07                5818
function.gzpassthru.php                            30-Sep-2022 11:07                5005
function.gzputs.php                                30-Sep-2022 11:07                1639
function.gzread.php                                30-Sep-2022 11:07                6957
function.gzrewind.php                              30-Sep-2022 11:07                3347
function.gzseek.php                                30-Sep-2022 11:07                6594
function.gztell.php                                30-Sep-2022 11:07                3577
function.gzuncompress.php                          30-Sep-2022 11:07                5365
function.gzwrite.php                               30-Sep-2022 11:07                6709
function.halt-compiler.php                         30-Sep-2022 11:07                5205
function.hash-algos.php                            30-Sep-2022 11:07                5813
function.hash-copy.php                             30-Sep-2022 11:07                5551
function.hash-equals.php                           30-Sep-2022 11:07                6760
function.hash-file.php                             30-Sep-2022 11:07                7646
function.hash-final.php                            30-Sep-2022 11:07                6515
function.hash-hkdf.php                             30-Sep-2022 11:07                9209
function.hash-hmac-algos.php                       30-Sep-2022 11:07                5414
function.hash-hmac-file.php                        30-Sep-2022 11:07                7567
function.hash-hmac.php                             30-Sep-2022 11:07                7449
function.hash-init.php                             30-Sep-2022 11:07                8644
function.hash-pbkdf2.php                           30-Sep-2022 11:07               12269
function.hash-update-file.php                      30-Sep-2022 11:07                5924
function.hash-update-stream.php                    30-Sep-2022 11:07                7371
function.hash-update.php                           30-Sep-2022 11:07                4550
function.hash.php                                  30-Sep-2022 11:07                7352
function.header-register-callback.php              30-Sep-2022 11:08                7115
function.header-remove.php                         30-Sep-2022 11:08                6948
function.header.php                                30-Sep-2022 11:08               20194
function.headers-list.php                          30-Sep-2022 11:08                6410
function.headers-sent.php                          30-Sep-2022 11:08                8371
function.hebrev.php                                30-Sep-2022 11:08                3267
function.hebrevc.php                               30-Sep-2022 11:08                3743
function.hex2bin.php                               30-Sep-2022 11:08                4945
function.hexdec.php                                30-Sep-2022 11:07                6394
function.highlight-file.php                        30-Sep-2022 11:07                5495
function.highlight-string.php                      30-Sep-2022 11:07                5750
function.hrtime.php                                30-Sep-2022 11:07                4917
function.html-entity-decode.php                    30-Sep-2022 11:08               14909
function.htmlentities.php                          30-Sep-2022 11:08               17629
function.htmlspecialchars-decode.php               30-Sep-2022 11:08                8998
function.htmlspecialchars.php                      30-Sep-2022 11:08               21717
function.http-build-query.php                      30-Sep-2022 11:08               20969
function.http-response-code.php                    30-Sep-2022 11:08                7284
function.hypot.php                                 30-Sep-2022 11:07                2865
function.ibase-add-user.php                        30-Sep-2022 11:07                4673
function.ibase-affected-rows.php                   30-Sep-2022 11:07                3467
function.ibase-backup.php                          30-Sep-2022 11:07                9977
function.ibase-blob-add.php                        30-Sep-2022 11:07                3970
function.ibase-blob-cancel.php                     30-Sep-2022 11:07                3579
function.ibase-blob-close.php                      30-Sep-2022 11:07                4007
function.ibase-blob-create.php                     30-Sep-2022 11:07                3971
function.ibase-blob-echo.php                       30-Sep-2022 11:07                4007
function.ibase-blob-get.php                        30-Sep-2022 11:07                6668
function.ibase-blob-import.php                     30-Sep-2022 11:07                8457
function.ibase-blob-info.php                       30-Sep-2022 11:07                3257
function.ibase-blob-open.php                       30-Sep-2022 11:07                4224
function.ibase-close.php                           30-Sep-2022 11:07                3783
function.ibase-commit-ret.php                      30-Sep-2022 11:07                3185
function.ibase-commit.php                          30-Sep-2022 11:07                2983
function.ibase-connect.php                         30-Sep-2022 11:07               10615
function.ibase-db-info.php                         30-Sep-2022 11:07                2451
function.ibase-delete-user.php                     30-Sep-2022 11:07                3313
function.ibase-drop-db.php                         30-Sep-2022 11:07                3606
function.ibase-errcode.php                         30-Sep-2022 11:07                2634
function.ibase-errmsg.php                          30-Sep-2022 11:07                2637
function.ibase-execute.php                         30-Sep-2022 11:07                7174
function.ibase-fetch-assoc.php                     30-Sep-2022 11:07                4670
function.ibase-fetch-object.php                    30-Sep-2022 11:07                6631
function.ibase-fetch-row.php                       30-Sep-2022 11:07                4472
function.ibase-field-info.php                      30-Sep-2022 11:07                7132
function.ibase-free-event-handler.php              30-Sep-2022 11:07                3415
function.ibase-free-query.php                      30-Sep-2022 11:07                2647
function.ibase-free-result.php                     30-Sep-2022 11:07                2737
function.ibase-gen-id.php                          30-Sep-2022 11:07                2728
function.ibase-maintain-db.php                     30-Sep-2022 11:07                2801
function.ibase-modify-user.php                     30-Sep-2022 11:07                4678
function.ibase-name-result.php                     30-Sep-2022 11:07                5713
function.ibase-num-fields.php                      30-Sep-2022 11:07                6665
function.ibase-num-params.php                      30-Sep-2022 11:07                3407
function.ibase-param-info.php                      30-Sep-2022 11:07                3617
function.ibase-pconnect.php                        30-Sep-2022 11:07                7992
function.ibase-prepare.php                         30-Sep-2022 11:07                4014
function.ibase-query.php                           30-Sep-2022 11:07                7147
function.ibase-restore.php                         30-Sep-2022 11:07               10056
function.ibase-rollback-ret.php                    30-Sep-2022 11:07                3243
function.ibase-rollback.php                        30-Sep-2022 11:07                3055
function.ibase-server-info.php                     30-Sep-2022 11:07               10794
function.ibase-service-attach.php                  30-Sep-2022 11:07               12686
function.ibase-service-detach.php                  30-Sep-2022 11:07                6940
function.ibase-set-event-handler.php               30-Sep-2022 11:07                8053
function.ibase-trans.php                           30-Sep-2022 11:07                6058
function.ibase-wait-event.php                      30-Sep-2022 11:07                4047
function.iconv-get-encoding.php                    30-Sep-2022 11:07                5598
function.iconv-mime-decode-headers.php             30-Sep-2022 11:07               10904
function.iconv-mime-decode.php                     30-Sep-2022 11:07                8617
function.iconv-mime-encode.php                     30-Sep-2022 11:07               11911
function.iconv-set-encoding.php                    30-Sep-2022 11:07                4842
function.iconv-strlen.php                          30-Sep-2022 11:07                4851
function.iconv-strpos.php                          30-Sep-2022 11:07                7234
function.iconv-strrpos.php                         30-Sep-2022 11:07                6491
function.iconv-substr.php                          30-Sep-2022 11:07                8162
function.iconv.php                                 30-Sep-2022 11:07                9013
function.idate.php                                 30-Sep-2022 11:07               11372
function.idn-to-ascii.php                          30-Sep-2022 11:07                7298
function.idn-to-utf8.php                           30-Sep-2022 11:07                7290
function.igbinary-serialize.php                    30-Sep-2022 11:07               10498
function.igbinary-unserialize.php                  30-Sep-2022 11:07               10217
function.ignore-user-abort.php                     30-Sep-2022 11:07                7883
function.image-type-to-extension.php               30-Sep-2022 11:07                5223
function.image-type-to-mime-type.php               30-Sep-2022 11:07                7821
function.image2wbmp.php                            30-Sep-2022 11:07                6512
function.imageaffine.php                           30-Sep-2022 11:07                4734
function.imageaffinematrixconcat.php               30-Sep-2022 11:07                6553
function.imageaffinematrixget.php                  30-Sep-2022 11:07                6111
function.imagealphablending.php                    30-Sep-2022 11:07                7746
function.imageantialias.php                        30-Sep-2022 11:07               11497
function.imagearc.php                              30-Sep-2022 11:07               13805
function.imageavif.php                             30-Sep-2022 11:07                5960
function.imagebmp.php                              30-Sep-2022 11:07                7946
function.imagechar.php                             30-Sep-2022 11:07                9930
function.imagecharup.php                           30-Sep-2022 11:07                9864
function.imagecolorallocate.php                    30-Sep-2022 11:07               10065
function.imagecolorallocatealpha.php               30-Sep-2022 11:07               18785
function.imagecolorat.php                          30-Sep-2022 11:07               10385
function.imagecolorclosest.php                     30-Sep-2022 11:07               12472
function.imagecolorclosestalpha.php                30-Sep-2022 11:07               12950
function.imagecolorclosesthwb.php                  30-Sep-2022 11:07                6514
function.imagecolordeallocate.php                  30-Sep-2022 11:07                5855
function.imagecolorexact.php                       30-Sep-2022 11:07                8619
function.imagecolorexactalpha.php                  30-Sep-2022 11:07                9591
function.imagecolormatch.php                       30-Sep-2022 11:07                8708
function.imagecolorresolve.php                     30-Sep-2022 11:07                7745
function.imagecolorresolvealpha.php                30-Sep-2022 11:07                8448
function.imagecolorset.php                         30-Sep-2022 11:07                8815
function.imagecolorsforindex.php                   30-Sep-2022 11:07                7591
function.imagecolorstotal.php                      30-Sep-2022 11:07                5913
function.imagecolortransparent.php                 30-Sep-2022 11:07                9220
function.imageconvolution.php                      30-Sep-2022 11:07               12003
function.imagecopy.php                             30-Sep-2022 11:07                9261
function.imagecopymerge.php                        30-Sep-2022 11:07                9578
function.imagecopymergegray.php                    30-Sep-2022 11:07               10323
function.imagecopyresampled.php                    30-Sep-2022 11:07               19700
function.imagecopyresized.php                      30-Sep-2022 11:07               14293
function.imagecreate.php                           30-Sep-2022 11:07                8528
function.imagecreatefromavif.php                   30-Sep-2022 11:07                2831
function.imagecreatefrombmp.php                    30-Sep-2022 11:07                5699
function.imagecreatefromgd.php                     30-Sep-2022 11:07                6395
function.imagecreatefromgd2.php                    30-Sep-2022 11:07                6669
function.imagecreatefromgd2part.php                30-Sep-2022 11:07                9146
function.imagecreatefromgif.php                    30-Sep-2022 11:07               10518
function.imagecreatefromjpeg.php                   30-Sep-2022 11:07               10114
function.imagecreatefrompng.php                    30-Sep-2022 11:07               10064
function.imagecreatefromstring.php                 30-Sep-2022 11:07                8738
function.imagecreatefromtga.php                    30-Sep-2022 11:07                3571
function.imagecreatefromwbmp.php                   30-Sep-2022 11:07               10200
function.imagecreatefromwebp.php                   30-Sep-2022 11:07                5880
function.imagecreatefromxbm.php                    30-Sep-2022 11:07                5697
function.imagecreatefromxpm.php                    30-Sep-2022 11:07                6503
function.imagecreatetruecolor.php                  30-Sep-2022 11:07                7397
function.imagecrop.php                             30-Sep-2022 11:07                8115
function.imagecropauto.php                         30-Sep-2022 11:07               11949
function.imagedashedline.php                       30-Sep-2022 11:07               13517
function.imagedestroy.php                          30-Sep-2022 11:07                5296
function.imageellipse.php                          30-Sep-2022 11:07               10026
function.imagefill.php                             30-Sep-2022 11:07                7510
function.imagefilledarc.php                        30-Sep-2022 11:07               18587
function.imagefilledellipse.php                    30-Sep-2022 11:07                9725
function.imagefilledpolygon.php                    30-Sep-2022 11:07               12769
function.imagefilledrectangle.php                  30-Sep-2022 11:07                8286
function.imagefilltoborder.php                     30-Sep-2022 11:07               11468
function.imagefilter.php                           30-Sep-2022 11:07               34518
function.imageflip.php                             30-Sep-2022 11:07                9653
function.imagefontheight.php                       30-Sep-2022 11:07                6697
function.imagefontwidth.php                        30-Sep-2022 11:07                6652
function.imageftbbox.php                           30-Sep-2022 11:07               14602
function.imagefttext.php                           30-Sep-2022 11:07               16307
function.imagegammacorrect.php                     30-Sep-2022 11:07                5971
function.imagegd.php                               30-Sep-2022 11:07               11174
function.imagegd2.php                              30-Sep-2022 11:07               11743
function.imagegetclip.php                          30-Sep-2022 11:07                6130
function.imagegetinterpolation.php                 30-Sep-2022 11:07                3716
function.imagegif.php                              30-Sep-2022 11:07               17620
function.imagegrabscreen.php                       30-Sep-2022 11:07                4956
function.imagegrabwindow.php                       30-Sep-2022 11:07               10185
function.imageinterlace.php                        30-Sep-2022 11:07                7135
function.imageistruecolor.php                      30-Sep-2022 11:07                7775
function.imagejpeg.php                             30-Sep-2022 11:07               15579
function.imagelayereffect.php                      30-Sep-2022 11:07               12025
function.imageline.php                             30-Sep-2022 11:07               16399
function.imageloadfont.php                         30-Sep-2022 11:07                9828
function.imageopenpolygon.php                      30-Sep-2022 11:07               10604
function.imagepalettecopy.php                      30-Sep-2022 11:07                7808
function.imagepalettetotruecolor.php               30-Sep-2022 11:07               10481
function.imagepng.php                              30-Sep-2022 11:07                8940
function.imagepolygon.php                          30-Sep-2022 11:07               10940
function.imagerectangle.php                        30-Sep-2022 11:07               10537
function.imageresolution.php                       30-Sep-2022 11:07                7476
function.imagerotate.php                           30-Sep-2022 11:07                9549
function.imagesavealpha.php                        30-Sep-2022 11:07                6966
function.imagescale.php                            30-Sep-2022 11:07                6636
function.imagesetbrush.php                         30-Sep-2022 11:07                9494
function.imagesetclip.php                          30-Sep-2022 11:07                4949
function.imagesetinterpolation.php                 30-Sep-2022 11:07               10371
function.imagesetpixel.php                         30-Sep-2022 11:07               11709
function.imagesetstyle.php                         30-Sep-2022 11:07               12533
function.imagesetthickness.php                     30-Sep-2022 11:07                8529
function.imagesettile.php                          30-Sep-2022 11:07                8702
function.imagestring.php                           30-Sep-2022 11:07               10249
function.imagestringup.php                         30-Sep-2022 11:07                9367
function.imagesx.php                               30-Sep-2022 11:07                5258
function.imagesy.php                               30-Sep-2022 11:07                5284
function.imagetruecolortopalette.php               30-Sep-2022 11:07                6927
function.imagettfbbox.php                          30-Sep-2022 11:07               20583
function.imagettftext.php                          30-Sep-2022 11:07               19221
function.imagetypes.php                            30-Sep-2022 11:07                4728
function.imagewbmp.php                             30-Sep-2022 11:07               15619
function.imagewebp.php                             30-Sep-2022 11:07                7470
function.imagexbm.php                              30-Sep-2022 11:07               12219
function.imap-8bit.php                             30-Sep-2022 11:07                3018
function.imap-alerts.php                           30-Sep-2022 11:07                3274
function.imap-append.php                           30-Sep-2022 11:07               10272
function.imap-base64.php                           30-Sep-2022 11:07                3563
function.imap-binary.php                           30-Sep-2022 11:07                3034
function.imap-body.php                             30-Sep-2022 11:07                5515
function.imap-bodystruct.php                       30-Sep-2022 11:07                4700
function.imap-check.php                            30-Sep-2022 11:07                6233
function.imap-clearflag-full.php                   30-Sep-2022 11:07                5774
function.imap-close.php                            30-Sep-2022 11:07                4346
function.imap-create.php                           30-Sep-2022 11:07                1743
function.imap-createmailbox.php                    30-Sep-2022 11:07               15882
function.imap-delete.php                           30-Sep-2022 11:07               10142
function.imap-deletemailbox.php                    30-Sep-2022 11:07                5070
function.imap-errors.php                           30-Sep-2022 11:07                3493
function.imap-expunge.php                          30-Sep-2022 11:07                3654
function.imap-fetch-overview.php                   30-Sep-2022 11:07               11703
function.imap-fetchbody.php                        30-Sep-2022 11:07                6094
function.imap-fetchheader.php                      30-Sep-2022 11:07                5754
function.imap-fetchmime.php                        30-Sep-2022 11:07                6281
function.imap-fetchstructure.php                   30-Sep-2022 11:07                9764
function.imap-fetchtext.php                        30-Sep-2022 11:07                1724
function.imap-gc.php                               30-Sep-2022 11:07                5076
function.imap-get-quota.php                        30-Sep-2022 11:07               13282
function.imap-get-quotaroot.php                    30-Sep-2022 11:07                9813
function.imap-getacl.php                           30-Sep-2022 11:07                5994
function.imap-getmailboxes.php                     30-Sep-2022 11:07               13153
function.imap-getsubscribed.php                    30-Sep-2022 11:07                8129
function.imap-header.php                           30-Sep-2022 11:07                1973
function.imap-headerinfo.php                       30-Sep-2022 11:07               12246
function.imap-headers.php                          30-Sep-2022 11:07                3592
function.imap-last-error.php                       30-Sep-2022 11:07                3147
function.imap-list.php                             30-Sep-2022 11:07                9270
function.imap-listmailbox.php                      30-Sep-2022 11:07                1729
function.imap-listscan.php                         30-Sep-2022 11:07                7096
function.imap-listsubscribed.php                   30-Sep-2022 11:07                1750
function.imap-lsub.php                             30-Sep-2022 11:07                6294
function.imap-mail-compose.php                     30-Sep-2022 11:07               15095
function.imap-mail-copy.php                        30-Sep-2022 11:07                6296
function.imap-mail-move.php                        30-Sep-2022 11:07                6809
function.imap-mail.php                             30-Sep-2022 11:07                6873
function.imap-mailboxmsginfo.php                   30-Sep-2022 11:07               10373
function.imap-mime-header-decode.php               30-Sep-2022 11:07                6602
function.imap-msgno.php                            30-Sep-2022 11:07                4173
function.imap-mutf7-to-utf8.php                    30-Sep-2022 11:07                3238
function.imap-num-msg.php                          30-Sep-2022 11:07                4161
function.imap-num-recent.php                       30-Sep-2022 11:07                4009
function.imap-open.php                             30-Sep-2022 11:07               23561
function.imap-ping.php                             30-Sep-2022 11:07                5038
function.imap-qprint.php                           30-Sep-2022 11:07                3034
function.imap-rename.php                           30-Sep-2022 11:07                1746
function.imap-renamemailbox.php                    30-Sep-2022 11:07                5750
function.imap-reopen.php                           30-Sep-2022 11:07                8803
function.imap-rfc822-parse-adrlist.php             30-Sep-2022 11:07                8263
function.imap-rfc822-parse-headers.php             30-Sep-2022 11:07                3702
function.imap-rfc822-write-address.php             30-Sep-2022 11:07                5328
function.imap-savebody.php                         30-Sep-2022 11:07                6257
function.imap-scan.php                             30-Sep-2022 11:07                1711
function.imap-scanmailbox.php                      30-Sep-2022 11:07                1741
function.imap-search.php                           30-Sep-2022 11:07               14294
function.imap-set-quota.php                        30-Sep-2022 11:07                6988
function.imap-setacl.php                           30-Sep-2022 11:07                5449
function.imap-setflag-full.php                     30-Sep-2022 11:07                8080
function.imap-sort.php                             30-Sep-2022 11:07                7879
function.imap-status.php                           30-Sep-2022 11:07               11229
function.imap-subscribe.php                        30-Sep-2022 11:07                4471
function.imap-thread.php                           30-Sep-2022 11:07                8176
function.imap-timeout.php                          30-Sep-2022 11:07                4395
function.imap-uid.php                              30-Sep-2022 11:07                4664
function.imap-undelete.php                         30-Sep-2022 11:07                5053
function.imap-unsubscribe.php                      30-Sep-2022 11:07                4566
function.imap-utf7-decode.php                      30-Sep-2022 11:07                3762
function.imap-utf7-encode.php                      30-Sep-2022 11:07                3288
function.imap-utf8-to-mutf7.php                    30-Sep-2022 11:07                3244
function.imap-utf8.php                             30-Sep-2022 11:07                4369
function.implode.php                               30-Sep-2022 11:08                7719
function.in-array.php                              30-Sep-2022 11:08               12186
function.include-once.php                          30-Sep-2022 11:07                2346
function.include.php                               30-Sep-2022 11:07               22770
function.inet-ntop.php                             30-Sep-2022 11:08                6447
function.inet-pton.php                             30-Sep-2022 11:08                4929
function.inflate-add.php                           30-Sep-2022 11:07                5858
function.inflate-get-read-len.php                  30-Sep-2022 11:07                3460
function.inflate-get-status.php                    30-Sep-2022 11:07                3291
function.inflate-init.php                          30-Sep-2022 11:07                6890
function.ini-alter.php                             30-Sep-2022 11:07                1688
function.ini-get-all.php                           30-Sep-2022 11:07               10215
function.ini-get.php                               30-Sep-2022 11:07               11186
function.ini-restore.php                           30-Sep-2022 11:07                6488
function.ini-set.php                               30-Sep-2022 11:07                6448
function.inotify-add-watch.php                     30-Sep-2022 11:07                4125
function.inotify-init.php                          30-Sep-2022 11:07                9500
function.inotify-queue-len.php                     30-Sep-2022 11:07                3912
function.inotify-read.php                          30-Sep-2022 11:07                4668
function.inotify-rm-watch.php                      30-Sep-2022 11:07                3480
function.intdiv.php                                30-Sep-2022 11:07                7280
function.interface-exists.php                      30-Sep-2022 11:08                5552
function.intl-error-name.php                       30-Sep-2022 11:07                5137
function.intl-get-error-code.php                   30-Sep-2022 11:07                4802
function.intl-get-error-message.php                30-Sep-2022 11:07                4770
function.intl-is-failure.php                       30-Sep-2022 11:07                5621
function.intval.php                                30-Sep-2022 11:08               14296
function.ip2long.php                               30-Sep-2022 11:08                9705
function.iptcembed.php                             30-Sep-2022 11:07               12943
function.iptcparse.php                             30-Sep-2022 11:07                4601
function.is-a.php                                  30-Sep-2022 11:08                7170
function.is-array.php                              30-Sep-2022 11:08                5799
function.is-bool.php                               30-Sep-2022 11:08                5724
function.is-callable.php                           30-Sep-2022 11:08               11483
function.is-countable.php                          30-Sep-2022 11:08                6354
function.is-dir.php                                30-Sep-2022 11:07                6829
function.is-double.php                             30-Sep-2022 11:08                1677
function.is-executable.php                         30-Sep-2022 11:07                6771
function.is-file.php                               30-Sep-2022 11:07                6187
function.is-finite.php                             30-Sep-2022 11:07                3153
function.is-float.php                              30-Sep-2022 11:08                5227
function.is-infinite.php                           30-Sep-2022 11:07                3292
function.is-int.php                                30-Sep-2022 11:08                6772
function.is-integer.php                            30-Sep-2022 11:08                1670
function.is-iterable.php                           30-Sep-2022 11:08                5835
function.is-link.php                               30-Sep-2022 11:07                5854
function.is-long.php                               30-Sep-2022 11:08                1651
function.is-nan.php                                30-Sep-2022 11:07                4576
function.is-null.php                               30-Sep-2022 11:08                5913
function.is-numeric.php                            30-Sep-2022 11:08               13077
function.is-object.php                             30-Sep-2022 11:08                7385
function.is-readable.php                           30-Sep-2022 11:07                6649
function.is-real.php                               30-Sep-2022 11:08                1907
function.is-resource.php                           30-Sep-2022 11:08                5016
function.is-scalar.php                             30-Sep-2022 11:08                8007
function.is-soap-fault.php                         30-Sep-2022 11:08                8597
function.is-string.php                             30-Sep-2022 11:08                6789
function.is-subclass-of.php                        30-Sep-2022 11:08               13647
function.is-tainted.php                            30-Sep-2022 11:08                2309
function.is-uploaded-file.php                      30-Sep-2022 11:07                7110
function.is-writable.php                           30-Sep-2022 11:07                6266
function.is-writeable.php                          30-Sep-2022 11:07                1738
function.isset.php                                 30-Sep-2022 11:08               17122
function.iterator-apply.php                        30-Sep-2022 11:07                6855
function.iterator-count.php                        30-Sep-2022 11:07                7935
function.iterator-to-array.php                     30-Sep-2022 11:07                6493
function.jddayofweek.php                           30-Sep-2022 11:07                3567
function.jdmonthname.php                           30-Sep-2022 11:07                4527
function.jdtofrench.php                            30-Sep-2022 11:07                3066
function.jdtogregorian.php                         30-Sep-2022 11:07                3142
function.jdtojewish.php                            30-Sep-2022 11:07                7239
function.jdtojulian.php                            30-Sep-2022 11:07                3077
function.jdtounix.php                              30-Sep-2022 11:07                4520
function.jewishtojd.php                            30-Sep-2022 11:07                4637
function.join.php                                  30-Sep-2022 11:08                1633
function.jpeg2wbmp.php                             30-Sep-2022 11:07                6421
function.json-decode.php                           30-Sep-2022 11:07               20554
function.json-encode.php                           30-Sep-2022 11:07               30885
function.json-last-error-msg.php                   30-Sep-2022 11:07                3042
function.json-last-error.php                       30-Sep-2022 11:07               14998
function.juliantojd.php                            30-Sep-2022 11:07                4669
function.key-exists.php                            30-Sep-2022 11:08                1709
function.key.php                                   30-Sep-2022 11:08                7498
function.krsort.php                                30-Sep-2022 11:08                7913
function.ksort.php                                 30-Sep-2022 11:08                9858
function.lcfirst.php                               30-Sep-2022 11:08                5570
function.lcg-value.php                             30-Sep-2022 11:07                3566
function.lchgrp.php                                30-Sep-2022 11:07                6093
function.lchown.php                                30-Sep-2022 11:07                5910
function.ldap-8859-to-t61.php                      30-Sep-2022 11:08                3221
function.ldap-add-ext.php                          30-Sep-2022 11:08                5866
function.ldap-add.php                              30-Sep-2022 11:08               10909
function.ldap-bind-ext.php                         30-Sep-2022 11:08                5861
function.ldap-bind.php                             30-Sep-2022 11:08               10060
function.ldap-close.php                            30-Sep-2022 11:08                1694
function.ldap-compare.php                          30-Sep-2022 11:08               11227
function.ldap-connect.php                          30-Sep-2022 11:08               10112
function.ldap-control-paged-result-response.php    30-Sep-2022 11:08                5728
function.ldap-control-paged-result.php             30-Sep-2022 11:08               16042
function.ldap-count-entries.php                    30-Sep-2022 11:08                6079
function.ldap-count-references.php                 30-Sep-2022 11:08                4856
function.ldap-delete-ext.php                       30-Sep-2022 11:08                5419
function.ldap-delete.php                           30-Sep-2022 11:08                5295
function.ldap-dn2ufn.php                           30-Sep-2022 11:08                2653
function.ldap-err2str.php                          30-Sep-2022 11:08                4857
function.ldap-errno.php                            30-Sep-2022 11:08                8050
function.ldap-error.php                            30-Sep-2022 11:08                4781
function.ldap-escape.php                           30-Sep-2022 11:08                6550
function.ldap-exop-passwd.php                      30-Sep-2022 11:08               11233
function.ldap-exop-refresh.php                     30-Sep-2022 11:08                5210
function.ldap-exop-whoami.php                      30-Sep-2022 11:08                3971
function.ldap-exop.php                             30-Sep-2022 11:08               13157
function.ldap-explode-dn.php                       30-Sep-2022 11:08                3559
function.ldap-first-attribute.php                  30-Sep-2022 11:08                6421
function.ldap-first-entry.php                      30-Sep-2022 11:08                6214
function.ldap-first-reference.php                  30-Sep-2022 11:08                2403
function.ldap-free-result.php                      30-Sep-2022 11:08                4202
function.ldap-get-attributes.php                   30-Sep-2022 11:08                8954
function.ldap-get-dn.php                           30-Sep-2022 11:08                4423
function.ldap-get-entries.php                      30-Sep-2022 11:08                6336
function.ldap-get-option.php                       30-Sep-2022 11:08               13057
function.ldap-get-values-len.php                   30-Sep-2022 11:08                5647
function.ldap-get-values.php                       30-Sep-2022 11:08                9433
function.ldap-list.php                             30-Sep-2022 11:08               15614
function.ldap-mod-add.php                          30-Sep-2022 11:08                6799
function.ldap-mod-del.php                          30-Sep-2022 11:08                6270
function.ldap-mod-replace.php                      30-Sep-2022 11:08                6721
function.ldap-mod_add-ext.php                      30-Sep-2022 11:08                5817
function.ldap-mod_del-ext.php                      30-Sep-2022 11:08                5832
function.ldap-mod_replace-ext.php                  30-Sep-2022 11:08                5897
function.ldap-modify-batch.php                     30-Sep-2022 11:08               21155
function.ldap-modify.php                           30-Sep-2022 11:08                2108
function.ldap-next-attribute.php                   30-Sep-2022 11:08                5834
function.ldap-next-entry.php                       30-Sep-2022 11:08                6151
function.ldap-next-reference.php                   30-Sep-2022 11:08                2374
function.ldap-parse-exop.php                       30-Sep-2022 11:08                5901
function.ldap-parse-reference.php                  30-Sep-2022 11:08                2372
function.ldap-parse-result.php                     30-Sep-2022 11:08                9634
function.ldap-read.php                             30-Sep-2022 11:08               12927
function.ldap-rename-ext.php                       30-Sep-2022 11:08                6062
function.ldap-rename.php                           30-Sep-2022 11:08                7084
function.ldap-sasl-bind.php                        30-Sep-2022 11:08                6174
function.ldap-search.php                           30-Sep-2022 11:08               15927
function.ldap-set-option.php                       30-Sep-2022 11:08               16327
function.ldap-set-rebind-proc.php                  30-Sep-2022 11:08                3274
function.ldap-sort.php                             30-Sep-2022 11:08                7558
function.ldap-start-tls.php                        30-Sep-2022 11:08                2006
function.ldap-t61-to-8859.php                      30-Sep-2022 11:08                2058
function.ldap-unbind.php                           30-Sep-2022 11:08                3871
function.levenshtein.php                           30-Sep-2022 11:08               13336
function.libxml-clear-errors.php                   30-Sep-2022 11:08                2900
function.libxml-disable-entity-loader.php          30-Sep-2022 11:08                5011
function.libxml-get-errors.php                     30-Sep-2022 11:08               12076
function.libxml-get-last-error.php                 30-Sep-2022 11:08                3221
function.libxml-set-external-entity-loader.php     30-Sep-2022 11:08               10317
function.libxml-set-streams-context.php            30-Sep-2022 11:08                5257
function.libxml-use-internal-errors.php            30-Sep-2022 11:08                6824
function.link.php                                  30-Sep-2022 11:07                6014
function.linkinfo.php                              30-Sep-2022 11:07                4605
function.list.php                                  30-Sep-2022 11:08               17967
function.localeconv.php                            30-Sep-2022 11:08                9441
function.localtime.php                             30-Sep-2022 11:07                9141
function.log.php                                   30-Sep-2022 11:07                3724
function.log10.php                                 30-Sep-2022 11:07                2593
function.log1p.php                                 30-Sep-2022 11:07                3402
function.long2ip.php                               30-Sep-2022 11:08                4221
function.lstat.php                                 30-Sep-2022 11:07                6663
function.ltrim.php                                 30-Sep-2022 11:08                9711
function.lzf-compress.php                          30-Sep-2022 11:07                2834
function.lzf-decompress.php                        30-Sep-2022 11:07                2882
function.lzf-optimized-for.php                     30-Sep-2022 11:07                2268
function.mail.php                                  30-Sep-2022 11:07               28866
function.mailparse-determine-best-xfer-encoding..> 30-Sep-2022 11:07                4306
function.mailparse-msg-create.php                  30-Sep-2022 11:07                3464
function.mailparse-msg-extract-part-file.php       30-Sep-2022 11:07                5261
function.mailparse-msg-extract-part.php            30-Sep-2022 11:07                4103
function.mailparse-msg-extract-whole-part-file.php 30-Sep-2022 11:07                4092
function.mailparse-msg-free.php                    30-Sep-2022 11:07                3524
function.mailparse-msg-get-part-data.php           30-Sep-2022 11:07                2496
function.mailparse-msg-get-part.php                30-Sep-2022 11:07                2745
function.mailparse-msg-get-structure.php           30-Sep-2022 11:07                2526
function.mailparse-msg-parse-file.php              30-Sep-2022 11:07                4368
function.mailparse-msg-parse.php                   30-Sep-2022 11:07                3459
function.mailparse-rfc822-parse-addresses.php      30-Sep-2022 11:07                5579
function.mailparse-stream-encode.php               30-Sep-2022 11:07                5915
function.mailparse-uudecode-all.php                30-Sep-2022 11:07                7056
function.max.php                                   30-Sep-2022 11:07               12843
function.mb-check-encoding.php                     30-Sep-2022 11:07                4471
function.mb-chr.php                                30-Sep-2022 11:07                7206
function.mb-convert-case.php                       30-Sep-2022 11:07               11471
function.mb-convert-encoding.php                   30-Sep-2022 11:07               11059
function.mb-convert-kana.php                       30-Sep-2022 11:07                9125
function.mb-convert-variables.php                  30-Sep-2022 11:07                6661
function.mb-decode-mimeheader.php                  30-Sep-2022 11:07                3043
function.mb-decode-numericentity.php               30-Sep-2022 11:07               36256
function.mb-detect-encoding.php                    30-Sep-2022 11:07               16410
function.mb-detect-order.php                       30-Sep-2022 11:07                9058
function.mb-encode-mimeheader.php                  30-Sep-2022 11:07                9600
function.mb-encode-numericentity.php               30-Sep-2022 11:07               13169
function.mb-encoding-aliases.php                   30-Sep-2022 11:07                5866
function.mb-ereg-match.php                         30-Sep-2022 11:07                5439
function.mb-ereg-replace-callback.php              30-Sep-2022 11:07               13463
function.mb-ereg-replace.php                       30-Sep-2022 11:07                7078
function.mb-ereg-search-getpos.php                 30-Sep-2022 11:07                4003
function.mb-ereg-search-getregs.php                30-Sep-2022 11:07                4418
function.mb-ereg-search-init.php                   30-Sep-2022 11:07                6001
function.mb-ereg-search-pos.php                    30-Sep-2022 11:07                5845
function.mb-ereg-search-regs.php                   30-Sep-2022 11:07                5661
function.mb-ereg-search-setpos.php                 30-Sep-2022 11:07                4560
function.mb-ereg-search.php                        30-Sep-2022 11:07                5545
function.mb-ereg.php                               30-Sep-2022 11:07                6678
function.mb-eregi-replace.php                      30-Sep-2022 11:07                6796
function.mb-eregi.php                              30-Sep-2022 11:07                6745
function.mb-get-info.php                           30-Sep-2022 11:07                6120
function.mb-http-input.php                         30-Sep-2022 11:07                5063
function.mb-http-output.php                        30-Sep-2022 11:07                4994
function.mb-internal-encoding.php                  30-Sep-2022 11:07                7220
function.mb-language.php                           30-Sep-2022 11:07                6440
function.mb-list-encodings.php                     30-Sep-2022 11:07                5143
function.mb-ord.php                                30-Sep-2022 11:07                6742
function.mb-output-handler.php                     30-Sep-2022 11:07                5249
function.mb-parse-str.php                          30-Sep-2022 11:07                4613
function.mb-preferred-mime-name.php                30-Sep-2022 11:07                4373
function.mb-regex-encoding.php                     30-Sep-2022 11:07                4422
function.mb-regex-set-options.php                  30-Sep-2022 11:07                7512
function.mb-scrub.php                              30-Sep-2022 11:07                3273
function.mb-send-mail.php                          30-Sep-2022 11:07               10301
function.mb-split.php                              30-Sep-2022 11:07                4475
function.mb-str-split.php                          30-Sep-2022 11:07                5240
function.mb-strcut.php                             30-Sep-2022 11:07                7618
function.mb-strimwidth.php                         30-Sep-2022 11:07                7231
function.mb-stripos.php                            30-Sep-2022 11:07                6330
function.mb-stristr.php                            30-Sep-2022 11:07                6567
function.mb-strlen.php                             30-Sep-2022 11:07                4880
function.mb-strpos.php                             30-Sep-2022 11:07                6184
function.mb-strrchr.php                            30-Sep-2022 11:07                6331
function.mb-strrichr.php                           30-Sep-2022 11:07                6415
function.mb-strripos.php                           30-Sep-2022 11:07                6251
function.mb-strrpos.php                            30-Sep-2022 11:07                6491
function.mb-strstr.php                             30-Sep-2022 11:07                6330
function.mb-strtolower.php                         30-Sep-2022 11:07                7327
function.mb-strtoupper.php                         30-Sep-2022 11:07                7336
function.mb-strwidth.php                           30-Sep-2022 11:07                9051
function.mb-substitute-character.php               30-Sep-2022 11:07                6826
function.mb-substr-count.php                       30-Sep-2022 11:07                5685
function.mb-substr.php                             30-Sep-2022 11:07                6370
function.mcrypt-create-iv.php                      30-Sep-2022 11:07                6561
function.mcrypt-decrypt.php                        30-Sep-2022 11:07                5602
function.mcrypt-enc-get-algorithms-name.php        30-Sep-2022 11:07                5300
function.mcrypt-enc-get-block-size.php             30-Sep-2022 11:07                2931
function.mcrypt-enc-get-iv-size.php                30-Sep-2022 11:07                3304
function.mcrypt-enc-get-key-size.php               30-Sep-2022 11:07                3023
function.mcrypt-enc-get-modes-name.php             30-Sep-2022 11:07                5234
function.mcrypt-enc-get-supported-key-sizes.php    30-Sep-2022 11:07                5088
function.mcrypt-enc-is-block-algorithm-mode.php    30-Sep-2022 11:07                3435
function.mcrypt-enc-is-block-algorithm.php         30-Sep-2022 11:07                3269
function.mcrypt-enc-is-block-mode.php              30-Sep-2022 11:07                3272
function.mcrypt-enc-self-test.php                  30-Sep-2022 11:07                3051
function.mcrypt-encrypt.php                        30-Sep-2022 11:07               16088
function.mcrypt-generic-deinit.php                 30-Sep-2022 11:07                4001
function.mcrypt-generic-init.php                   30-Sep-2022 11:07                5360
function.mcrypt-generic.php                        30-Sep-2022 11:07                6328
function.mcrypt-get-block-size.php                 30-Sep-2022 11:07                6625
function.mcrypt-get-cipher-name.php                30-Sep-2022 11:07                4829
function.mcrypt-get-iv-size.php                    30-Sep-2022 11:07                6553
function.mcrypt-get-key-size.php                   30-Sep-2022 11:07                6803
function.mcrypt-list-algorithms.php                30-Sep-2022 11:07                4850
function.mcrypt-list-modes.php                     30-Sep-2022 11:07                4920
function.mcrypt-module-close.php                   30-Sep-2022 11:07                3371
function.mcrypt-module-get-algo-block-size.php     30-Sep-2022 11:07                3523
function.mcrypt-module-get-algo-key-size.php       30-Sep-2022 11:07                3601
function.mcrypt-module-get-supported-key-sizes.php 30-Sep-2022 11:07                4849
function.mcrypt-module-is-block-algorithm-mode.php 30-Sep-2022 11:07                4159
function.mcrypt-module-is-block-algorithm.php      30-Sep-2022 11:07                3924
function.mcrypt-module-is-block-mode.php           30-Sep-2022 11:07                4185
function.mcrypt-module-open.php                    30-Sep-2022 11:07               15552
function.mcrypt-module-self-test.php               30-Sep-2022 11:07                4929
function.md5-file.php                              30-Sep-2022 11:08                5108
function.md5.php                                   30-Sep-2022 11:08                6149
function.mdecrypt-generic.php                      30-Sep-2022 11:07               12116
function.memcache-debug.php                        30-Sep-2022 11:08                3445
function.memory-get-peak-usage.php                 30-Sep-2022 11:07                3636
function.memory-get-usage.php                      30-Sep-2022 11:07                5623
function.memory-reset-peak-usage.php               30-Sep-2022 11:07                5027
function.metaphone.php                             30-Sep-2022 11:08                8275
function.method-exists.php                         30-Sep-2022 11:08                6540
function.mhash-count.php                           30-Sep-2022 11:07                4927
function.mhash-get-block-size.php                  30-Sep-2022 11:07                4545
function.mhash-get-hash-name.php                   30-Sep-2022 11:07                4497
function.mhash-keygen-s2k.php                      30-Sep-2022 11:07                5861
function.mhash.php                                 30-Sep-2022 11:07                4636
function.microtime.php                             30-Sep-2022 11:07                7938
function.mime-content-type.php                     30-Sep-2022 11:07                4900
function.min.php                                   30-Sep-2022 11:07               13458
function.mkdir.php                                 30-Sep-2022 11:07                9427
function.mktime.php                                30-Sep-2022 11:07               18677
function.money-format.php                          30-Sep-2022 11:08               19808
function.mongodb.bson-fromjson.php                 30-Sep-2022 11:07                5829
function.mongodb.bson-fromphp.php                  30-Sep-2022 11:07                5815
function.mongodb.bson-tocanonicalextendedjson.php  30-Sep-2022 11:07               16215
function.mongodb.bson-tojson.php                   30-Sep-2022 11:07               17702
function.mongodb.bson-tophp.php                    30-Sep-2022 11:07                8726
function.mongodb.bson-torelaxedextendedjson.php    30-Sep-2022 11:07               15914
function.mongodb.driver.monitoring.addsubscribe..> 30-Sep-2022 11:07                5137
function.mongodb.driver.monitoring.removesubscr..> 30-Sep-2022 11:07                4997
function.move-uploaded-file.php                    30-Sep-2022 11:07                9204
function.mqseries-back.php                         30-Sep-2022 11:08                6640
function.mqseries-begin.php                        30-Sep-2022 11:08                8094
function.mqseries-close.php                        30-Sep-2022 11:08                6631
function.mqseries-cmit.php                         30-Sep-2022 11:08                6581
function.mqseries-conn.php                         30-Sep-2022 11:08                6054
function.mqseries-connx.php                        30-Sep-2022 11:08               14330
function.mqseries-disc.php                         30-Sep-2022 11:08                5689
function.mqseries-get.php                          30-Sep-2022 11:08               13117
function.mqseries-inq.php                          30-Sep-2022 11:08                9207
function.mqseries-open.php                         30-Sep-2022 11:08                7730
function.mqseries-put.php                          30-Sep-2022 11:08               14210
function.mqseries-put1.php                         30-Sep-2022 11:08                5899
function.mqseries-set.php                          30-Sep-2022 11:08                5636
function.mqseries-strerror.php                     30-Sep-2022 11:08                4339
function.msg-get-queue.php                         30-Sep-2022 11:07                5871
function.msg-queue-exists.php                      30-Sep-2022 11:07                3365
function.msg-receive.php                           30-Sep-2022 11:07               11687
function.msg-remove-queue.php                      30-Sep-2022 11:07                4720
function.msg-send.php                              30-Sep-2022 11:07                9361
function.msg-set-queue.php                         30-Sep-2022 11:07                5296
function.msg-stat-queue.php                        30-Sep-2022 11:07                6840
function.mt-getrandmax.php                         30-Sep-2022 11:07                5644
function.mt-rand.php                               30-Sep-2022 11:07               10786
function.mt-srand.php                              30-Sep-2022 11:07                8237
function.mysql-affected-rows.php                   30-Sep-2022 11:07               12701
function.mysql-client-encoding.php                 30-Sep-2022 11:07                6245
function.mysql-close.php                           30-Sep-2022 11:07                7562
function.mysql-connect.php                         30-Sep-2022 11:07               17870
function.mysql-create-db.php                       30-Sep-2022 11:07                8659
function.mysql-data-seek.php                       30-Sep-2022 11:07               12596
function.mysql-db-name.php                         30-Sep-2022 11:07                7923
function.mysql-db-query.php                        30-Sep-2022 11:07               10537
function.mysql-drop-db.php                         30-Sep-2022 11:07                7862
function.mysql-errno.php                           30-Sep-2022 11:07                8536
function.mysql-error.php                           30-Sep-2022 11:07                8450
function.mysql-escape-string.php                   30-Sep-2022 11:07                6983
function.mysql-fetch-array.php                     30-Sep-2022 11:07               15930
function.mysql-fetch-assoc.php                     30-Sep-2022 11:07               12270
function.mysql-fetch-field.php                     30-Sep-2022 11:07               13953
function.mysql-fetch-lengths.php                   30-Sep-2022 11:07                7763
function.mysql-fetch-object.php                    30-Sep-2022 11:07               11890
function.mysql-fetch-row.php                       30-Sep-2022 11:07                7717
function.mysql-field-flags.php                     30-Sep-2022 11:07                8681
function.mysql-field-len.php                       30-Sep-2022 11:07                7063
function.mysql-field-name.php                      30-Sep-2022 11:07                9356
function.mysql-field-seek.php                      30-Sep-2022 11:07                5030
function.mysql-field-table.php                     30-Sep-2022 11:07                7892
function.mysql-field-type.php                      30-Sep-2022 11:07               12194
function.mysql-free-result.php                     30-Sep-2022 11:07                7861
function.mysql-get-client-info.php                 30-Sep-2022 11:07                5130
function.mysql-get-host-info.php                   30-Sep-2022 11:07                6903
function.mysql-get-proto-info.php                  30-Sep-2022 11:07                6637
function.mysql-get-server-info.php                 30-Sep-2022 11:07                7020
function.mysql-info.php                            30-Sep-2022 11:07                6245
function.mysql-insert-id.php                       30-Sep-2022 11:07                8458
function.mysql-list-dbs.php                        30-Sep-2022 11:07                8933
function.mysql-list-fields.php                     30-Sep-2022 11:07                8970
function.mysql-list-processes.php                  30-Sep-2022 11:07                7637
function.mysql-list-tables.php                     30-Sep-2022 11:07                9861
function.mysql-num-fields.php                      30-Sep-2022 11:07                6701
function.mysql-num-rows.php                        30-Sep-2022 11:07                8189
function.mysql-pconnect.php                        30-Sep-2022 11:07                8411
function.mysql-ping.php                            30-Sep-2022 11:07                8135
function.mysql-query.php                           30-Sep-2022 11:07               14661
function.mysql-real-escape-string.php              30-Sep-2022 11:07               17479
function.mysql-result.php                          30-Sep-2022 11:07               10106
function.mysql-select-db.php                       30-Sep-2022 11:07                7859
function.mysql-set-charset.php                     30-Sep-2022 11:07                5885
function.mysql-stat.php                            30-Sep-2022 11:07                9408
function.mysql-tablename.php                       30-Sep-2022 11:07                8216
function.mysql-thread-id.php                       30-Sep-2022 11:07                6735
function.mysql-unbuffered-query.php                30-Sep-2022 11:07                7001
function.mysql-xdevapi-expression.php              30-Sep-2022 11:07                4859
function.mysql-xdevapi-getsession.php              30-Sep-2022 11:07               14299
function.mysqli-connect.php                        30-Sep-2022 11:07                2376
function.mysqli-escape-string.php                  30-Sep-2022 11:07                1951
function.mysqli-execute.php                        30-Sep-2022 11:07                2543
function.mysqli-get-client-stats.php               30-Sep-2022 11:07                8346
function.mysqli-get-links-stats.php                30-Sep-2022 11:07                3260
function.mysqli-report.php                         30-Sep-2022 11:07                1753
function.mysqli-set-opt.php                        30-Sep-2022 11:07                1842
function.natcasesort.php                           30-Sep-2022 11:08                7360
function.natsort.php                               30-Sep-2022 11:08               10596
function.net-get-interfaces.php                    30-Sep-2022 11:08                4839
function.next.php                                  30-Sep-2022 11:08                9225
function.ngettext.php                              30-Sep-2022 11:07                5672
function.nl-langinfo.php                           30-Sep-2022 11:08               15531
function.nl2br.php                                 30-Sep-2022 11:08                6833
function.number-format.php                         30-Sep-2022 11:08                8956
function.oauth-get-sbs.php                         30-Sep-2022 11:08                2870
function.oauth-urlencode.php                       30-Sep-2022 11:08                2543
function.ob-clean.php                              30-Sep-2022 11:07                3757
function.ob-end-clean.php                          30-Sep-2022 11:07                5589
function.ob-end-flush.php                          30-Sep-2022 11:07                6493
function.ob-flush.php                              30-Sep-2022 11:07                3936
function.ob-get-clean.php                          30-Sep-2022 11:07                5557
function.ob-get-contents.php                       30-Sep-2022 11:07                4787
function.ob-get-flush.php                          30-Sep-2022 11:07                6099
function.ob-get-length.php                         30-Sep-2022 11:07                4756
function.ob-get-level.php                          30-Sep-2022 11:07                2886
function.ob-get-status.php                         30-Sep-2022 11:07                7297
function.ob-gzhandler.php                          30-Sep-2022 11:07                6195
function.ob-iconv-handler.php                      30-Sep-2022 11:07                5190
function.ob-implicit-flush.php                     30-Sep-2022 11:07                4471
function.ob-list-handlers.php                      30-Sep-2022 11:07                6139
function.ob-start.php                              30-Sep-2022 11:07               17790
function.ob-tidyhandler.php                        30-Sep-2022 11:08                4298
function.oci-bind-array-by-name.php                30-Sep-2022 11:07               14038
function.oci-bind-by-name.php                      30-Sep-2022 11:07               86391
function.oci-cancel.php                            30-Sep-2022 11:07                2549
function.oci-client-version.php                    30-Sep-2022 11:07                4098
function.oci-close.php                             30-Sep-2022 11:07               20831
function.oci-commit.php                            30-Sep-2022 11:07               12093
function.oci-connect.php                           30-Sep-2022 11:07               39653
function.oci-define-by-name.php                    30-Sep-2022 11:07               25760
function.oci-error.php                             30-Sep-2022 11:07               12107
function.oci-execute.php                           30-Sep-2022 11:07               22974
function.oci-fetch-all.php                         30-Sep-2022 11:07               27503
function.oci-fetch-array.php                       30-Sep-2022 11:07               72251
function.oci-fetch-assoc.php                       30-Sep-2022 11:07                8929
function.oci-fetch-object.php                      30-Sep-2022 11:07               20085
function.oci-fetch-row.php                         30-Sep-2022 11:07                8918
function.oci-fetch.php                             30-Sep-2022 11:07               14279
function.oci-field-is-null.php                     30-Sep-2022 11:07                8694
function.oci-field-name.php                        30-Sep-2022 11:07               11023
function.oci-field-precision.php                   30-Sep-2022 11:07                9872
function.oci-field-scale.php                       30-Sep-2022 11:07                9857
function.oci-field-size.php                        30-Sep-2022 11:07               11906
function.oci-field-type-raw.php                    30-Sep-2022 11:07                8980
function.oci-field-type.php                        30-Sep-2022 11:07               12103
function.oci-free-descriptor.php                   30-Sep-2022 11:07                3461
function.oci-free-statement.php                    30-Sep-2022 11:07                2797
function.oci-get-implicit-resultset.php            30-Sep-2022 11:07               32840
function.oci-internal-debug.php                    30-Sep-2022 11:07                3822
function.oci-new-collection.php                    30-Sep-2022 11:07                5470
function.oci-new-connect.php                       30-Sep-2022 11:07               17645
function.oci-new-cursor.php                        30-Sep-2022 11:07                8746
function.oci-new-descriptor.php                    30-Sep-2022 11:07               21554
function.oci-num-fields.php                        30-Sep-2022 11:07                7879
function.oci-num-rows.php                          30-Sep-2022 11:07                8567
function.oci-parse.php                             30-Sep-2022 11:07               13396
function.oci-password-change.php                   30-Sep-2022 11:07               14700
function.oci-pconnect.php                          30-Sep-2022 11:07               15665
function.oci-register-taf-callback.php             30-Sep-2022 11:07                5312
function.oci-result.php                            30-Sep-2022 11:07                9749
function.oci-rollback.php                          30-Sep-2022 11:07               15632
function.oci-server-version.php                    30-Sep-2022 11:07                5382
function.oci-set-action.php                        30-Sep-2022 11:07                8997
function.oci-set-call-timout.php                   30-Sep-2022 11:07                5707
function.oci-set-client-identifier.php             30-Sep-2022 11:07                8811
function.oci-set-client-info.php                   30-Sep-2022 11:07                8862
function.oci-set-db-operation.php                  30-Sep-2022 11:07                7923
function.oci-set-edition.php                       30-Sep-2022 11:07               10366
function.oci-set-module-name.php                   30-Sep-2022 11:07                9051
function.oci-set-prefetch-lob.php                  30-Sep-2022 11:07                9278
function.oci-set-prefetch.php                      30-Sep-2022 11:07               24027
function.oci-statement-type.php                    30-Sep-2022 11:07                7163
function.oci-unregister-taf-callback.php           30-Sep-2022 11:07                3427
function.ocibindbyname.php                         30-Sep-2022 11:07                2030
function.ocicancel.php                             30-Sep-2022 11:07                1972
function.ocicloselob.php                           30-Sep-2022 11:07                1971
function.ocicollappend.php                         30-Sep-2022 11:07                2036
function.ocicollassign.php                         30-Sep-2022 11:07                2041
function.ocicollassignelem.php                     30-Sep-2022 11:07                2086
function.ocicollgetelem.php                        30-Sep-2022 11:07                2053
function.ocicollmax.php                            30-Sep-2022 11:07                2005
function.ocicollsize.php                           30-Sep-2022 11:07                2008
function.ocicolltrim.php                           30-Sep-2022 11:07                2018
function.ocicolumnisnull.php                       30-Sep-2022 11:07                2042
function.ocicolumnname.php                         30-Sep-2022 11:07                2034
function.ocicolumnprecision.php                    30-Sep-2022 11:07                2077
function.ocicolumnscale.php                        30-Sep-2022 11:07                2041
function.ocicolumnsize.php                         30-Sep-2022 11:07                2022
function.ocicolumntype.php                         30-Sep-2022 11:07                2026
function.ocicolumntyperaw.php                      30-Sep-2022 11:07                2049
function.ocicommit.php                             30-Sep-2022 11:07                1986
function.ocidefinebyname.php                       30-Sep-2022 11:07                2032
function.ocierror.php                              30-Sep-2022 11:07                1963
function.ociexecute.php                            30-Sep-2022 11:07                1967
function.ocifetch.php                              30-Sep-2022 11:07                1957
function.ocifetchinto.php                          30-Sep-2022 11:07                2705
function.ocifetchstatement.php                     30-Sep-2022 11:07                2050
function.ocifreecollection.php                     30-Sep-2022 11:07                2068
function.ocifreecursor.php                         30-Sep-2022 11:07                2040
function.ocifreedesc.php                           30-Sep-2022 11:07                1984
function.ocifreestatement.php                      30-Sep-2022 11:07                2059
function.ociinternaldebug.php                      30-Sep-2022 11:07                2073
function.ociloadlob.php                            30-Sep-2022 11:07                1969
function.ocilob-copy.php                           30-Sep-2022 11:07                4562
function.ocilob-is-equal.php                       30-Sep-2022 11:07                3238
function.ocilogoff.php                             30-Sep-2022 11:07                1956
function.ocilogon.php                              30-Sep-2022 11:07                1971
function.ocinewcollection.php                      30-Sep-2022 11:07                2057
function.ocinewcursor.php                          30-Sep-2022 11:07                2025
function.ocinewdescriptor.php                      30-Sep-2022 11:07                2047
function.ocinlogon.php                             30-Sep-2022 11:07                1996
function.ocinumcols.php                            30-Sep-2022 11:07                1981
function.ociparse.php                              30-Sep-2022 11:07                1951
function.ociplogon.php                             30-Sep-2022 11:07                1966
function.ociresult.php                             30-Sep-2022 11:07                1964
function.ocirollback.php                           30-Sep-2022 11:07                1986
function.ocirowcount.php                           30-Sep-2022 11:07                1988
function.ocisavelob.php                            30-Sep-2022 11:07                1969
function.ocisavelobfile.php                        30-Sep-2022 11:07                2007
function.ociserverversion.php                      30-Sep-2022 11:07                2061
function.ocisetprefetch.php                        30-Sep-2022 11:07                2047
function.ocistatementtype.php                      30-Sep-2022 11:07                2067
function.ociwritelobtofile.php                     30-Sep-2022 11:07                2048
function.ociwritetemporarylob.php                  30-Sep-2022 11:07                2071
function.octdec.php                                30-Sep-2022 11:07                5791
function.odbc-autocommit.php                       30-Sep-2022 11:07                4467
function.odbc-binmode.php                          30-Sep-2022 11:07                6897
function.odbc-close-all.php                        30-Sep-2022 11:07                2659
function.odbc-close.php                            30-Sep-2022 11:07                2919
function.odbc-columnprivileges.php                 30-Sep-2022 11:07                8787
function.odbc-columns.php                          30-Sep-2022 11:07               11575
function.odbc-commit.php                           30-Sep-2022 11:07                2584
function.odbc-connect.php                          30-Sep-2022 11:07                9050
function.odbc-cursor.php                           30-Sep-2022 11:07                2547
function.odbc-data-source.php                      30-Sep-2022 11:07                5763
function.odbc-do.php                               30-Sep-2022 11:07                1673
function.odbc-error.php                            30-Sep-2022 11:07                4109
function.odbc-errormsg.php                         30-Sep-2022 11:07                4174
function.odbc-exec.php                             30-Sep-2022 11:07                3897
function.odbc-execute.php                          30-Sep-2022 11:07                7115
function.odbc-fetch-array.php                      30-Sep-2022 11:07                4180
function.odbc-fetch-into.php                       30-Sep-2022 11:07                4838
function.odbc-fetch-object.php                     30-Sep-2022 11:07                4250
function.odbc-fetch-row.php                        30-Sep-2022 11:07                4813
function.odbc-field-len.php                        30-Sep-2022 11:07                3283
function.odbc-field-name.php                       30-Sep-2022 11:07                2899
function.odbc-field-num.php                        30-Sep-2022 11:07                2885
function.odbc-field-precision.php                  30-Sep-2022 11:07                2212
function.odbc-field-scale.php                      30-Sep-2022 11:07                2895
function.odbc-field-type.php                       30-Sep-2022 11:07                2919
function.odbc-foreignkeys.php                      30-Sep-2022 11:07                8979
function.odbc-free-result.php                      30-Sep-2022 11:07                3380
function.odbc-gettypeinfo.php                      30-Sep-2022 11:07                4429
function.odbc-longreadlen.php                      30-Sep-2022 11:07                3780
function.odbc-next-result.php                      30-Sep-2022 11:07                9238
function.odbc-num-fields.php                       30-Sep-2022 11:07                2512
function.odbc-num-rows.php                         30-Sep-2022 11:07                3221
function.odbc-pconnect.php                         30-Sep-2022 11:07                4558
function.odbc-prepare.php                          30-Sep-2022 11:07                6425
function.odbc-primarykeys.php                      30-Sep-2022 11:07                7853
function.odbc-procedurecolumns.php                 30-Sep-2022 11:07               11792
function.odbc-procedures.php                       30-Sep-2022 11:07                9685
function.odbc-result-all.php                       30-Sep-2022 11:07                4136
function.odbc-result.php                           30-Sep-2022 11:07                5652
function.odbc-rollback.php                         30-Sep-2022 11:07                2592
function.odbc-setoption.php                        30-Sep-2022 11:07                7506
function.odbc-specialcolumns.php                   30-Sep-2022 11:07                7294
function.odbc-statistics.php                       30-Sep-2022 11:07                9771
function.odbc-tableprivileges.php                  30-Sep-2022 11:07                8391
function.odbc-tables.php                           30-Sep-2022 11:07               12922
function.opcache-compile-file.php                  30-Sep-2022 11:07                3900
function.opcache-get-configuration.php             30-Sep-2022 11:07                3332
function.opcache-get-status.php                    30-Sep-2022 11:07                3750
function.opcache-invalidate.php                    30-Sep-2022 11:07                4319
function.opcache-is-script-cached.php              30-Sep-2022 11:07                3566
function.opcache-reset.php                         30-Sep-2022 11:07                3151
function.openal-buffer-create.php                  30-Sep-2022 11:07                2855
function.openal-buffer-data.php                    30-Sep-2022 11:07                4537
function.openal-buffer-destroy.php                 30-Sep-2022 11:07                3021
function.openal-buffer-get.php                     30-Sep-2022 11:07                3604
function.openal-buffer-loadwav.php                 30-Sep-2022 11:07                3601
function.openal-context-create.php                 30-Sep-2022 11:07                3313
function.openal-context-current.php                30-Sep-2022 11:07                3106
function.openal-context-destroy.php                30-Sep-2022 11:07                3072
function.openal-context-process.php                30-Sep-2022 11:07                3551
function.openal-context-suspend.php                30-Sep-2022 11:07                3545
function.openal-device-close.php                   30-Sep-2022 11:07                3038
function.openal-device-open.php                    30-Sep-2022 11:07                3329
function.openal-listener-get.php                   30-Sep-2022 11:07                3247
function.openal-listener-set.php                   30-Sep-2022 11:07                3533
function.openal-source-create.php                  30-Sep-2022 11:07                3072
function.openal-source-destroy.php                 30-Sep-2022 11:07                3026
function.openal-source-get.php                     30-Sep-2022 11:07                4775
function.openal-source-pause.php                   30-Sep-2022 11:07                3376
function.openal-source-play.php                    30-Sep-2022 11:07                3375
function.openal-source-rewind.php                  30-Sep-2022 11:07                3385
function.openal-source-set.php                     30-Sep-2022 11:07                5308
function.openal-source-stop.php                    30-Sep-2022 11:07                3357
function.openal-stream.php                         30-Sep-2022 11:07                4066
function.opendir.php                               30-Sep-2022 11:07                8241
function.openlog.php                               30-Sep-2022 11:08                9152
function.openssl-cipher-iv-length.php              30-Sep-2022 11:07                4382
function.openssl-cipher-key-length.php             30-Sep-2022 11:07                4250
function.openssl-cms-decrypt.php                   30-Sep-2022 11:07                4657
function.openssl-cms-encrypt.php                   30-Sep-2022 11:07                5895
function.openssl-cms-read.php                      30-Sep-2022 11:07                3032
function.openssl-cms-sign.php                      30-Sep-2022 11:07                7423
function.openssl-cms-verify.php                    30-Sep-2022 11:07                6318
function.openssl-csr-export-to-file.php            30-Sep-2022 11:07                8550
function.openssl-csr-export.php                    30-Sep-2022 11:07                8373
function.openssl-csr-get-public-key.php            30-Sep-2022 11:07                9060
function.openssl-csr-get-subject.php               30-Sep-2022 11:07                9855
function.openssl-csr-new.php                       30-Sep-2022 11:07               22148
function.openssl-csr-sign.php                      30-Sep-2022 11:07               13407
function.openssl-decrypt.php                       30-Sep-2022 11:07                7442
function.openssl-dh-compute-key.php                30-Sep-2022 11:07               17019
function.openssl-digest.php                        30-Sep-2022 11:07                4523
function.openssl-encrypt.php                       30-Sep-2022 11:07               18315
function.openssl-error-string.php                  30-Sep-2022 11:07                3922
function.openssl-free-key.php                      30-Sep-2022 11:07                3916
function.openssl-get-cert-locations.php            30-Sep-2022 11:07                3980
function.openssl-get-cipher-methods.php            30-Sep-2022 11:07               14498
function.openssl-get-curve-names.php               30-Sep-2022 11:07                7180
function.openssl-get-md-methods.php                30-Sep-2022 11:07                7032
function.openssl-get-privatekey.php                30-Sep-2022 11:07                1898
function.openssl-get-publickey.php                 30-Sep-2022 11:07                1869
function.openssl-open.php                          30-Sep-2022 11:07               10252
function.openssl-pbkdf2.php                        30-Sep-2022 11:07                7534
function.openssl-pkcs12-export-to-file.php         30-Sep-2022 11:07                7098
function.openssl-pkcs12-export.php                 30-Sep-2022 11:07                7081
function.openssl-pkcs12-read.php                   30-Sep-2022 11:07                5516
function.openssl-pkcs7-decrypt.php                 30-Sep-2022 11:07                7548
function.openssl-pkcs7-encrypt.php                 30-Sep-2022 11:07               10959
function.openssl-pkcs7-read.php                    30-Sep-2022 11:07                7019
function.openssl-pkcs7-sign.php                    30-Sep-2022 11:07               12213
function.openssl-pkcs7-verify.php                  30-Sep-2022 11:07                7823
function.openssl-pkey-derive.php                   30-Sep-2022 11:07                8135
function.openssl-pkey-export-to-file.php           30-Sep-2022 11:07                6303
function.openssl-pkey-export.php                   30-Sep-2022 11:07                6165
function.openssl-pkey-free.php                     30-Sep-2022 11:07                4240
function.openssl-pkey-get-details.php              30-Sep-2022 11:07                9261
function.openssl-pkey-get-private.php              30-Sep-2022 11:07                6112
function.openssl-pkey-get-public.php               30-Sep-2022 11:07                5582
function.openssl-pkey-new.php                      30-Sep-2022 11:07                7156
function.openssl-private-decrypt.php               30-Sep-2022 11:07                6336
function.openssl-private-encrypt.php               30-Sep-2022 11:07                6240
function.openssl-public-decrypt.php                30-Sep-2022 11:07                6235
function.openssl-public-encrypt.php                30-Sep-2022 11:07                6496
function.openssl-random-pseudo-bytes.php           30-Sep-2022 11:07                9680
function.openssl-seal.php                          30-Sep-2022 11:07               11521
function.openssl-sign.php                          30-Sep-2022 11:07               12420
function.openssl-spki-export-challenge.php         30-Sep-2022 11:07                7943
function.openssl-spki-export.php                   30-Sep-2022 11:07                8561
function.openssl-spki-new.php                      30-Sep-2022 11:07                9513
function.openssl-spki-verify.php                   30-Sep-2022 11:07                8091
function.openssl-verify.php                        30-Sep-2022 11:07               13477
function.openssl-x509-check-private-key.php        30-Sep-2022 11:07                5727
function.openssl-x509-checkpurpose.php             30-Sep-2022 11:07                7429
function.openssl-x509-export-to-file.php           30-Sep-2022 11:07                4862
function.openssl-x509-export.php                   30-Sep-2022 11:07                4793
function.openssl-x509-fingerprint.php              30-Sep-2022 11:07                5382
function.openssl-x509-free.php                     30-Sep-2022 11:07                4249
function.openssl-x509-parse.php                    30-Sep-2022 11:07                4756
function.openssl-x509-read.php                     30-Sep-2022 11:07                4656
function.openssl-x509-verify.php                   30-Sep-2022 11:07               13121
function.ord.php                                   30-Sep-2022 11:08                7499
function.output-add-rewrite-var.php                30-Sep-2022 11:07                8681
function.output-reset-rewrite-vars.php             30-Sep-2022 11:07                6757
function.pack.php                                  30-Sep-2022 11:07               13457
function.parse-ini-file.php                        30-Sep-2022 11:07               21401
function.parse-ini-string.php                      30-Sep-2022 11:07                6757
function.parse-str.php                             30-Sep-2022 11:08               10707
function.parse-url.php                             30-Sep-2022 11:08               16419
function.passthru.php                              30-Sep-2022 11:07                6229
function.password-algos.php                        30-Sep-2022 11:07                3259
function.password-get-info.php                     30-Sep-2022 11:07                3509
function.password-hash.php                         30-Sep-2022 11:07               23632
function.password-needs-rehash.php                 30-Sep-2022 11:07                7991
function.password-verify.php                       30-Sep-2022 11:07                6486
function.pathinfo.php                              30-Sep-2022 11:07               12021
function.pclose.php                                30-Sep-2022 11:07                5019
function.pcntl-alarm.php                           30-Sep-2022 11:07                2927
function.pcntl-async-signals.php                   30-Sep-2022 11:07                4136
function.pcntl-errno.php                           30-Sep-2022 11:07                1761
function.pcntl-exec.php                            30-Sep-2022 11:07                3601
function.pcntl-fork.php                            30-Sep-2022 11:07                5400
function.pcntl-get-last-error.php                  30-Sep-2022 11:07                2799
function.pcntl-getpriority.php                     30-Sep-2022 11:07                5249
function.pcntl-rfork.php                           30-Sep-2022 11:07                8194
function.pcntl-setpriority.php                     30-Sep-2022 11:07                5114
function.pcntl-signal-dispatch.php                 30-Sep-2022 11:07                5823
function.pcntl-signal-get-handler.php              30-Sep-2022 11:07                6781
function.pcntl-signal.php                          30-Sep-2022 11:07               12434
function.pcntl-sigprocmask.php                     30-Sep-2022 11:07                5902
function.pcntl-sigtimedwait.php                    30-Sep-2022 11:07                5000
function.pcntl-sigwaitinfo.php                     30-Sep-2022 11:07                7608
function.pcntl-strerror.php                        30-Sep-2022 11:07                2923
function.pcntl-unshare.php                         30-Sep-2022 11:07                4449
function.pcntl-wait.php                            30-Sep-2022 11:07                8607
function.pcntl-waitpid.php                         30-Sep-2022 11:07                9766
function.pcntl-wexitstatus.php                     30-Sep-2022 11:07                3676
function.pcntl-wifexited.php                       30-Sep-2022 11:07                3431
function.pcntl-wifsignaled.php                     30-Sep-2022 11:07                3497
function.pcntl-wifstopped.php                      30-Sep-2022 11:07                3459
function.pcntl-wstopsig.php                        30-Sep-2022 11:07                3623
function.pcntl-wtermsig.php                        30-Sep-2022 11:07                3822
function.pfsockopen.php                            30-Sep-2022 11:08                5315
function.pg-affected-rows.php                      30-Sep-2022 11:07                7145
function.pg-cancel-query.php                       30-Sep-2022 11:07                7918
function.pg-client-encoding.php                    30-Sep-2022 11:07                7466
function.pg-close.php                              30-Sep-2022 11:07                6871
function.pg-connect-poll.php                       30-Sep-2022 11:07                3877
function.pg-connect.php                            30-Sep-2022 11:07               11765
function.pg-connection-busy.php                    30-Sep-2022 11:07                6073
function.pg-connection-reset.php                   30-Sep-2022 11:07                6030
function.pg-connection-status.php                  30-Sep-2022 11:07                5795
function.pg-consume-input.php                      30-Sep-2022 11:07                3698
function.pg-convert.php                            30-Sep-2022 11:07                9326
function.pg-copy-from.php                          30-Sep-2022 11:07                8190
function.pg-copy-to.php                            30-Sep-2022 11:07                7591
function.pg-dbname.php                             30-Sep-2022 11:07                5441
function.pg-delete.php                             30-Sep-2022 11:07                9574
function.pg-end-copy.php                           30-Sep-2022 11:07                7624
function.pg-escape-bytea.php                       30-Sep-2022 11:07                8521
function.pg-escape-identifier.php                  30-Sep-2022 11:07                8394
function.pg-escape-literal.php                     30-Sep-2022 11:07                8954
function.pg-escape-string.php                      30-Sep-2022 11:07                8287
function.pg-execute.php                            30-Sep-2022 11:07               11329
function.pg-fetch-all-columns.php                  30-Sep-2022 11:07                7321
function.pg-fetch-all.php                          30-Sep-2022 11:07                9183
function.pg-fetch-array.php                        30-Sep-2022 11:07               12751
function.pg-fetch-assoc.php                        30-Sep-2022 11:07                9493
function.pg-fetch-object.php                       30-Sep-2022 11:07               11185
function.pg-fetch-result.php                       30-Sep-2022 11:07                9148
function.pg-fetch-row.php                          30-Sep-2022 11:07                9641
function.pg-field-is-null.php                      30-Sep-2022 11:07                8826
function.pg-field-name.php                         30-Sep-2022 11:07                9673
function.pg-field-num.php                          30-Sep-2022 11:07                7005
function.pg-field-prtlen.php                       30-Sep-2022 11:07               11205
function.pg-field-size.php                         30-Sep-2022 11:07                9911
function.pg-field-table.php                        30-Sep-2022 11:07                8819
function.pg-field-type-oid.php                     30-Sep-2022 11:07                7791
function.pg-field-type.php                         30-Sep-2022 11:07                7534
function.pg-flush.php                              30-Sep-2022 11:07                3705
function.pg-free-result.php                        30-Sep-2022 11:07                7737
function.pg-get-notify.php                         30-Sep-2022 11:07                7508
function.pg-get-pid.php                            30-Sep-2022 11:07                5359
function.pg-get-result.php                         30-Sep-2022 11:07                9361
function.pg-host.php                               30-Sep-2022 11:07                6556
function.pg-insert.php                             30-Sep-2022 11:07               10217
function.pg-last-error.php                         30-Sep-2022 11:07                7849
function.pg-last-notice.php                        30-Sep-2022 11:07                8290
function.pg-last-oid.php                           30-Sep-2022 11:07                7963
function.pg-lo-close.php                           30-Sep-2022 11:07                7600
function.pg-lo-create.php                          30-Sep-2022 11:07                9428
function.pg-lo-export.php                          30-Sep-2022 11:07                8653
function.pg-lo-import.php                          30-Sep-2022 11:07                8108
function.pg-lo-open.php                            30-Sep-2022 11:07                9740
function.pg-lo-read-all.php                        30-Sep-2022 11:07                6859
function.pg-lo-read.php                            30-Sep-2022 11:07                7315
function.pg-lo-seek.php                            30-Sep-2022 11:07                8117
function.pg-lo-tell.php                            30-Sep-2022 11:07                7437
function.pg-lo-truncate.php                        30-Sep-2022 11:07                6897
function.pg-lo-unlink.php                          30-Sep-2022 11:07                7535
function.pg-lo-write.php                           30-Sep-2022 11:07                8557
function.pg-meta-data.php                          30-Sep-2022 11:07                7562
function.pg-num-fields.php                         30-Sep-2022 11:07                6215
function.pg-num-rows.php                           30-Sep-2022 11:07                6155
function.pg-options.php                            30-Sep-2022 11:07                5757
function.pg-parameter-status.php                   30-Sep-2022 11:07                9007
function.pg-pconnect.php                           30-Sep-2022 11:07               10539
function.pg-ping.php                               30-Sep-2022 11:07                6269
function.pg-port.php                               30-Sep-2022 11:07                6010
function.pg-prepare.php                            30-Sep-2022 11:07               11421
function.pg-put-line.php                           30-Sep-2022 11:07                9391
function.pg-query-params.php                       30-Sep-2022 11:07               11750
function.pg-query.php                              30-Sep-2022 11:07               13336
function.pg-result-error-field.php                 30-Sep-2022 11:07                9095
function.pg-result-error.php                       30-Sep-2022 11:07                8583
function.pg-result-seek.php                        30-Sep-2022 11:07                7610
function.pg-result-status.php                      30-Sep-2022 11:07                8152
function.pg-select.php                             30-Sep-2022 11:07               10241
function.pg-send-execute.php                       30-Sep-2022 11:07               11169
function.pg-send-prepare.php                       30-Sep-2022 11:07               11582
function.pg-send-query-params.php                  30-Sep-2022 11:07                8399
function.pg-send-query.php                         30-Sep-2022 11:07               10478
function.pg-set-client-encoding.php                30-Sep-2022 11:07                9655
function.pg-set-error-verbosity.php                30-Sep-2022 11:07                9046
function.pg-socket.php                             30-Sep-2022 11:07                3877
function.pg-trace.php                              30-Sep-2022 11:07                8654
function.pg-transaction-status.php                 30-Sep-2022 11:07                6874
function.pg-tty.php                                30-Sep-2022 11:07                6360
function.pg-unescape-bytea.php                     30-Sep-2022 11:07                6810
function.pg-untrace.php                            30-Sep-2022 11:07                6744
function.pg-update.php                             30-Sep-2022 11:07               10526
function.pg-version.php                            30-Sep-2022 11:07                6924
function.php-ini-loaded-file.php                   30-Sep-2022 11:07                4772
function.php-ini-scanned-files.php                 30-Sep-2022 11:07                6716
function.php-sapi-name.php                         30-Sep-2022 11:07                6271
function.php-strip-whitespace.php                  30-Sep-2022 11:07                4859
function.php-uname.php                             30-Sep-2022 11:07                9657
function.phpcredits.php                            30-Sep-2022 11:07                8175
function.phpdbg-break-file.php                     30-Sep-2022 11:07                3772
function.phpdbg-break-function.php                 30-Sep-2022 11:07                3563
function.phpdbg-break-method.php                   30-Sep-2022 11:07                3837
function.phpdbg-break-next.php                     30-Sep-2022 11:07                3284
function.phpdbg-clear.php                          30-Sep-2022 11:07                3652
function.phpdbg-color.php                          30-Sep-2022 11:07                3721
function.phpdbg-end-oplog.php                      30-Sep-2022 11:07                2467
function.phpdbg-exec.php                           30-Sep-2022 11:07                2882
function.phpdbg-get-executable.php                 30-Sep-2022 11:07                2466
function.phpdbg-prompt.php                         30-Sep-2022 11:07                2796
function.phpdbg-start-oplog.php                    30-Sep-2022 11:07                2275
function.phpinfo.php                               30-Sep-2022 11:07                9871
function.phpversion.php                            30-Sep-2022 11:07               11082
function.pi.php                                    30-Sep-2022 11:07                3034
function.png2wbmp.php                              30-Sep-2022 11:07                6389
function.popen.php                                 30-Sep-2022 11:07                9304
function.pos.php                                   30-Sep-2022 11:08                1606
function.posix-access.php                          30-Sep-2022 11:07                6405
function.posix-ctermid.php                         30-Sep-2022 11:07                4347
function.posix-errno.php                           30-Sep-2022 11:07                1777
function.posix-get-last-error.php                  30-Sep-2022 11:07                4337
function.posix-getcwd.php                          30-Sep-2022 11:07                4275
function.posix-getegid.php                         30-Sep-2022 11:07                5337
function.posix-geteuid.php                         30-Sep-2022 11:07                5341
function.posix-getgid.php                          30-Sep-2022 11:07                4843
function.posix-getgrgid.php                        30-Sep-2022 11:07                6369
function.posix-getgrnam.php                        30-Sep-2022 11:07                6274
function.posix-getgroups.php                       30-Sep-2022 11:07                4157
function.posix-getlogin.php                        30-Sep-2022 11:07                3516
function.posix-getpgid.php                         30-Sep-2022 11:07                4601
function.posix-getpgrp.php                         30-Sep-2022 11:07                2518
function.posix-getpid.php                          30-Sep-2022 11:07                3247
function.posix-getppid.php                         30-Sep-2022 11:07                2835
function.posix-getpwnam.php                        30-Sep-2022 11:07                7031
function.posix-getpwuid.php                        30-Sep-2022 11:07                6982
function.posix-getrlimit.php                       30-Sep-2022 11:07                7457
function.posix-getsid.php                          30-Sep-2022 11:07                4640
function.posix-getuid.php                          30-Sep-2022 11:07                3309
function.posix-initgroups.php                      30-Sep-2022 11:07                3106
function.posix-isatty.php                          30-Sep-2022 11:07                3659
function.posix-kill.php                            30-Sep-2022 11:07                3300
function.posix-mkfifo.php                          30-Sep-2022 11:07                3455
function.posix-mknod.php                           30-Sep-2022 11:07                7311
function.posix-setegid.php                         30-Sep-2022 11:07                5147
function.posix-seteuid.php                         30-Sep-2022 11:07                3414
function.posix-setgid.php                          30-Sep-2022 11:07                5399
function.posix-setpgid.php                         30-Sep-2022 11:07                3251
function.posix-setrlimit.php                       30-Sep-2022 11:07                4544
function.posix-setsid.php                          30-Sep-2022 11:07                2578
function.posix-setuid.php                          30-Sep-2022 11:07                5462
function.posix-strerror.php                        30-Sep-2022 11:07                4881
function.posix-times.php                           30-Sep-2022 11:07                4818
function.posix-ttyname.php                         30-Sep-2022 11:07                3102
function.posix-uname.php                           30-Sep-2022 11:07                5043
function.pow.php                                   30-Sep-2022 11:07                6716
function.preg-filter.php                           30-Sep-2022 11:08                9368
function.preg-grep.php                             30-Sep-2022 11:08                5780
function.preg-last-error-msg.php                   30-Sep-2022 11:08                4162
function.preg-last-error.php                       30-Sep-2022 11:08                4858
function.preg-match-all.php                        30-Sep-2022 11:08               26401
function.preg-match.php                            30-Sep-2022 11:08               24483
function.preg-quote.php                            30-Sep-2022 11:08                9191
function.preg-replace-callback-array.php           30-Sep-2022 11:08               10584
function.preg-replace-callback.php                 30-Sep-2022 11:08               18391
function.preg-replace.php                          30-Sep-2022 11:08               24749
function.preg-split.php                            30-Sep-2022 11:08               12829
function.prev.php                                  30-Sep-2022 11:08                8723
function.print-r.php                               30-Sep-2022 11:08                9082
function.print.php                                 30-Sep-2022 11:08               14250
function.printf.php                                30-Sep-2022 11:08               24845
function.proc-close.php                            30-Sep-2022 11:07                3766
function.proc-get-status.php                       30-Sep-2022 11:07                5993
function.proc-nice.php                             30-Sep-2022 11:07                7944
function.proc-open.php                             30-Sep-2022 11:07               23824
function.proc-terminate.php                        30-Sep-2022 11:07                4810
function.property-exists.php                       30-Sep-2022 11:08                8763
function.ps-add-bookmark.php                       30-Sep-2022 11:07                5276
function.ps-add-launchlink.php                     30-Sep-2022 11:07                5518
function.ps-add-locallink.php                      30-Sep-2022 11:07                6393
function.ps-add-note.php                           30-Sep-2022 11:07                7023
function.ps-add-pdflink.php                        30-Sep-2022 11:07                6733
function.ps-add-weblink.php                        30-Sep-2022 11:07                5632
function.ps-arc.php                                30-Sep-2022 11:07                4947
function.ps-arcn.php                               30-Sep-2022 11:07                4954
function.ps-begin-page.php                         30-Sep-2022 11:07                7611
function.ps-begin-pattern.php                      30-Sep-2022 11:07               13474
function.ps-begin-template.php                     30-Sep-2022 11:07               11612
function.ps-circle.php                             30-Sep-2022 11:07                4506
function.ps-clip.php                               30-Sep-2022 11:07                2939
function.ps-close-image.php                        30-Sep-2022 11:07                3858
function.ps-close.php                              30-Sep-2022 11:07                3731
function.ps-closepath-stroke.php                   30-Sep-2022 11:07                2984
function.ps-closepath.php                          30-Sep-2022 11:07                3210
function.ps-continue-text.php                      30-Sep-2022 11:07                4114
function.ps-curveto.php                            30-Sep-2022 11:07                4643
function.ps-delete.php                             30-Sep-2022 11:07                3624
function.ps-end-page.php                           30-Sep-2022 11:07                3348
function.ps-end-pattern.php                        30-Sep-2022 11:07                3158
function.ps-end-template.php                       30-Sep-2022 11:07                3189
function.ps-fill-stroke.php                        30-Sep-2022 11:07                3250
function.ps-fill.php                               30-Sep-2022 11:07                3181
function.ps-findfont.php                           30-Sep-2022 11:07                7823
function.ps-get-buffer.php                         30-Sep-2022 11:07                3269
function.ps-get-parameter.php                      30-Sep-2022 11:07                7264
function.ps-get-value.php                          30-Sep-2022 11:07                9892
function.ps-hyphenate.php                          30-Sep-2022 11:07                7522
function.ps-include-file.php                       30-Sep-2022 11:07                2980
function.ps-lineto.php                             30-Sep-2022 11:07                8203
function.ps-makespotcolor.php                      30-Sep-2022 11:07               10506
function.ps-moveto.php                             30-Sep-2022 11:07                3670
function.ps-new.php                                30-Sep-2022 11:07                3221
function.ps-open-file.php                          30-Sep-2022 11:07                3626
function.ps-open-image-file.php                    30-Sep-2022 11:07                4779
function.ps-open-image.php                         30-Sep-2022 11:07                6667
function.ps-open-memory-image.php                  30-Sep-2022 11:07                2735
function.ps-place-image.php                        30-Sep-2022 11:07                4973
function.ps-rect.php                               30-Sep-2022 11:07                4709
function.ps-restore.php                            30-Sep-2022 11:07                3352
function.ps-rotate.php                             30-Sep-2022 11:07               12451
function.ps-save.php                               30-Sep-2022 11:07                3106
function.ps-scale.php                              30-Sep-2022 11:07                3544
function.ps-set-border-color.php                   30-Sep-2022 11:07                4569
function.ps-set-border-dash.php                    30-Sep-2022 11:07                4239
function.ps-set-border-style.php                   30-Sep-2022 11:07                4359
function.ps-set-info.php                           30-Sep-2022 11:07                6117
function.ps-set-parameter.php                      30-Sep-2022 11:07                3864
function.ps-set-text-pos.php                       30-Sep-2022 11:07                9493
function.ps-set-value.php                          30-Sep-2022 11:07                4604
function.ps-setcolor.php                           30-Sep-2022 11:07                5786
function.ps-setdash.php                            30-Sep-2022 11:07                3404
function.ps-setflat.php                            30-Sep-2022 11:07                2992
function.ps-setfont.php                            30-Sep-2022 11:07                3975
function.ps-setgray.php                            30-Sep-2022 11:07                3180
function.ps-setlinecap.php                         30-Sep-2022 11:07                3729
function.ps-setlinejoin.php                        30-Sep-2022 11:07                3749
function.ps-setlinewidth.php                       30-Sep-2022 11:07                3572
function.ps-setmiterlimit.php                      30-Sep-2022 11:07                4122
function.ps-setoverprintmode.php                   30-Sep-2022 11:07                2999
function.ps-setpolydash.php                        30-Sep-2022 11:07                7870
function.ps-shading-pattern.php                    30-Sep-2022 11:07                4248
function.ps-shading.php                            30-Sep-2022 11:07                6908
function.ps-shfill.php                             30-Sep-2022 11:07                3988
function.ps-show-boxed.php                         30-Sep-2022 11:07               13284
function.ps-show-xy.php                            30-Sep-2022 11:07                4007
function.ps-show-xy2.php                           30-Sep-2022 11:07                2795
function.ps-show.php                               30-Sep-2022 11:07                6120
function.ps-show2.php                              30-Sep-2022 11:07                3083
function.ps-string-geometry.php                    30-Sep-2022 11:07                4818
function.ps-stringwidth.php                        30-Sep-2022 11:07                4317
function.ps-stroke.php                             30-Sep-2022 11:07                3380
function.ps-symbol-name.php                        30-Sep-2022 11:07                3861
function.ps-symbol-width.php                       30-Sep-2022 11:07                4466
function.ps-symbol.php                             30-Sep-2022 11:07                3691
function.ps-translate.php                          30-Sep-2022 11:07               14446
function.pspell-add-to-personal.php                30-Sep-2022 11:07                6535
function.pspell-add-to-session.php                 30-Sep-2022 11:07                4068
function.pspell-check.php                          30-Sep-2022 11:07                5093
function.pspell-clear-session.php                  30-Sep-2022 11:07                5954
function.pspell-config-create.php                  30-Sep-2022 11:07                8411
function.pspell-config-data-dir.php                30-Sep-2022 11:07                3328
function.pspell-config-dict-dir.php                30-Sep-2022 11:07                3322
function.pspell-config-ignore.php                  30-Sep-2022 11:07                5786
function.pspell-config-mode.php                    30-Sep-2022 11:07                6418
function.pspell-config-personal.php                30-Sep-2022 11:07                6733
function.pspell-config-repl.php                    30-Sep-2022 11:07                7050
function.pspell-config-runtogether.php             30-Sep-2022 11:07                6395
function.pspell-config-save-repl.php               30-Sep-2022 11:07                5316
function.pspell-new-config.php                     30-Sep-2022 11:07                6614
function.pspell-new-personal.php                   30-Sep-2022 11:07               11090
function.pspell-new.php                            30-Sep-2022 11:07                9521
function.pspell-save-wordlist.php                  30-Sep-2022 11:07                6175
function.pspell-store-replacement.php              30-Sep-2022 11:07                7838
function.pspell-suggest.php                        30-Sep-2022 11:07                5757
function.putenv.php                                30-Sep-2022 11:07                3900
function.quoted-printable-decode.php               30-Sep-2022 11:08                5121
function.quoted-printable-encode.php               30-Sep-2022 11:08                4879
function.quotemeta.php                             30-Sep-2022 11:08                5903
function.rad2deg.php                               30-Sep-2022 11:07                3506
function.radius-acct-open.php                      30-Sep-2022 11:07                3239
function.radius-add-server.php                     30-Sep-2022 11:07                7742
function.radius-auth-open.php                      30-Sep-2022 11:07                3247
function.radius-close.php                          30-Sep-2022 11:07                2514
function.radius-config.php                         30-Sep-2022 11:07                3964
function.radius-create-request.php                 30-Sep-2022 11:07                5098
function.radius-cvt-addr.php                       30-Sep-2022 11:07                6773
function.radius-cvt-int.php                        30-Sep-2022 11:07                6001
function.radius-cvt-string.php                     30-Sep-2022 11:07                6072
function.radius-demangle-mppe-key.php              30-Sep-2022 11:07                3130
function.radius-demangle.php                       30-Sep-2022 11:07                2844
function.radius-get-attr.php                       30-Sep-2022 11:07                6826
function.radius-get-tagged-attr-data.php           30-Sep-2022 11:07                6729
function.radius-get-tagged-attr-tag.php            30-Sep-2022 11:07                6784
function.radius-get-vendor-attr.php                30-Sep-2022 11:07                8853
function.radius-put-addr.php                       30-Sep-2022 11:07                5086
function.radius-put-attr.php                       30-Sep-2022 11:07                8498
function.radius-put-int.php                        30-Sep-2022 11:07                7155
function.radius-put-string.php                     30-Sep-2022 11:07                7669
function.radius-put-vendor-addr.php                30-Sep-2022 11:07                5112
function.radius-put-vendor-attr.php                30-Sep-2022 11:07                7346
function.radius-put-vendor-int.php                 30-Sep-2022 11:07                5769
function.radius-put-vendor-string.php              30-Sep-2022 11:07                6285
function.radius-request-authenticator.php          30-Sep-2022 11:07                3064
function.radius-salt-encrypt-attr.php              30-Sep-2022 11:07                3981
function.radius-send-request.php                   30-Sep-2022 11:07                3740
function.radius-server-secret.php                  30-Sep-2022 11:07                2580
function.radius-strerror.php                       30-Sep-2022 11:07                2542
function.rand.php                                  30-Sep-2022 11:07               10488
function.random-bytes.php                          30-Sep-2022 11:07                8011
function.random-int.php                            30-Sep-2022 11:07                8193
function.range.php                                 30-Sep-2022 11:08                8129
function.rar-wrapper-cache-stats.php               30-Sep-2022 11:07                2319
function.rawurldecode.php                          30-Sep-2022 11:08                4697
function.rawurlencode.php                          30-Sep-2022 11:08                6490
function.read-exif-data.php                        30-Sep-2022 11:07                2539
function.readdir.php                               30-Sep-2022 11:07               11122
function.readfile.php                              30-Sep-2022 11:07               10083
function.readgzfile.php                            30-Sep-2022 11:07                4518
function.readline-add-history.php                  30-Sep-2022 11:07                2586
function.readline-callback-handler-install.php     30-Sep-2022 11:07               10495
function.readline-callback-handler-remove.php      30-Sep-2022 11:07                3932
function.readline-callback-read-char.php           30-Sep-2022 11:07                3981
function.readline-clear-history.php                30-Sep-2022 11:07                2396
function.readline-completion-function.php          30-Sep-2022 11:07                2967
function.readline-info.php                         30-Sep-2022 11:07                4663
function.readline-list-history.php                 30-Sep-2022 11:07                2341
function.readline-on-new-line.php                  30-Sep-2022 11:07                2754
function.readline-read-history.php                 30-Sep-2022 11:07                3257
function.readline-redisplay.php                    30-Sep-2022 11:07                2221
function.readline-write-history.php                30-Sep-2022 11:07                3213
function.readline.php                              30-Sep-2022 11:07                5124
function.readlink.php                              30-Sep-2022 11:07                4521
function.realpath-cache-get.php                    30-Sep-2022 11:07                4277
function.realpath-cache-size.php                   30-Sep-2022 11:07                3715
function.realpath.php                              30-Sep-2022 11:07                8997
function.recode-file.php                           30-Sep-2022 11:07                5604
function.recode-string.php                         30-Sep-2022 11:07                5143
function.recode.php                                30-Sep-2022 11:07                1706
function.register-shutdown-function.php            30-Sep-2022 11:08                8638
function.register-tick-function.php                30-Sep-2022 11:08                5462
function.rename.php                                30-Sep-2022 11:07                5830
function.require-once.php                          30-Sep-2022 11:07                1932
function.require.php                               30-Sep-2022 11:07                2004
function.reset.php                                 30-Sep-2022 11:08                9229
function.restore-error-handler.php                 30-Sep-2022 11:07                5846
function.restore-exception-handler.php             30-Sep-2022 11:07                6933
function.restore-include-path.php                  30-Sep-2022 11:07                5375
function.return.php                                30-Sep-2022 11:07                4609
function.rewind.php                                30-Sep-2022 11:07                6478
function.rewinddir.php                             30-Sep-2022 11:07                3497
function.rmdir.php                                 30-Sep-2022 11:07                4976
function.round.php                                 30-Sep-2022 11:07               24287
function.rpmaddtag.php                             30-Sep-2022 11:07                3119
function.rpmdbinfo.php                             30-Sep-2022 11:07                4679
function.rpmdbsearch.php                           30-Sep-2022 11:07                5464
function.rpminfo.php                               30-Sep-2022 11:07                4863
function.rpmvercmp.php                             30-Sep-2022 11:07                2531
function.rrd-create.php                            30-Sep-2022 11:08                2645
function.rrd-error.php                             30-Sep-2022 11:08                2009
function.rrd-fetch.php                             30-Sep-2022 11:08                2723
function.rrd-first.php                             30-Sep-2022 11:08                2665
function.rrd-graph.php                             30-Sep-2022 11:08                2917
function.rrd-info.php                              30-Sep-2022 11:08                2304
function.rrd-last.php                              30-Sep-2022 11:08                2290
function.rrd-lastupdate.php                        30-Sep-2022 11:08                2434
function.rrd-restore.php                           30-Sep-2022 11:08                2978
function.rrd-tune.php                              30-Sep-2022 11:08                2716
function.rrd-update.php                            30-Sep-2022 11:08                2789
function.rrd-version.php                           30-Sep-2022 11:08                2103
function.rrd-xport.php                             30-Sep-2022 11:08                2480
function.rrdc-disconnect.php                       30-Sep-2022 11:08                2491
function.rsort.php                                 30-Sep-2022 11:08                8324
function.rtrim.php                                 30-Sep-2022 11:08                9749
function.runkit7-constant-add.php                  30-Sep-2022 11:07                4223
function.runkit7-constant-redefine.php             30-Sep-2022 11:07                4084
function.runkit7-constant-remove.php               30-Sep-2022 11:07                3442
function.runkit7-function-add.php                  30-Sep-2022 11:07                8834
function.runkit7-function-copy.php                 30-Sep-2022 11:07                5260
function.runkit7-function-redefine.php             30-Sep-2022 11:07                9264
function.runkit7-function-remove.php               30-Sep-2022 11:07                3954
function.runkit7-function-rename.php               30-Sep-2022 11:07                4175
function.runkit7-import.php                        30-Sep-2022 11:07                3543
function.runkit7-method-add.php                    30-Sep-2022 11:07               10707
function.runkit7-method-copy.php                   30-Sep-2022 11:07                7024
function.runkit7-method-redefine.php               30-Sep-2022 11:07               11173
function.runkit7-method-remove.php                 30-Sep-2022 11:07                6482
function.runkit7-method-rename.php                 30-Sep-2022 11:07                6533
function.runkit7-object-id.php                     30-Sep-2022 11:07                3622
function.runkit7-superglobals.php                  30-Sep-2022 11:07                2549
function.runkit7-zval-inspect.php                  30-Sep-2022 11:07                5025
function.sapi-windows-cp-conv.php                  30-Sep-2022 11:07                4580
function.sapi-windows-cp-get.php                   30-Sep-2022 11:07                3587
function.sapi-windows-cp-is-utf8.php               30-Sep-2022 11:07                2731
function.sapi-windows-cp-set.php                   30-Sep-2022 11:07                2931
function.sapi-windows-generate-ctrl-event.php      30-Sep-2022 11:07                7874
function.sapi-windows-set-ctrl-handler.php         30-Sep-2022 11:07                7819
function.sapi-windows-vt100-support.php            30-Sep-2022 11:07               10638
function.scandir.php                               30-Sep-2022 11:07                8563
function.scoutapm-get-calls.php                    30-Sep-2022 11:08                4511
function.scoutapm-list-instrumented-functions.php  30-Sep-2022 11:08                3736
function.seaslog-get-author.php                    30-Sep-2022 11:07                3012
function.seaslog-get-version.php                   30-Sep-2022 11:07                3013
function.sem-acquire.php                           30-Sep-2022 11:07                5122
function.sem-get.php                               30-Sep-2022 11:07                7030
function.sem-release.php                           30-Sep-2022 11:07                4266
function.sem-remove.php                            30-Sep-2022 11:07                4228
function.serialize.php                             30-Sep-2022 11:08               11665
function.session-abort.php                         30-Sep-2022 11:08                4140
function.session-cache-expire.php                  30-Sep-2022 11:08                7695
function.session-cache-limiter.php                 30-Sep-2022 11:08                9433
function.session-commit.php                        30-Sep-2022 11:08                1819
function.session-create-id.php                     30-Sep-2022 11:08               11692
function.session-decode.php                        30-Sep-2022 11:08                3748
function.session-destroy.php                       30-Sep-2022 11:08               10672
function.session-encode.php                        30-Sep-2022 11:08                4085
function.session-gc.php                            30-Sep-2022 11:08                8690
function.session-get-cookie-params.php             30-Sep-2022 11:08                5692
function.session-id.php                            30-Sep-2022 11:08                6349
function.session-module-name.php                   30-Sep-2022 11:08                4471
function.session-name.php                          30-Sep-2022 11:08                8401
function.session-regenerate-id.php                 30-Sep-2022 11:08               19030
function.session-register-shutdown.php             30-Sep-2022 11:08                2711
function.session-reset.php                         30-Sep-2022 11:08                4148
function.session-save-path.php                     30-Sep-2022 11:08                4668
function.session-set-cookie-params.php             30-Sep-2022 11:08               10238
function.session-set-save-handler.php              30-Sep-2022 11:08               23965
function.session-start.php                         30-Sep-2022 11:08               15648
function.session-status.php                        30-Sep-2022 11:08                3177
function.session-unset.php                         30-Sep-2022 11:08                4520
function.session-write-close.php                   30-Sep-2022 11:08                4194
function.set-error-handler.php                     30-Sep-2022 11:07               28783
function.set-exception-handler.php                 30-Sep-2022 11:07                7060
function.set-file-buffer.php                       30-Sep-2022 11:07                1791
function.set-include-path.php                      30-Sep-2022 11:07                6194
function.set-time-limit.php                        30-Sep-2022 11:07                4744
function.setcookie.php                             30-Sep-2022 11:08               28002
function.setlocale.php                             30-Sep-2022 11:08               15570
function.setrawcookie.php                          30-Sep-2022 11:08                5565
function.settype.php                               30-Sep-2022 11:08                6384
function.sha1-file.php                             30-Sep-2022 11:08                5666
function.sha1.php                                  30-Sep-2022 11:08                5961
function.shell-exec.php                            30-Sep-2022 11:07                5661
function.shm-attach.php                            30-Sep-2022 11:07                6094
function.shm-detach.php                            30-Sep-2022 11:07                4587
function.shm-get-var.php                           30-Sep-2022 11:07                4493
function.shm-has-var.php                           30-Sep-2022 11:07                4288
function.shm-put-var.php                           30-Sep-2022 11:07                5427
function.shm-remove-var.php                        30-Sep-2022 11:07                4148
function.shm-remove.php                            30-Sep-2022 11:07                3920
function.shmop-close.php                           30-Sep-2022 11:07                5035
function.shmop-delete.php                          30-Sep-2022 11:07                4168
function.shmop-open.php                            30-Sep-2022 11:07                9139
function.shmop-read.php                            30-Sep-2022 11:07                5507
function.shmop-size.php                            30-Sep-2022 11:07                4329
function.shmop-write.php                           30-Sep-2022 11:07                5719
function.show-source.php                           30-Sep-2022 11:07                1740
function.shuffle.php                               30-Sep-2022 11:08                5921
function.similar-text.php                          30-Sep-2022 11:08                7547
function.simplexml-import-dom.php                  30-Sep-2022 11:08                6636
function.simplexml-load-file.php                   30-Sep-2022 11:08               10285
function.simplexml-load-string.php                 30-Sep-2022 11:08                9843
function.sin.php                                   30-Sep-2022 11:07                4694
function.sinh.php                                  30-Sep-2022 11:07                3310
function.sizeof.php                                30-Sep-2022 11:08                1626
function.sleep.php                                 30-Sep-2022 11:07                7261
function.snmp-get-quick-print.php                  30-Sep-2022 11:08                3640
function.snmp-get-valueretrieval.php               30-Sep-2022 11:08                4395
function.snmp-read-mib.php                         30-Sep-2022 11:08                4699
function.snmp-set-enum-print.php                   30-Sep-2022 11:08                4638
function.snmp-set-oid-numeric-print.php            30-Sep-2022 11:08                2328
function.snmp-set-oid-output-format.php            30-Sep-2022 11:08                6730
function.snmp-set-quick-print.php                  30-Sep-2022 11:08                6713
function.snmp-set-valueretrieval.php               30-Sep-2022 11:08                9246
function.snmp2-get.php                             30-Sep-2022 11:08                5553
function.snmp2-getnext.php                         30-Sep-2022 11:08                5992
function.snmp2-real-walk.php                       30-Sep-2022 11:08                6175
function.snmp2-set.php                             30-Sep-2022 11:08               10988
function.snmp2-walk.php                            30-Sep-2022 11:08                6881
function.snmp3-get.php                             30-Sep-2022 11:08                8539
function.snmp3-getnext.php                         30-Sep-2022 11:08                8940
function.snmp3-real-walk.php                       30-Sep-2022 11:08                9347
function.snmp3-set.php                             30-Sep-2022 11:08               13650
function.snmp3-walk.php                            30-Sep-2022 11:08               10073
function.snmpget.php                               30-Sep-2022 11:08                5580
function.snmpgetnext.php                           30-Sep-2022 11:08                5863
function.snmprealwalk.php                          30-Sep-2022 11:08                6080
function.snmpset.php                               30-Sep-2022 11:08               11046
function.snmpwalk.php                              30-Sep-2022 11:08                7023
function.snmpwalkoid.php                           30-Sep-2022 11:08                7726
function.socket-accept.php                         30-Sep-2022 11:08                7194
function.socket-addrinfo-bind.php                  30-Sep-2022 11:08                5627
function.socket-addrinfo-connect.php               30-Sep-2022 11:08                5388
function.socket-addrinfo-explain.php               30-Sep-2022 11:08                4581
function.socket-addrinfo-lookup.php                30-Sep-2022 11:08                5845
function.socket-bind.php                           30-Sep-2022 11:08               11316
function.socket-clear-error.php                    30-Sep-2022 11:08                4735
function.socket-close.php                          30-Sep-2022 11:08                4718
function.socket-cmsg-space.php                     30-Sep-2022 11:08                3556
function.socket-connect.php                        30-Sep-2022 11:08                7502
function.socket-create-listen.php                  30-Sep-2022 11:08                7363
function.socket-create-pair.php                    30-Sep-2022 11:08               20988
function.socket-create.php                         30-Sep-2022 11:08               13457
function.socket-export-stream.php                  30-Sep-2022 11:08                3451
function.socket-get-option.php                     30-Sep-2022 11:08               25884
function.socket-get-status.php                     30-Sep-2022 11:08                1821
function.socket-getopt.php                         30-Sep-2022 11:08                1796
function.socket-getpeername.php                    30-Sep-2022 11:08                8223
function.socket-getsockname.php                    30-Sep-2022 11:08                7526
function.socket-import-stream.php                  30-Sep-2022 11:08                5211
function.socket-last-error.php                     30-Sep-2022 11:08                7539
function.socket-listen.php                         30-Sep-2022 11:08                7591
function.socket-read.php                           30-Sep-2022 11:08                8140
function.socket-recv.php                           30-Sep-2022 11:08               17154
function.socket-recvfrom.php                       30-Sep-2022 11:08               13681
function.socket-recvmsg.php                        30-Sep-2022 11:08                4307
function.socket-select.php                         30-Sep-2022 11:08               16818
function.socket-send.php                           30-Sep-2022 11:08                6639
function.socket-sendmsg.php                        30-Sep-2022 11:08                4410
function.socket-sendto.php                         30-Sep-2022 11:08                9996
function.socket-set-block.php                      30-Sep-2022 11:08                6217
function.socket-set-blocking.php                   30-Sep-2022 11:08                1841
function.socket-set-nonblock.php                   30-Sep-2022 11:08                6602
function.socket-set-option.php                     30-Sep-2022 11:08               11656
function.socket-set-timeout.php                    30-Sep-2022 11:08                1809
function.socket-setopt.php                         30-Sep-2022 11:08                1790
function.socket-shutdown.php                       30-Sep-2022 11:08                4968
function.socket-strerror.php                       30-Sep-2022 11:08                7428
function.socket-write.php                          30-Sep-2022 11:08                7473
function.socket-wsaprotocol-info-export.php        30-Sep-2022 11:08                5043
function.socket-wsaprotocol-info-import.php        30-Sep-2022 11:08                4432
function.socket-wsaprotocol-info-release.php       30-Sep-2022 11:08                3458
function.sodium-add.php                            30-Sep-2022 11:07                3126
function.sodium-base642bin.php                     30-Sep-2022 11:07                4645
function.sodium-bin2base64.php                     30-Sep-2022 11:07                4278
function.sodium-bin2hex.php                        30-Sep-2022 11:07                2706
function.sodium-compare.php                        30-Sep-2022 11:07                3222
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-Sep-2022 11:07                4571
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-Sep-2022 11:07                4328
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-Sep-2022 11:07                2763
function.sodium-crypto-aead-aes256gcm-keygen.php   30-Sep-2022 11:07                2817
function.sodium-crypto-aead-chacha20poly1305-de..> 30-Sep-2022 11:07                4471
function.sodium-crypto-aead-chacha20poly1305-en..> 30-Sep-2022 11:07                4136
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:07                4806
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:07                4401
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:07                3009
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-Sep-2022 11:07                2944
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:07                5051
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:07                4678
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:07                2985
function.sodium-crypto-auth-keygen.php             30-Sep-2022 11:07                2627
function.sodium-crypto-auth-verify.php             30-Sep-2022 11:07                3627
function.sodium-crypto-auth.php                    30-Sep-2022 11:07                3232
function.sodium-crypto-box-keypair-from-secretk..> 30-Sep-2022 11:07                3268
function.sodium-crypto-box-keypair.php             30-Sep-2022 11:07                3009
function.sodium-crypto-box-open.php                30-Sep-2022 11:07                3877
function.sodium-crypto-box-publickey-from-secre..> 30-Sep-2022 11:07                3178
function.sodium-crypto-box-publickey.php           30-Sep-2022 11:07                2875
function.sodium-crypto-box-seal-open.php           30-Sep-2022 11:07                6020
function.sodium-crypto-box-seal.php                30-Sep-2022 11:07                7265
function.sodium-crypto-box-secretkey.php           30-Sep-2022 11:07                2838
function.sodium-crypto-box-seed-keypair.php        30-Sep-2022 11:07                3035
function.sodium-crypto-box.php                     30-Sep-2022 11:07                4328
function.sodium-crypto-core-ristretto255-add.php   30-Sep-2022 11:07                6024
function.sodium-crypto-core-ristretto255-from-h..> 30-Sep-2022 11:07                5502
function.sodium-crypto-core-ristretto255-is-val..> 30-Sep-2022 11:07                5558
function.sodium-crypto-core-ristretto255-random..> 30-Sep-2022 11:07                5639
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:07                6297
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:07                3496
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:07                5384
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:07                3733
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:07                5393
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:07                5803
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:07                3458
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:07                6295
function.sodium-crypto-core-ristretto255-sub.php   30-Sep-2022 11:07                6054
function.sodium-crypto-generichash-final.php       30-Sep-2022 11:07                6798
function.sodium-crypto-generichash-init.php        30-Sep-2022 11:07                6761
function.sodium-crypto-generichash-keygen.php      30-Sep-2022 11:07                2429
function.sodium-crypto-generichash-update.php      30-Sep-2022 11:07                6567
function.sodium-crypto-generichash.php             30-Sep-2022 11:07                3585
function.sodium-crypto-kdf-derive-from-key.php     30-Sep-2022 11:07                3826
function.sodium-crypto-kdf-keygen.php              30-Sep-2022 11:07                2567
function.sodium-crypto-kx-client-session-keys.php  30-Sep-2022 11:07                3283
function.sodium-crypto-kx-keypair.php              30-Sep-2022 11:07                5090
function.sodium-crypto-kx-publickey.php            30-Sep-2022 11:07                2718
function.sodium-crypto-kx-secretkey.php            30-Sep-2022 11:07                2732
function.sodium-crypto-kx-seed-keypair.php         30-Sep-2022 11:07                2616
function.sodium-crypto-kx-server-session-keys.php  30-Sep-2022 11:07                3359
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:07                3177
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:07                3354
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:07                6110
function.sodium-crypto-pwhash-str-needs-rehash.php 30-Sep-2022 11:07                3855
function.sodium-crypto-pwhash-str-verify.php       30-Sep-2022 11:07                4907
function.sodium-crypto-pwhash-str.php              30-Sep-2022 11:07                8770
function.sodium-crypto-pwhash.php                  30-Sep-2022 11:07               10259
function.sodium-crypto-scalarmult-base.php         30-Sep-2022 11:07                2038
function.sodium-crypto-scalarmult-ristretto255-..> 30-Sep-2022 11:07                3424
function.sodium-crypto-scalarmult-ristretto255.php 30-Sep-2022 11:07                3756
function.sodium-crypto-scalarmult.php              30-Sep-2022 11:07                2937
function.sodium-crypto-secretbox-keygen.php        30-Sep-2022 11:07                6397
function.sodium-crypto-secretbox-open.php          30-Sep-2022 11:07                8894
function.sodium-crypto-secretbox.php               30-Sep-2022 11:07                8763
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:07               11845
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:07               11005
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:07                2745
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:07                6000
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:07                6148
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:07                2965
function.sodium-crypto-shorthash-keygen.php        30-Sep-2022 11:07                2700
function.sodium-crypto-shorthash.php               30-Sep-2022 11:07                3163
function.sodium-crypto-sign-detached.php           30-Sep-2022 11:07                3062
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-Sep-2022 11:07                2834
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-Sep-2022 11:07                2890
function.sodium-crypto-sign-keypair-from-secret..> 30-Sep-2022 11:07                3065
function.sodium-crypto-sign-keypair.php            30-Sep-2022 11:07                2432
function.sodium-crypto-sign-open.php               30-Sep-2022 11:07                3199
function.sodium-crypto-sign-publickey-from-secr..> 30-Sep-2022 11:07                2714
function.sodium-crypto-sign-publickey.php          30-Sep-2022 11:07                2763
function.sodium-crypto-sign-secretkey.php          30-Sep-2022 11:07                2739
function.sodium-crypto-sign-seed-keypair.php       30-Sep-2022 11:07                3062
function.sodium-crypto-sign-verify-detached.php    30-Sep-2022 11:07                3321
function.sodium-crypto-sign.php                    30-Sep-2022 11:07                3285
function.sodium-crypto-stream-keygen.php           30-Sep-2022 11:07                2606
function.sodium-crypto-stream-xchacha20-keygen.php 30-Sep-2022 11:07                2762
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-Sep-2022 11:07                9751
function.sodium-crypto-stream-xchacha20-xor.php    30-Sep-2022 11:07                4683
function.sodium-crypto-stream-xchacha20.php        30-Sep-2022 11:07                3581
function.sodium-crypto-stream-xor.php              30-Sep-2022 11:07                3423
function.sodium-crypto-stream.php                  30-Sep-2022 11:07                3373
function.sodium-hex2bin.php                        30-Sep-2022 11:07                3211
function.sodium-increment.php                      30-Sep-2022 11:07                2508
function.sodium-memcmp.php                         30-Sep-2022 11:07                3434
function.sodium-memzero.php                        30-Sep-2022 11:07                2418
function.sodium-pad.php                            30-Sep-2022 11:07                2756
function.sodium-unpad.php                          30-Sep-2022 11:07                2674
function.solr-get-version.php                      30-Sep-2022 11:08                3898
function.sort.php                                  30-Sep-2022 11:08               11807
function.soundex.php                               30-Sep-2022 11:08                7602
function.spl-autoload-call.php                     30-Sep-2022 11:07                2618
function.spl-autoload-extensions.php               30-Sep-2022 11:07                4816
function.spl-autoload-functions.php                30-Sep-2022 11:07                2508
function.spl-autoload-register.php                 30-Sep-2022 11:07               10889
function.spl-autoload-unregister.php               30-Sep-2022 11:07                3094
function.spl-autoload.php                          30-Sep-2022 11:07                4463
function.spl-classes.php                           30-Sep-2022 11:07                3641
function.spl-object-hash.php                       30-Sep-2022 11:07                4866
function.spl-object-id.php                         30-Sep-2022 11:07                4303
function.sprintf.php                               30-Sep-2022 11:08               26951
function.sqlsrv-begin-transaction.php              30-Sep-2022 11:07               12059
function.sqlsrv-cancel.php                         30-Sep-2022 11:07               10723
function.sqlsrv-client-info.php                    30-Sep-2022 11:07                6877
function.sqlsrv-close.php                          30-Sep-2022 11:07                5542
function.sqlsrv-commit.php                         30-Sep-2022 11:07               11887
function.sqlsrv-configure.php                      30-Sep-2022 11:07                4467
function.sqlsrv-connect.php                        30-Sep-2022 11:07               12686
function.sqlsrv-errors.php                         30-Sep-2022 11:07               10635
function.sqlsrv-execute.php                        30-Sep-2022 11:07               10841
function.sqlsrv-fetch-array.php                    30-Sep-2022 11:07               15673
function.sqlsrv-fetch-object.php                   30-Sep-2022 11:07               12429
function.sqlsrv-fetch.php                          30-Sep-2022 11:07               11157
function.sqlsrv-field-metadata.php                 30-Sep-2022 11:07                8969
function.sqlsrv-free-stmt.php                      30-Sep-2022 11:07                7748
function.sqlsrv-get-config.php                     30-Sep-2022 11:07                3242
function.sqlsrv-get-field.php                      30-Sep-2022 11:07               10675
function.sqlsrv-has-rows.php                       30-Sep-2022 11:07                6434
function.sqlsrv-next-result.php                    30-Sep-2022 11:07                9599
function.sqlsrv-num-fields.php                     30-Sep-2022 11:07                8554
function.sqlsrv-num-rows.php                       30-Sep-2022 11:07                8069
function.sqlsrv-prepare.php                        30-Sep-2022 11:07               14922
function.sqlsrv-query.php                          30-Sep-2022 11:07               11660
function.sqlsrv-rollback.php                       30-Sep-2022 11:07               11357
function.sqlsrv-rows-affected.php                  30-Sep-2022 11:07                8186
function.sqlsrv-send-stream-data.php               30-Sep-2022 11:07                8939
function.sqlsrv-server-info.php                    30-Sep-2022 11:07                6299
function.sqrt.php                                  30-Sep-2022 11:07                4325
function.srand.php                                 30-Sep-2022 11:07                6733
function.sscanf.php                                30-Sep-2022 11:08               12331
function.ssdeep-fuzzy-compare.php                  30-Sep-2022 11:08                3014
function.ssdeep-fuzzy-hash-filename.php            30-Sep-2022 11:08                2793
function.ssdeep-fuzzy-hash.php                     30-Sep-2022 11:08                2637
function.ssh2-auth-agent.php                       30-Sep-2022 11:08                4608
function.ssh2-auth-hostbased-file.php              30-Sep-2022 11:08                7850
function.ssh2-auth-none.php                        30-Sep-2022 11:08                4867
function.ssh2-auth-password.php                    30-Sep-2022 11:08                4892
function.ssh2-auth-pubkey-file.php                 30-Sep-2022 11:08                7335
function.ssh2-connect.php                          30-Sep-2022 11:08               16489
function.ssh2-disconnect.php                       30-Sep-2022 11:08                2884
function.ssh2-exec.php                             30-Sep-2022 11:08                7165
function.ssh2-fetch-stream.php                     30-Sep-2022 11:08                5570
function.ssh2-fingerprint.php                      30-Sep-2022 11:08                5416
function.ssh2-forward-accept.php                   30-Sep-2022 11:08                3019
function.ssh2-forward-listen.php                   30-Sep-2022 11:08                4350
function.ssh2-methods-negotiated.php               30-Sep-2022 11:08                8199
function.ssh2-poll.php                             30-Sep-2022 11:08                3680
function.ssh2-publickey-add.php                    30-Sep-2022 11:08                8311
function.ssh2-publickey-init.php                   30-Sep-2022 11:08                4779
function.ssh2-publickey-list.php                   30-Sep-2022 11:08                9226
function.ssh2-publickey-remove.php                 30-Sep-2022 11:08                4608
function.ssh2-scp-recv.php                         30-Sep-2022 11:08                5345
function.ssh2-scp-send.php                         30-Sep-2022 11:08                5924
function.ssh2-send-eof.php                         30-Sep-2022 11:08                3463
function.ssh2-sftp-chmod.php                       30-Sep-2022 11:08                5861
function.ssh2-sftp-lstat.php                       30-Sep-2022 11:08                7505
function.ssh2-sftp-mkdir.php                       30-Sep-2022 11:08                6698
function.ssh2-sftp-readlink.php                    30-Sep-2022 11:08                5400
function.ssh2-sftp-realpath.php                    30-Sep-2022 11:08                5585
function.ssh2-sftp-rename.php                      30-Sep-2022 11:08                5393
function.ssh2-sftp-rmdir.php                       30-Sep-2022 11:08                5517
function.ssh2-sftp-stat.php                        30-Sep-2022 11:08                7403
function.ssh2-sftp-symlink.php                     30-Sep-2022 11:08                5660
function.ssh2-sftp-unlink.php                      30-Sep-2022 11:08                4882
function.ssh2-sftp.php                             30-Sep-2022 11:08                5476
function.ssh2-shell.php                            30-Sep-2022 11:08                7636
function.ssh2-tunnel.php                           30-Sep-2022 11:08                5307
function.stat.php                                  30-Sep-2022 11:07               18365
function.stats-absolute-deviation.php              30-Sep-2022 11:07                2630
function.stats-cdf-beta.php                        30-Sep-2022 11:07                4887
function.stats-cdf-binomial.php                    30-Sep-2022 11:07                4872
function.stats-cdf-cauchy.php                      30-Sep-2022 11:07                4907
function.stats-cdf-chisquare.php                   30-Sep-2022 11:07                4280
function.stats-cdf-exponential.php                 30-Sep-2022 11:07                4311
function.stats-cdf-f.php                           30-Sep-2022 11:07                4812
function.stats-cdf-gamma.php                       30-Sep-2022 11:07                4871
function.stats-cdf-laplace.php                     30-Sep-2022 11:07                4892
function.stats-cdf-logistic.php                    30-Sep-2022 11:07                4927
function.stats-cdf-negative-binomial.php           30-Sep-2022 11:07                5015
function.stats-cdf-noncentral-chisquare.php        30-Sep-2022 11:07                5117
function.stats-cdf-noncentral-f.php                30-Sep-2022 11:07                5637
function.stats-cdf-noncentral-t.php                30-Sep-2022 11:07                4977
function.stats-cdf-normal.php                      30-Sep-2022 11:07                4909
function.stats-cdf-poisson.php                     30-Sep-2022 11:07                4245
function.stats-cdf-t.php                           30-Sep-2022 11:07                4173
function.stats-cdf-uniform.php                     30-Sep-2022 11:07                4872
function.stats-cdf-weibull.php                     30-Sep-2022 11:07                4909
function.stats-covariance.php                      30-Sep-2022 11:07                2776
function.stats-dens-beta.php                       30-Sep-2022 11:07                3208
function.stats-dens-cauchy.php                     30-Sep-2022 11:07                3266
function.stats-dens-chisquare.php                  30-Sep-2022 11:07                2990
function.stats-dens-exponential.php                30-Sep-2022 11:07                2980
function.stats-dens-f.php                          30-Sep-2022 11:07                3206
function.stats-dens-gamma.php                      30-Sep-2022 11:07                3259
function.stats-dens-laplace.php                    30-Sep-2022 11:07                3293
function.stats-dens-logistic.php                   30-Sep-2022 11:07                3305
function.stats-dens-normal.php                     30-Sep-2022 11:07                3276
function.stats-dens-pmf-binomial.php               30-Sep-2022 11:07                3330
function.stats-dens-pmf-hypergeometric.php         30-Sep-2022 11:07                3928
function.stats-dens-pmf-negative-binomial.php      30-Sep-2022 11:07                3459
function.stats-dens-pmf-poisson.php                30-Sep-2022 11:07                2981
function.stats-dens-t.php                          30-Sep-2022 11:07                2894
function.stats-dens-uniform.php                    30-Sep-2022 11:07                3241
function.stats-dens-weibull.php                    30-Sep-2022 11:07                3273
function.stats-harmonic-mean.php                   30-Sep-2022 11:07                2620
function.stats-kurtosis.php                        30-Sep-2022 11:07                2537
function.stats-rand-gen-beta.php                   30-Sep-2022 11:07                2841
function.stats-rand-gen-chisquare.php              30-Sep-2022 11:07                2568
function.stats-rand-gen-exponential.php            30-Sep-2022 11:07                2566
function.stats-rand-gen-f.php                      30-Sep-2022 11:07                2895
function.stats-rand-gen-funiform.php               30-Sep-2022 11:07                2822
function.stats-rand-gen-gamma.php                  30-Sep-2022 11:07                2908
function.stats-rand-gen-ibinomial-negative.php     30-Sep-2022 11:07                2988
function.stats-rand-gen-ibinomial.php              30-Sep-2022 11:07                2912
function.stats-rand-gen-int.php                    30-Sep-2022 11:07                2209
function.stats-rand-gen-ipoisson.php               30-Sep-2022 11:07                2541
function.stats-rand-gen-iuniform.php               30-Sep-2022 11:07                2889
function.stats-rand-gen-noncentral-chisquare.php   30-Sep-2022 11:07                3030
function.stats-rand-gen-noncentral-f.php           30-Sep-2022 11:07                3329
function.stats-rand-gen-noncentral-t.php           30-Sep-2022 11:07                2943
function.stats-rand-gen-normal.php                 30-Sep-2022 11:07                2856
function.stats-rand-gen-t.php                      30-Sep-2022 11:07                2460
function.stats-rand-get-seeds.php                  30-Sep-2022 11:07                2252
function.stats-rand-phrase-to-seeds.php            30-Sep-2022 11:07                2547
function.stats-rand-ranf.php                       30-Sep-2022 11:07                2253
function.stats-rand-setall.php                     30-Sep-2022 11:07                2797
function.stats-skew.php                            30-Sep-2022 11:07                2503
function.stats-standard-deviation.php              30-Sep-2022 11:07                3400
function.stats-stat-binomial-coef.php              30-Sep-2022 11:07                2801
function.stats-stat-correlation.php                30-Sep-2022 11:07                2956
function.stats-stat-factorial.php                  30-Sep-2022 11:07                2428
function.stats-stat-independent-t.php              30-Sep-2022 11:07                3114
function.stats-stat-innerproduct.php               30-Sep-2022 11:07                2898
function.stats-stat-paired-t.php                   30-Sep-2022 11:07                2835
function.stats-stat-percentile.php                 30-Sep-2022 11:07                2753
function.stats-stat-powersum.php                   30-Sep-2022 11:07                2745
function.stats-variance.php                        30-Sep-2022 11:07                2957
function.stomp-connect-error.php                   30-Sep-2022 11:08                3620
function.stomp-version.php                         30-Sep-2022 11:08                3047
function.str-contains.php                          30-Sep-2022 11:08                8654
function.str-ends-with.php                         30-Sep-2022 11:08                8540
function.str-getcsv.php                            30-Sep-2022 11:08                7995
function.str-ireplace.php                          30-Sep-2022 11:08                8689
function.str-pad.php                               30-Sep-2022 11:08                7925
function.str-repeat.php                            30-Sep-2022 11:08                4578
function.str-replace.php                           30-Sep-2022 11:08               17975
function.str-rot13.php                             30-Sep-2022 11:08                3608
function.str-shuffle.php                           30-Sep-2022 11:08                5644
function.str-split.php                             30-Sep-2022 11:08                8407
function.str-starts-with.php                       30-Sep-2022 11:08                8564
function.str-word-count.php                        30-Sep-2022 11:08                9201
function.strcasecmp.php                            30-Sep-2022 11:08                5896
function.strchr.php                                30-Sep-2022 11:08                1648
function.strcmp.php                                30-Sep-2022 11:08                5636
function.strcoll.php                               30-Sep-2022 11:08                5323
function.strcspn.php                               30-Sep-2022 11:08               11466
function.stream-bucket-append.php                  30-Sep-2022 11:07                2168
function.stream-bucket-make-writeable.php          30-Sep-2022 11:07                4209
function.stream-bucket-new.php                     30-Sep-2022 11:07                2170
function.stream-bucket-prepend.php                 30-Sep-2022 11:07                6708
function.stream-context-create.php                 30-Sep-2022 11:07                7927
function.stream-context-get-default.php            30-Sep-2022 11:07                9507
function.stream-context-get-options.php            30-Sep-2022 11:07                4511
function.stream-context-get-params.php             30-Sep-2022 11:07                5493
function.stream-context-set-default.php            30-Sep-2022 11:07                6764
function.stream-context-set-option.php             30-Sep-2022 11:07                5386
function.stream-context-set-params.php             30-Sep-2022 11:07                4669
function.stream-copy-to-stream.php                 30-Sep-2022 11:07                7679
function.stream-filter-append.php                  30-Sep-2022 11:07               11532
function.stream-filter-prepend.php                 30-Sep-2022 11:07                8456
function.stream-filter-register.php                30-Sep-2022 11:07               20231
function.stream-filter-remove.php                  30-Sep-2022 11:07                6750
function.stream-get-contents.php                   30-Sep-2022 11:07                8606
function.stream-get-filters.php                    30-Sep-2022 11:07                4162
function.stream-get-line.php                       30-Sep-2022 11:07                5224
function.stream-get-meta-data.php                  30-Sep-2022 11:07               15653
function.stream-get-transports.php                 30-Sep-2022 11:07                4173
function.stream-get-wrappers.php                   30-Sep-2022 11:07                5091
function.stream-is-local.php                       30-Sep-2022 11:07                3981
function.stream-isatty.php                         30-Sep-2022 11:07                3815
function.stream-notification-callback.php          30-Sep-2022 11:07               25551
function.stream-register-wrapper.php               30-Sep-2022 11:07                1922
function.stream-resolve-include-path.php           30-Sep-2022 11:07                4156
function.stream-select.php                         30-Sep-2022 11:07               17467
function.stream-set-blocking.php                   30-Sep-2022 11:07                4981
function.stream-set-chunk-size.php                 30-Sep-2022 11:07                3379
function.stream-set-read-buffer.php                30-Sep-2022 11:07                3848
function.stream-set-timeout.php                    30-Sep-2022 11:07                8492
function.stream-set-write-buffer.php               30-Sep-2022 11:07                6201
function.stream-socket-accept.php                  30-Sep-2022 11:07                7882
function.stream-socket-client.php                  30-Sep-2022 11:07               18823
function.stream-socket-enable-crypto.php           30-Sep-2022 11:07               11490
function.stream-socket-get-name.php                30-Sep-2022 11:07                3630
function.stream-socket-pair.php                    30-Sep-2022 11:07                9376
function.stream-socket-recvfrom.php                30-Sep-2022 11:07               11224
function.stream-socket-sendto.php                  30-Sep-2022 11:07                7644
function.stream-socket-server.php                  30-Sep-2022 11:07               16573
function.stream-socket-shutdown.php                30-Sep-2022 11:07                6408
function.stream-supports-lock.php                  30-Sep-2022 11:07                3119
function.stream-wrapper-register.php               30-Sep-2022 11:07                9539
function.stream-wrapper-restore.php                30-Sep-2022 11:07                2754
function.stream-wrapper-unregister.php             30-Sep-2022 11:07                3020
function.strftime.php                              30-Sep-2022 11:07               62280
function.strip-tags.php                            30-Sep-2022 11:08                9678
function.stripcslashes.php                         30-Sep-2022 11:08                4022
function.stripos.php                               30-Sep-2022 11:08               12051
function.stripslashes.php                          30-Sep-2022 11:08                8019
function.stristr.php                               30-Sep-2022 11:08               10258
function.strlen.php                                30-Sep-2022 11:08                5428
function.strnatcasecmp.php                         30-Sep-2022 11:08                7214
function.strnatcmp.php                             30-Sep-2022 11:08                8567
function.strncasecmp.php                           30-Sep-2022 11:08                6559
function.strncmp.php                               30-Sep-2022 11:08                6379
function.strpbrk.php                               30-Sep-2022 11:08                5378
function.strpos.php                                30-Sep-2022 11:08               14632
function.strptime.php                              30-Sep-2022 11:07               12684
function.strrchr.php                               30-Sep-2022 11:08                7351
function.strrev.php                                30-Sep-2022 11:08                3137
function.strripos.php                              30-Sep-2022 11:08               10536
function.strrpos.php                               30-Sep-2022 11:08               13138
function.strspn.php                                30-Sep-2022 11:08               10816
function.strstr.php                                30-Sep-2022 11:08                8616
function.strtok.php                                30-Sep-2022 11:08               13013
function.strtolower.php                            30-Sep-2022 11:08                5105
function.strtotime.php                             30-Sep-2022 11:07               13805
function.strtoupper.php                            30-Sep-2022 11:08                5103
function.strtr.php                                 30-Sep-2022 11:08               11544
function.strval.php                                30-Sep-2022 11:08                6579
function.substr-compare.php                        30-Sep-2022 11:08               10659
function.substr-count.php                          30-Sep-2022 11:08                9705
function.substr-replace.php                        30-Sep-2022 11:08               16251
function.substr.php                                30-Sep-2022 11:08               23910
function.svn-add.php                               30-Sep-2022 11:08                6075
function.svn-auth-get-parameter.php                30-Sep-2022 11:08                3928
function.svn-auth-set-parameter.php                30-Sep-2022 11:08                5465
function.svn-blame.php                             30-Sep-2022 11:08                4875
function.svn-cat.php                               30-Sep-2022 11:08                4893
function.svn-checkout.php                          30-Sep-2022 11:08                7637
function.svn-cleanup.php                           30-Sep-2022 11:08                5397
function.svn-client-version.php                    30-Sep-2022 11:08                3627
function.svn-commit.php                            30-Sep-2022 11:08                7893
function.svn-delete.php                            30-Sep-2022 11:08                4511
function.svn-diff.php                              30-Sep-2022 11:08               14366
function.svn-export.php                            30-Sep-2022 11:08                4969
function.svn-fs-abort-txn.php                      30-Sep-2022 11:08                3181
function.svn-fs-apply-text.php                     30-Sep-2022 11:08                2739
function.svn-fs-begin-txn2.php                     30-Sep-2022 11:08                2729
function.svn-fs-change-node-prop.php               30-Sep-2022 11:08                3107
function.svn-fs-check-path.php                     30-Sep-2022 11:08                2841
function.svn-fs-contents-changed.php               30-Sep-2022 11:08                3190
function.svn-fs-copy.php                           30-Sep-2022 11:08                4022
function.svn-fs-delete.php                         30-Sep-2022 11:08                3415
function.svn-fs-dir-entries.php                    30-Sep-2022 11:08                2879
function.svn-fs-file-contents.php                  30-Sep-2022 11:08                2884
function.svn-fs-file-length.php                    30-Sep-2022 11:08                2777
function.svn-fs-is-dir.php                         30-Sep-2022 11:08                3484
function.svn-fs-is-file.php                        30-Sep-2022 11:08                3469
function.svn-fs-make-dir.php                       30-Sep-2022 11:08                3427
function.svn-fs-make-file.php                      30-Sep-2022 11:08                3442
function.svn-fs-node-created-rev.php               30-Sep-2022 11:08                2802
function.svn-fs-node-prop.php                      30-Sep-2022 11:08                2828
function.svn-fs-props-changed.php                  30-Sep-2022 11:08                3173
function.svn-fs-revision-prop.php                  30-Sep-2022 11:08                2862
function.svn-fs-revision-root.php                  30-Sep-2022 11:08                2824
function.svn-fs-txn-root.php                       30-Sep-2022 11:08                2628
function.svn-fs-youngest-rev.php                   30-Sep-2022 11:08                2660
function.svn-import.php                            30-Sep-2022 11:08                6145
function.svn-log.php                               30-Sep-2022 11:08                9332
function.svn-ls.php                                30-Sep-2022 11:08                7084
function.svn-mkdir.php                             30-Sep-2022 11:08                3097
function.svn-repos-create.php                      30-Sep-2022 11:08                2955
function.svn-repos-fs-begin-txn-for-commit.php     30-Sep-2022 11:08                3197
function.svn-repos-fs-commit-txn.php               30-Sep-2022 11:08                2749
function.svn-repos-fs.php                          30-Sep-2022 11:08                2650
function.svn-repos-hotcopy.php                     30-Sep-2022 11:08                2913
function.svn-repos-open.php                        30-Sep-2022 11:08                2554
function.svn-repos-recover.php                     30-Sep-2022 11:08                2603
function.svn-revert.php                            30-Sep-2022 11:08                3308
function.svn-status.php                            30-Sep-2022 11:08               14881
function.svn-update.php                            30-Sep-2022 11:08                6058
function.swoole-async-dns-lookup.php               30-Sep-2022 11:07                3566
function.swoole-async-read.php                     30-Sep-2022 11:07                4150
function.swoole-async-readfile.php                 30-Sep-2022 11:07                3591
function.swoole-async-set.php                      30-Sep-2022 11:07                2310
function.swoole-async-write.php                    30-Sep-2022 11:07                3431
function.swoole-async-writefile.php                30-Sep-2022 11:07                3459
function.swoole-clear-error.php                    30-Sep-2022 11:07                2243
function.swoole-client-select.php                  30-Sep-2022 11:07                3197
function.swoole-cpu-num.php                        30-Sep-2022 11:07                2061
function.swoole-errno.php                          30-Sep-2022 11:07                2038
function.swoole-error-log.php                      30-Sep-2022 11:07                2977
function.swoole-event-add.php                      30-Sep-2022 11:07                3320
function.swoole-event-defer.php                    30-Sep-2022 11:07                2480
function.swoole-event-del.php                      30-Sep-2022 11:07                2388
function.swoole-event-exit.php                     30-Sep-2022 11:07                2137
function.swoole-event-set.php                      30-Sep-2022 11:07                3307
function.swoole-event-wait.php                     30-Sep-2022 11:07                2108
function.swoole-event-write.php                    30-Sep-2022 11:07                2604
function.swoole-get-local-ip.php                   30-Sep-2022 11:07                2132
function.swoole-last-error.php                     30-Sep-2022 11:07                2087
function.swoole-load-module.php                    30-Sep-2022 11:07                2284
function.swoole-select.php                         30-Sep-2022 11:07                3164
function.swoole-set-process-name.php               30-Sep-2022 11:07                2472
function.swoole-strerror.php                       30-Sep-2022 11:07                2393
function.swoole-timer-after.php                    30-Sep-2022 11:07                2926
function.swoole-timer-exists.php                   30-Sep-2022 11:07                2289
function.swoole-timer-tick.php                     30-Sep-2022 11:07                2799
function.swoole-version.php                        30-Sep-2022 11:07                2064
function.symlink.php                               30-Sep-2022 11:07                5454
function.sys-get-temp-dir.php                      30-Sep-2022 11:07                4223
function.sys-getloadavg.php                        30-Sep-2022 11:07                4135
function.syslog.php                                30-Sep-2022 11:08                9359
function.system.php                                30-Sep-2022 11:07                8002
function.taint.php                                 30-Sep-2022 11:08                2573
function.tan.php                                   30-Sep-2022 11:07                4392
function.tanh.php                                  30-Sep-2022 11:07                3342
function.tcpwrap-check.php                         30-Sep-2022 11:08                5698
function.tempnam.php                               30-Sep-2022 11:07                7481
function.textdomain.php                            30-Sep-2022 11:07                3249
function.tidy-access-count.php                     30-Sep-2022 11:08                6710
function.tidy-config-count.php                     30-Sep-2022 11:08                4351
function.tidy-error-count.php                      30-Sep-2022 11:08                5380
function.tidy-get-output.php                       30-Sep-2022 11:08                4263
function.tidy-warning-count.php                    30-Sep-2022 11:08                4961
function.time-nanosleep.php                        30-Sep-2022 11:07                8917
function.time-sleep-until.php                      30-Sep-2022 11:07                5686
function.time.php                                  30-Sep-2022 11:07                4709
function.timezone-abbreviations-list.php           30-Sep-2022 11:07                1918
function.timezone-identifiers-list.php             30-Sep-2022 11:07                1934
function.timezone-location-get.php                 30-Sep-2022 11:07                1890
function.timezone-name-from-abbr.php               30-Sep-2022 11:07                6214
function.timezone-name-get.php                     30-Sep-2022 11:07                1834
function.timezone-offset-get.php                   30-Sep-2022 11:07                1832
function.timezone-open.php                         30-Sep-2022 11:07                1820
function.timezone-transitions-get.php              30-Sep-2022 11:07                1893
function.timezone-version-get.php                  30-Sep-2022 11:07                4547
function.tmpfile.php                               30-Sep-2022 11:07                5632
function.token-get-all.php                         30-Sep-2022 11:08               12492
function.token-name.php                            30-Sep-2022 11:08                4199
function.touch.php                                 30-Sep-2022 11:07                8007
function.trader-acos.php                           30-Sep-2022 11:07                2330
function.trader-ad.php                             30-Sep-2022 11:07                3071
function.trader-add.php                            30-Sep-2022 11:07                2610
function.trader-adosc.php                          30-Sep-2022 11:07                3823
function.trader-adx.php                            30-Sep-2022 11:07                3160
function.trader-adxr.php                           30-Sep-2022 11:07                3171
function.trader-apo.php                            30-Sep-2022 11:07                3371
function.trader-aroon.php                          30-Sep-2022 11:07                2788
function.trader-aroonosc.php                       30-Sep-2022 11:07                2825
function.trader-asin.php                           30-Sep-2022 11:07                2348
function.trader-atan.php                           30-Sep-2022 11:07                2341
function.trader-atr.php                            30-Sep-2022 11:07                3150
function.trader-avgprice.php                       30-Sep-2022 11:07                3125
function.trader-bbands.php                         30-Sep-2022 11:07                4076
function.trader-beta.php                           30-Sep-2022 11:07                2761
function.trader-bop.php                            30-Sep-2022 11:07                3074
function.trader-cci.php                            30-Sep-2022 11:07                3155
function.trader-cdl2crows.php                      30-Sep-2022 11:07                3147
function.trader-cdl3blackcrows.php                 30-Sep-2022 11:07                3209
function.trader-cdl3inside.php                     30-Sep-2022 11:07                3190
function.trader-cdl3linestrike.php                 30-Sep-2022 11:07                3213
function.trader-cdl3outside.php                    30-Sep-2022 11:07                3205
function.trader-cdl3starsinsouth.php               30-Sep-2022 11:07                3254
function.trader-cdl3whitesoldiers.php              30-Sep-2022 11:07                3278
function.trader-cdlabandonedbaby.php               30-Sep-2022 11:07                3612
function.trader-cdladvanceblock.php                30-Sep-2022 11:07                3231
function.trader-cdlbelthold.php                    30-Sep-2022 11:07                3187
function.trader-cdlbreakaway.php                   30-Sep-2022 11:07                3201
function.trader-cdlclosingmarubozu.php             30-Sep-2022 11:07                3272
function.trader-cdlconcealbabyswall.php            30-Sep-2022 11:07                3295
function.trader-cdlcounterattack.php               30-Sep-2022 11:07                3259
function.trader-cdldarkcloudcover.php              30-Sep-2022 11:07                3606
function.trader-cdldoji.php                        30-Sep-2022 11:07                3144
function.trader-cdldojistar.php                    30-Sep-2022 11:07                3179
function.trader-cdldragonflydoji.php               30-Sep-2022 11:07                3234
function.trader-cdlengulfing.php                   30-Sep-2022 11:07                3219
function.trader-cdleveningdojistar.php             30-Sep-2022 11:07                3623
function.trader-cdleveningstar.php                 30-Sep-2022 11:07                3600
function.trader-cdlgapsidesidewhite.php            30-Sep-2022 11:07                3302
function.trader-cdlgravestonedoji.php              30-Sep-2022 11:07                3255
function.trader-cdlhammer.php                      30-Sep-2022 11:07                3170
function.trader-cdlhangingman.php                  30-Sep-2022 11:07                3191
function.trader-cdlharami.php                      30-Sep-2022 11:07                3172
function.trader-cdlharamicross.php                 30-Sep-2022 11:07                3214
function.trader-cdlhighwave.php                    30-Sep-2022 11:07                3188
function.trader-cdlhikkake.php                     30-Sep-2022 11:07                3177
function.trader-cdlhikkakemod.php                  30-Sep-2022 11:07                3218
function.trader-cdlhomingpigeon.php                30-Sep-2022 11:07                3239
function.trader-cdlidentical3crows.php             30-Sep-2022 11:07                3263
function.trader-cdlinneck.php                      30-Sep-2022 11:07                3189
function.trader-cdlinvertedhammer.php              30-Sep-2022 11:07                3237
function.trader-cdlkicking.php                     30-Sep-2022 11:07                3191
function.trader-cdlkickingbylength.php             30-Sep-2022 11:07                3297
function.trader-cdlladderbottom.php                30-Sep-2022 11:07                3247
function.trader-cdllongleggeddoji.php              30-Sep-2022 11:07                3252
function.trader-cdllongline.php                    30-Sep-2022 11:07                3196
function.trader-cdlmarubozu.php                    30-Sep-2022 11:07                3182
function.trader-cdlmatchinglow.php                 30-Sep-2022 11:07                3208
function.trader-cdlmathold.php                     30-Sep-2022 11:07                3546
function.trader-cdlmorningdojistar.php             30-Sep-2022 11:07                3619
function.trader-cdlmorningstar.php                 30-Sep-2022 11:07                3580
function.trader-cdlonneck.php                      30-Sep-2022 11:07                3169
function.trader-cdlpiercing.php                    30-Sep-2022 11:07                3186
function.trader-cdlrickshawman.php                 30-Sep-2022 11:07                3226
function.trader-cdlrisefall3methods.php            30-Sep-2022 11:07                3296
function.trader-cdlseparatinglines.php             30-Sep-2022 11:07                3278
function.trader-cdlshootingstar.php                30-Sep-2022 11:07                3237
function.trader-cdlshortline.php                   30-Sep-2022 11:07                3209
function.trader-cdlspinningtop.php                 30-Sep-2022 11:07                3224
function.trader-cdlstalledpattern.php              30-Sep-2022 11:07                3259
function.trader-cdlsticksandwich.php               30-Sep-2022 11:07                3240
function.trader-cdltakuri.php                      30-Sep-2022 11:07                3211
function.trader-cdltasukigap.php                   30-Sep-2022 11:07                3186
function.trader-cdlthrusting.php                   30-Sep-2022 11:07                3195
function.trader-cdltristar.php                     30-Sep-2022 11:07                3183
function.trader-cdlunique3river.php                30-Sep-2022 11:07                3234
function.trader-cdlupsidegap2crows.php             30-Sep-2022 11:07                3282
function.trader-cdlxsidegap3methods.php            30-Sep-2022 11:07                3281
function.trader-ceil.php                           30-Sep-2022 11:07                2365
function.trader-cmo.php                            30-Sep-2022 11:07                2528
function.trader-correl.php                         30-Sep-2022 11:07                2813
function.trader-cos.php                            30-Sep-2022 11:07                2331
function.trader-cosh.php                           30-Sep-2022 11:07                2347
function.trader-dema.php                           30-Sep-2022 11:07                2539
function.trader-div.php                            30-Sep-2022 11:07                2626
function.trader-dx.php                             30-Sep-2022 11:07                3136
function.trader-ema.php                            30-Sep-2022 11:07                2522
function.trader-errno.php                          30-Sep-2022 11:07                2131
function.trader-exp.php                            30-Sep-2022 11:07                2375
function.trader-floor.php                          30-Sep-2022 11:07                2357
function.trader-get-compat.php                     30-Sep-2022 11:07                2321
function.trader-get-unstable-period.php            30-Sep-2022 11:07                2579
function.trader-ht-dcperiod.php                    30-Sep-2022 11:07                2345
function.trader-ht-dcphase.php                     30-Sep-2022 11:07                2316
function.trader-ht-phasor.php                      30-Sep-2022 11:07                2297
function.trader-ht-sine.php                        30-Sep-2022 11:07                2276
function.trader-ht-trendline.php                   30-Sep-2022 11:07                2337
function.trader-ht-trendmode.php                   30-Sep-2022 11:07                2327
function.trader-kama.php                           30-Sep-2022 11:07                2577
function.trader-linearreg-angle.php                30-Sep-2022 11:07                2671
function.trader-linearreg-intercept.php            30-Sep-2022 11:07                2729
function.trader-linearreg-slope.php                30-Sep-2022 11:07                2681
function.trader-linearreg.php                      30-Sep-2022 11:07                2593
function.trader-ln.php                             30-Sep-2022 11:07                2333
function.trader-log10.php                          30-Sep-2022 11:07                2337
function.trader-ma.php                             30-Sep-2022 11:07                2889
function.trader-macd.php                           30-Sep-2022 11:07                3356
function.trader-macdext.php                        30-Sep-2022 11:07                4687
function.trader-macdfix.php                        30-Sep-2022 11:07                2623
function.trader-mama.php                           30-Sep-2022 11:07                2910
function.trader-mavp.php                           30-Sep-2022 11:07                3709
function.trader-max.php                            30-Sep-2022 11:07                2543
function.trader-maxindex.php                       30-Sep-2022 11:07                2600
function.trader-medprice.php                       30-Sep-2022 11:07                2509
function.trader-mfi.php                            30-Sep-2022 11:07                3442
function.trader-midpoint.php                       30-Sep-2022 11:07                2574
function.trader-midprice.php                       30-Sep-2022 11:07                2839
function.trader-min.php                            30-Sep-2022 11:07                2550
function.trader-minindex.php                       30-Sep-2022 11:07                2595
function.trader-minmax.php                         30-Sep-2022 11:07                2599
function.trader-minmaxindex.php                    30-Sep-2022 11:07                2650
function.trader-minus-di.php                       30-Sep-2022 11:07                3223
function.trader-minus-dm.php                       30-Sep-2022 11:07                2839
function.trader-mom.php                            30-Sep-2022 11:07                2514
function.trader-mult.php                           30-Sep-2022 11:07                2626
function.trader-natr.php                           30-Sep-2022 11:07                3161
function.trader-obv.php                            30-Sep-2022 11:07                2464
function.trader-plus-di.php                        30-Sep-2022 11:07                3194
function.trader-plus-dm.php                        30-Sep-2022 11:07                2826
function.trader-ppo.php                            30-Sep-2022 11:07                3375
function.trader-roc.php                            30-Sep-2022 11:07                2538
function.trader-rocp.php                           30-Sep-2022 11:07                2566
function.trader-rocr.php                           30-Sep-2022 11:07                2551
function.trader-rocr100.php                        30-Sep-2022 11:07                2591
function.trader-rsi.php                            30-Sep-2022 11:07                2519
function.trader-sar.php                            30-Sep-2022 11:07                3416
function.trader-sarext.php                         30-Sep-2022 11:07                6504
function.trader-set-compat.php                     30-Sep-2022 11:07                2519
function.trader-set-unstable-period.php            30-Sep-2022 11:07                3053
function.trader-sin.php                            30-Sep-2022 11:07                2355
function.trader-sinh.php                           30-Sep-2022 11:07                2343
function.trader-sma.php                            30-Sep-2022 11:07                2519
function.trader-sqrt.php                           30-Sep-2022 11:07                2336
function.trader-stddev.php                         30-Sep-2022 11:07                2809
function.trader-stoch.php                          30-Sep-2022 11:07                4812
function.trader-stochf.php                         30-Sep-2022 11:07                4027
function.trader-stochrsi.php                       30-Sep-2022 11:07                3834
function.trader-sub.php                            30-Sep-2022 11:07                2631
function.trader-sum.php                            30-Sep-2022 11:07                2501
function.trader-t3.php                             30-Sep-2022 11:07                2826
function.trader-tan.php                            30-Sep-2022 11:07                2324
function.trader-tanh.php                           30-Sep-2022 11:07                2348
function.trader-tema.php                           30-Sep-2022 11:07                2545
function.trader-trange.php                         30-Sep-2022 11:07                2737
function.trader-trima.php                          30-Sep-2022 11:07                2547
function.trader-trix.php                           30-Sep-2022 11:07                2557
function.trader-tsf.php                            30-Sep-2022 11:07                2526
function.trader-typprice.php                       30-Sep-2022 11:07                2760
function.trader-ultosc.php                         30-Sep-2022 11:07                3910
function.trader-var.php                            30-Sep-2022 11:07                2779
function.trader-wclprice.php                       30-Sep-2022 11:07                2765
function.trader-willr.php                          30-Sep-2022 11:07                3167
function.trader-wma.php                            30-Sep-2022 11:07                2543
function.trait-exists.php                          30-Sep-2022 11:08                2780
function.trigger-error.php                         30-Sep-2022 11:07                6459
function.trim.php                                  30-Sep-2022 11:08               13986
function.uasort.php                                30-Sep-2022 11:08               10014
function.ucfirst.php                               30-Sep-2022 11:08                5571
function.ucwords.php                               30-Sep-2022 11:08                9927
function.ui-draw-text-font-fontfamilies.php        30-Sep-2022 11:08                2273
function.ui-quit.php                               30-Sep-2022 11:08                2004
function.ui-run.php                                30-Sep-2022 11:08                2312
function.uksort.php                                30-Sep-2022 11:08                9333
function.umask.php                                 30-Sep-2022 11:07                5827
function.uniqid.php                                30-Sep-2022 11:07                7790
function.unixtojd.php                              30-Sep-2022 11:07                3833
function.unlink.php                                30-Sep-2022 11:07                6042
function.unpack.php                                30-Sep-2022 11:07               10826
function.unregister-tick-function.php              30-Sep-2022 11:08                3203
function.unserialize.php                           30-Sep-2022 11:08               16996
function.unset.php                                 30-Sep-2022 11:08               15764
function.untaint.php                               30-Sep-2022 11:08                2373
function.uopz-add-function.php                     30-Sep-2022 11:07                6566
function.uopz-allow-exit.php                       30-Sep-2022 11:07                4525
function.uopz-backup.php                           30-Sep-2022 11:07                4360
function.uopz-compose.php                          30-Sep-2022 11:07                6857
function.uopz-copy.php                             30-Sep-2022 11:07                5072
function.uopz-del-function.php                     30-Sep-2022 11:07                6114
function.uopz-delete.php                           30-Sep-2022 11:07                5874
function.uopz-extend.php                           30-Sep-2022 11:07                4871
function.uopz-flags.php                            30-Sep-2022 11:07               11090
function.uopz-function.php                         30-Sep-2022 11:07                7054
function.uopz-get-exit-status.php                  30-Sep-2022 11:07                4172
function.uopz-get-hook.php                         30-Sep-2022 11:07                5162
function.uopz-get-mock.php                         30-Sep-2022 11:07                5171
function.uopz-get-property.php                     30-Sep-2022 11:07                6095
function.uopz-get-return.php                       30-Sep-2022 11:07                4308
function.uopz-get-static.php                       30-Sep-2022 11:07                4776
function.uopz-implement.php                        30-Sep-2022 11:07                4897
function.uopz-overload.php                         30-Sep-2022 11:07                3845
function.uopz-redefine.php                         30-Sep-2022 11:07                4861
function.uopz-rename.php                           30-Sep-2022 11:07                6536
function.uopz-restore.php                          30-Sep-2022 11:07                4734
function.uopz-set-hook.php                         30-Sep-2022 11:07                5336
function.uopz-set-mock.php                         30-Sep-2022 11:07               12908
function.uopz-set-property.php                     30-Sep-2022 11:07                7540
function.uopz-set-return.php                       30-Sep-2022 11:07                9356
function.uopz-set-static.php                       30-Sep-2022 11:07                5415
function.uopz-undefine.php                         30-Sep-2022 11:07                4280
function.uopz-unset-hook.php                       30-Sep-2022 11:07                5230
function.uopz-unset-mock.php                       30-Sep-2022 11:07                5589
function.uopz-unset-return.php                     30-Sep-2022 11:07                4604
function.urldecode.php                             30-Sep-2022 11:08                6646
function.urlencode.php                             30-Sep-2022 11:08                8415
function.use-soap-error-handler.php                30-Sep-2022 11:08                3883
function.user-error.php                            30-Sep-2022 11:07                1706
function.usleep.php                                30-Sep-2022 11:07                6047
function.usort.php                                 30-Sep-2022 11:08               28196
function.utf8-decode.php                           30-Sep-2022 11:08                9524
function.utf8-encode.php                           30-Sep-2022 11:08                8024
function.var-dump.php                              30-Sep-2022 11:08                7119
function.var-export.php                            30-Sep-2022 11:08               17796
function.var-representation.php                    30-Sep-2022 11:08               14325
function.variant-abs.php                           30-Sep-2022 11:08                4365
function.variant-add.php                           30-Sep-2022 11:08                5779
function.variant-and.php                           30-Sep-2022 11:08                6496
function.variant-cast.php                          30-Sep-2022 11:08                3551
function.variant-cat.php                           30-Sep-2022 11:08                4991
function.variant-cmp.php                           30-Sep-2022 11:08                7658
function.variant-date-from-timestamp.php           30-Sep-2022 11:08                3631
function.variant-date-to-timestamp.php             30-Sep-2022 11:08                3749
function.variant-div.php                           30-Sep-2022 11:08                6656
function.variant-eqv.php                           30-Sep-2022 11:08                4662
function.variant-fix.php                           30-Sep-2022 11:08                5775
function.variant-get-type.php                      30-Sep-2022 11:08                3572
function.variant-idiv.php                          30-Sep-2022 11:08                5973
function.variant-imp.php                           30-Sep-2022 11:08                6007
function.variant-int.php                           30-Sep-2022 11:08                5224
function.variant-mod.php                           30-Sep-2022 11:08                5039
function.variant-mul.php                           30-Sep-2022 11:08                6079
function.variant-neg.php                           30-Sep-2022 11:08                4054
function.variant-not.php                           30-Sep-2022 11:08                4244
function.variant-or.php                            30-Sep-2022 11:08                6649
function.variant-pow.php                           30-Sep-2022 11:08                4849
function.variant-round.php                         30-Sep-2022 11:08                4579
function.variant-set-type.php                      30-Sep-2022 11:08                3626
function.variant-set.php                           30-Sep-2022 11:08                2946
function.variant-sub.php                           30-Sep-2022 11:08                5704
function.variant-xor.php                           30-Sep-2022 11:08                5999
function.version-compare.php                       30-Sep-2022 11:07               12022
function.vfprintf.php                              30-Sep-2022 11:08               16942
function.virtual.php                               30-Sep-2022 11:08                5625
function.vprintf.php                               30-Sep-2022 11:08               16321
function.vsprintf.php                              30-Sep-2022 11:08               16655
function.wddx-add-vars.php                         30-Sep-2022 11:08                3751
function.wddx-deserialize.php                      30-Sep-2022 11:08                3904
function.wddx-packet-end.php                       30-Sep-2022 11:08                2799
function.wddx-packet-start.php                     30-Sep-2022 11:08                2991
function.wddx-serialize-value.php                  30-Sep-2022 11:08                3234
function.wddx-serialize-vars.php                   30-Sep-2022 11:08                6134
function.win32-continue-service.php                30-Sep-2022 11:08                6939
function.win32-create-service.php                  30-Sep-2022 11:08               34224
function.win32-delete-service.php                  30-Sep-2022 11:08                7401
function.win32-get-last-control-message.php        30-Sep-2022 11:08                7646
function.win32-pause-service.php                   30-Sep-2022 11:08                6905
function.win32-query-service-status.php            30-Sep-2022 11:08                9048
function.win32-send-custom-control.php             30-Sep-2022 11:08                7036
function.win32-set-service-exit-code.php           30-Sep-2022 11:08                5679
function.win32-set-service-exit-mode.php           30-Sep-2022 11:08                5722
function.win32-set-service-status.php              30-Sep-2022 11:08                8875
function.win32-start-service-ctrl-dispatcher.php   30-Sep-2022 11:08               11928
function.win32-start-service.php                   30-Sep-2022 11:08                6907
function.win32-stop-service.php                    30-Sep-2022 11:08                6820
function.wincache-fcache-fileinfo.php              30-Sep-2022 11:07                9819
function.wincache-fcache-meminfo.php               30-Sep-2022 11:07                7678
function.wincache-lock.php                         30-Sep-2022 11:07                9231
function.wincache-ocache-fileinfo.php              30-Sep-2022 11:07               10519
function.wincache-ocache-meminfo.php               30-Sep-2022 11:07                7848
function.wincache-refresh-if-changed.php           30-Sep-2022 11:07                8413
function.wincache-rplist-fileinfo.php              30-Sep-2022 11:07                8019
function.wincache-rplist-meminfo.php               30-Sep-2022 11:07                7772
function.wincache-scache-info.php                  30-Sep-2022 11:07               10052
function.wincache-scache-meminfo.php               30-Sep-2022 11:07                7186
function.wincache-ucache-add.php                   30-Sep-2022 11:07               14108
function.wincache-ucache-cas.php                   30-Sep-2022 11:07                6166
function.wincache-ucache-clear.php                 30-Sep-2022 11:07                7865
function.wincache-ucache-dec.php                   30-Sep-2022 11:07                6213
function.wincache-ucache-delete.php                30-Sep-2022 11:07               11792
function.wincache-ucache-exists.php                30-Sep-2022 11:07                6321
function.wincache-ucache-get.php                   30-Sep-2022 11:07               11031
function.wincache-ucache-inc.php                   30-Sep-2022 11:07                6205
function.wincache-ucache-info.php                  30-Sep-2022 11:07               11930
function.wincache-ucache-meminfo.php               30-Sep-2022 11:07                7426
function.wincache-ucache-set.php                   30-Sep-2022 11:07               14210
function.wincache-unlock.php                       30-Sep-2022 11:07                8435
function.wordwrap.php                              30-Sep-2022 11:08                9103
function.xattr-get.php                             30-Sep-2022 11:07                6029
function.xattr-list.php                            30-Sep-2022 11:07                6621
function.xattr-remove.php                          30-Sep-2022 11:07                6200
function.xattr-set.php                             30-Sep-2022 11:07                7883
function.xattr-supported.php                       30-Sep-2022 11:07                5351
function.xdiff-file-bdiff-size.php                 30-Sep-2022 11:07                4985
function.xdiff-file-bdiff.php                      30-Sep-2022 11:07                6092
function.xdiff-file-bpatch.php                     30-Sep-2022 11:07                6701
function.xdiff-file-diff-binary.php                30-Sep-2022 11:07                6566
function.xdiff-file-diff.php                       30-Sep-2022 11:07                7184
function.xdiff-file-merge3.php                     30-Sep-2022 11:07                6838
function.xdiff-file-patch-binary.php               30-Sep-2022 11:07                6796
function.xdiff-file-patch.php                      30-Sep-2022 11:07                9157
function.xdiff-file-rabdiff.php                    30-Sep-2022 11:07                6701
function.xdiff-string-bdiff-size.php               30-Sep-2022 11:07                5286
function.xdiff-string-bdiff.php                    30-Sep-2022 11:07                3876
function.xdiff-string-bpatch.php                   30-Sep-2022 11:07                3957
function.xdiff-string-diff-binary.php              30-Sep-2022 11:07                4421
function.xdiff-string-diff.php                     30-Sep-2022 11:07                7689
function.xdiff-string-merge3.php                   30-Sep-2022 11:07                4705
function.xdiff-string-patch-binary.php             30-Sep-2022 11:07                4548
function.xdiff-string-patch.php                    30-Sep-2022 11:07                8474
function.xdiff-string-rabdiff.php                  30-Sep-2022 11:07                4537
function.xhprof-disable.php                        30-Sep-2022 11:07                3903
function.xhprof-enable.php                         30-Sep-2022 11:07                7972
function.xhprof-sample-disable.php                 30-Sep-2022 11:07                4710
function.xhprof-sample-enable.php                  30-Sep-2022 11:07                3611
function.xml-error-string.php                      30-Sep-2022 11:08                3184
function.xml-get-current-byte-index.php            30-Sep-2022 11:08                4745
function.xml-get-current-column-number.php         30-Sep-2022 11:08                4445
function.xml-get-current-line-number.php           30-Sep-2022 11:08                4245
function.xml-get-error-code.php                    30-Sep-2022 11:08                3919
function.xml-parse-into-struct.php                 30-Sep-2022 11:08               21409
function.xml-parse.php                             30-Sep-2022 11:08                8537
function.xml-parser-create-ns.php                  30-Sep-2022 11:08                5469
function.xml-parser-create.php                     30-Sep-2022 11:08                5074
function.xml-parser-free.php                       30-Sep-2022 11:08                4108
function.xml-parser-get-option.php                 30-Sep-2022 11:08                4658
function.xml-parser-set-option.php                 30-Sep-2022 11:08                6367
function.xml-set-character-data-handler.php        30-Sep-2022 11:08                6120
function.xml-set-default-handler.php               30-Sep-2022 11:08                5987
function.xml-set-element-handler.php               30-Sep-2022 11:08                8991
function.xml-set-end-namespace-decl-handler.php    30-Sep-2022 11:08                7147
function.xml-set-external-entity-ref-handler.php   30-Sep-2022 11:08                9470
function.xml-set-notation-decl-handler.php         30-Sep-2022 11:08                7814
function.xml-set-object.php                        30-Sep-2022 11:08               10692
function.xml-set-processing-instruction-handler..> 30-Sep-2022 11:08                7272
function.xml-set-start-namespace-decl-handler.php  30-Sep-2022 11:08                7283
function.xml-set-unparsed-entity-decl-handler.php  30-Sep-2022 11:08                8551
function.xmlrpc-decode-request.php                 30-Sep-2022 11:08                2788
function.xmlrpc-decode.php                         30-Sep-2022 11:08                4223
function.xmlrpc-encode-request.php                 30-Sep-2022 11:08                9027
function.xmlrpc-encode.php                         30-Sep-2022 11:08                2484
function.xmlrpc-get-type.php                       30-Sep-2022 11:08                6617
function.xmlrpc-is-fault.php                       30-Sep-2022 11:08                3847
function.xmlrpc-parse-method-descriptions.php      30-Sep-2022 11:08                2584
function.xmlrpc-server-add-introspection-data.php  30-Sep-2022 11:08                2720
function.xmlrpc-server-call-method.php             30-Sep-2022 11:08                3123
function.xmlrpc-server-create.php                  30-Sep-2022 11:08                2353
function.xmlrpc-server-destroy.php                 30-Sep-2022 11:08                2506
function.xmlrpc-server-register-introspection-c..> 30-Sep-2022 11:08                2796
function.xmlrpc-server-register-method.php         30-Sep-2022 11:08                2823
function.xmlrpc-set-type.php                       30-Sep-2022 11:08                5452
function.yaml-emit-file.php                        30-Sep-2022 11:08                5914
function.yaml-emit.php                             30-Sep-2022 11:08               12887
function.yaml-parse-file.php                       30-Sep-2022 11:08                6029
function.yaml-parse-url.php                        30-Sep-2022 11:08                6355
function.yaml-parse.php                            30-Sep-2022 11:08               10265
function.yaz-addinfo.php                           30-Sep-2022 11:08                3379
function.yaz-ccl-conf.php                          30-Sep-2022 11:08                5802
function.yaz-ccl-parse.php                         30-Sep-2022 11:08                6740
function.yaz-close.php                             30-Sep-2022 11:08                3326
function.yaz-connect.php                           30-Sep-2022 11:08                9792
function.yaz-database.php                          30-Sep-2022 11:08                3207
function.yaz-element.php                           30-Sep-2022 11:08                3760
function.yaz-errno.php                             30-Sep-2022 11:08                3679
function.yaz-error.php                             30-Sep-2022 11:08                3314
function.yaz-es-result.php                         30-Sep-2022 11:08                3258
function.yaz-es.php                                30-Sep-2022 11:08                7429
function.yaz-get-option.php                        30-Sep-2022 11:08                3319
function.yaz-hits.php                              30-Sep-2022 11:08                5051
function.yaz-itemorder.php                         30-Sep-2022 11:08                7093
function.yaz-present.php                           30-Sep-2022 11:08                2859
function.yaz-range.php                             30-Sep-2022 11:08                3464
function.yaz-record.php                            30-Sep-2022 11:08               15534
function.yaz-scan-result.php                       30-Sep-2022 11:08                3920
function.yaz-scan.php                              30-Sep-2022 11:08                9953
function.yaz-schema.php                            30-Sep-2022 11:08                3394
function.yaz-search.php                            30-Sep-2022 11:08                8991
function.yaz-set-option.php                        30-Sep-2022 11:08                7133
function.yaz-sort.php                              30-Sep-2022 11:08                5655
function.yaz-syntax.php                            30-Sep-2022 11:08                3311
function.yaz-wait.php                              30-Sep-2022 11:08                4228
function.zend-thread-id.php                        30-Sep-2022 11:07                3775
function.zend-version.php                          30-Sep-2022 11:07                3945
function.zip-close.php                             30-Sep-2022 11:07                4040
function.zip-entry-close.php                       30-Sep-2022 11:07                4175
function.zip-entry-compressedsize.php              30-Sep-2022 11:07                4502
function.zip-entry-compressionmethod.php           30-Sep-2022 11:07                4582
function.zip-entry-filesize.php                    30-Sep-2022 11:07                4458
function.zip-entry-name.php                        30-Sep-2022 11:07                4366
function.zip-entry-open.php                        30-Sep-2022 11:07                5822
function.zip-entry-read.php                        30-Sep-2022 11:07                5155
function.zip-open.php                              30-Sep-2022 11:07                4512
function.zip-read.php                              30-Sep-2022 11:07                4835
function.zlib-decode.php                           30-Sep-2022 11:07                3308
function.zlib-encode.php                           30-Sep-2022 11:07                5056
function.zlib-get-coding-type.php                  30-Sep-2022 11:07                2804
function.zookeeper-dispatch.php                    30-Sep-2022 11:08                8621
functional.parallel.php                            30-Sep-2022 11:07                2540
functions.anonymous.php                            30-Sep-2022 11:07               27300
functions.arguments.php                            30-Sep-2022 11:07               49781
functions.arrow.php                                30-Sep-2022 11:07               11315
functions.first_class_callable_syntax.php          30-Sep-2022 11:07               12573
functions.internal.php                             30-Sep-2022 11:07                8631
functions.returning-values.php                     30-Sep-2022 11:07                6518
functions.user-defined.php                         30-Sep-2022 11:07               10676
functions.variable-functions.php                   30-Sep-2022 11:07               12805
gearman.configuration.php                          30-Sep-2022 11:08                1190
gearman.constants.php                              30-Sep-2022 11:08               17939
gearman.examples-reverse-bg.php                    30-Sep-2022 11:08               11689
gearman.examples-reverse-task.php                  30-Sep-2022 11:08               18868
gearman.examples-reverse.php                       30-Sep-2022 11:08               14304
gearman.examples.php                               30-Sep-2022 11:08                1532
gearman.installation.php                           30-Sep-2022 11:08                1653
gearman.requirements.php                           30-Sep-2022 11:08                1477
gearman.resources.php                              30-Sep-2022 11:08                1195
gearman.setup.php                                  30-Sep-2022 11:08                1553
gearmanclient.addoptions.php                       30-Sep-2022 11:08                2846
gearmanclient.addserver.php                        30-Sep-2022 11:08                4948
gearmanclient.addservers.php                       30-Sep-2022 11:08                4410
gearmanclient.addtask.php                          30-Sep-2022 11:08               15238
gearmanclient.addtaskbackground.php                30-Sep-2022 11:08               21503
gearmanclient.addtaskhigh.php                      30-Sep-2022 11:08               11341
gearmanclient.addtaskhighbackground.php            30-Sep-2022 11:08                5880
gearmanclient.addtasklow.php                       30-Sep-2022 11:08               11323
gearmanclient.addtasklowbackground.php             30-Sep-2022 11:08                5873
gearmanclient.addtaskstatus.php                    30-Sep-2022 11:08                9911
gearmanclient.clearcallbacks.php                   30-Sep-2022 11:08                4341
gearmanclient.clone.php                            30-Sep-2022 11:08                2582
gearmanclient.construct.php                        30-Sep-2022 11:08                2815
gearmanclient.context.php                          30-Sep-2022 11:08                2828
gearmanclient.data.php                             30-Sep-2022 11:08                3095
gearmanclient.do.php                               30-Sep-2022 11:08               23901
gearmanclient.dobackground.php                     30-Sep-2022 11:08                9729
gearmanclient.dohigh.php                           30-Sep-2022 11:08                4746
gearmanclient.dohighbackground.php                 30-Sep-2022 11:08                4573
gearmanclient.dojobhandle.php                      30-Sep-2022 11:08                2885
gearmanclient.dolow.php                            30-Sep-2022 11:08                4732
gearmanclient.dolowbackground.php                  30-Sep-2022 11:08                4555
gearmanclient.donormal.php                         30-Sep-2022 11:08               24289
gearmanclient.dostatus.php                         30-Sep-2022 11:08                8780
gearmanclient.echo.php                             30-Sep-2022 11:08                2757
gearmanclient.error.php                            30-Sep-2022 11:08                2573
gearmanclient.geterrno.php                         30-Sep-2022 11:08                2597
gearmanclient.jobstatus.php                        30-Sep-2022 11:08                8638
gearmanclient.ping.php                             30-Sep-2022 11:08                2730
gearmanclient.removeoptions.php                    30-Sep-2022 11:08                2492
gearmanclient.returncode.php                       30-Sep-2022 11:08                2232
gearmanclient.runtasks.php                         30-Sep-2022 11:08                3566
gearmanclient.setclientcallback.php                30-Sep-2022 11:08                5342
gearmanclient.setcompletecallback.php              30-Sep-2022 11:08                5177
gearmanclient.setcontext.php                       30-Sep-2022 11:08                3047
gearmanclient.setcreatedcallback.php               30-Sep-2022 11:08                4650
gearmanclient.setdata.php                          30-Sep-2022 11:08                3241
gearmanclient.setdatacallback.php                  30-Sep-2022 11:08                4701
gearmanclient.setexceptioncallback.php             30-Sep-2022 11:08                4621
gearmanclient.setfailcallback.php                  30-Sep-2022 11:08                4707
gearmanclient.setoptions.php                       30-Sep-2022 11:08                2478
gearmanclient.setstatuscallback.php                30-Sep-2022 11:08                4707
gearmanclient.settimeout.php                       30-Sep-2022 11:08                2520
gearmanclient.setwarningcallback.php               30-Sep-2022 11:08                4710
gearmanclient.setworkloadcallback.php              30-Sep-2022 11:08                4864
gearmanclient.timeout.php                          30-Sep-2022 11:08                2692
gearmanclient.wait.php                             30-Sep-2022 11:08                2635
gearmanjob.complete.php                            30-Sep-2022 11:08                3381
gearmanjob.construct.php                           30-Sep-2022 11:08                2324
gearmanjob.data.php                                30-Sep-2022 11:08                3341
gearmanjob.exception.php                           30-Sep-2022 11:08                3563
gearmanjob.fail.php                                30-Sep-2022 11:08                3574
gearmanjob.functionname.php                        30-Sep-2022 11:08                2618
gearmanjob.handle.php                              30-Sep-2022 11:08                2505
gearmanjob.returncode.php                          30-Sep-2022 11:08                2552
gearmanjob.sendcomplete.php                        30-Sep-2022 11:08                3100
gearmanjob.senddata.php                            30-Sep-2022 11:08                3067
gearmanjob.sendexception.php                       30-Sep-2022 11:08                3295
gearmanjob.sendfail.php                            30-Sep-2022 11:08                3291
gearmanjob.sendstatus.php                          30-Sep-2022 11:08                3758
gearmanjob.sendwarning.php                         30-Sep-2022 11:08                3291
gearmanjob.setreturn.php                           30-Sep-2022 11:08                2413
gearmanjob.status.php                              30-Sep-2022 11:08                4041
gearmanjob.unique.php                              30-Sep-2022 11:08                2757
gearmanjob.warning.php                             30-Sep-2022 11:08                3574
gearmanjob.workload.php                            30-Sep-2022 11:08                2763
gearmanjob.workloadsize.php                        30-Sep-2022 11:08                2568
gearmantask.construct.php                          30-Sep-2022 11:08                2344
gearmantask.create.php                             30-Sep-2022 11:08                2720
gearmantask.data.php                               30-Sep-2022 11:08                2559
gearmantask.datasize.php                           30-Sep-2022 11:08                2584
gearmantask.function.php                           30-Sep-2022 11:08                2576
gearmantask.functionname.php                       30-Sep-2022 11:08                2266
gearmantask.isknown.php                            30-Sep-2022 11:08                2281
gearmantask.isrunning.php                          30-Sep-2022 11:08                2285
gearmantask.jobhandle.php                          30-Sep-2022 11:08                2654
gearmantask.recvdata.php                           30-Sep-2022 11:08                3302
gearmantask.returncode.php                         30-Sep-2022 11:08                2579
gearmantask.senddata.php                           30-Sep-2022 11:08                3229
gearmantask.sendworkload.php                       30-Sep-2022 11:08                3262
gearmantask.taskdenominator.php                    30-Sep-2022 11:08                2777
gearmantask.tasknumerator.php                      30-Sep-2022 11:08                2749
gearmantask.unique.php                             30-Sep-2022 11:08                3007
gearmantask.uuid.php                               30-Sep-2022 11:08                3298
gearmanworker.addfunction.php                      30-Sep-2022 11:08                7811
gearmanworker.addoptions.php                       30-Sep-2022 11:08                3233
gearmanworker.addserver.php                        30-Sep-2022 11:08                4605
gearmanworker.addservers.php                       30-Sep-2022 11:08                4062
gearmanworker.clone.php                            30-Sep-2022 11:08                2280
gearmanworker.construct.php                        30-Sep-2022 11:08                2788
gearmanworker.echo.php                             30-Sep-2022 11:08                2886
gearmanworker.error.php                            30-Sep-2022 11:08                2526
gearmanworker.geterrno.php                         30-Sep-2022 11:08                2564
gearmanworker.options.php                          30-Sep-2022 11:08                2571
gearmanworker.register.php                         30-Sep-2022 11:08                3604
gearmanworker.removeoptions.php                    30-Sep-2022 11:08                3255
gearmanworker.returncode.php                       30-Sep-2022 11:08                2774
gearmanworker.setid.php                            30-Sep-2022 11:08                3862
gearmanworker.setoptions.php                       30-Sep-2022 11:08                3403
gearmanworker.settimeout.php                       30-Sep-2022 11:08                8057
gearmanworker.timeout.php                          30-Sep-2022 11:08                2671
gearmanworker.unregister.php                       30-Sep-2022 11:08                3222
gearmanworker.unregisterall.php                    30-Sep-2022 11:08                2949
gearmanworker.wait.php                             30-Sep-2022 11:08                8442
gearmanworker.work.php                             30-Sep-2022 11:08                5374
gender-gender.connect.php                          30-Sep-2022 11:07                2506
gender-gender.construct.php                        30-Sep-2022 11:07                2455
gender-gender.country.php                          30-Sep-2022 11:07                3613
gender-gender.get.php                              30-Sep-2022 11:07                2712
gender-gender.isnick.php                           30-Sep-2022 11:07                3201
gender-gender.similarnames.php                     30-Sep-2022 11:07                2834
gender.example.admin.php                           30-Sep-2022 11:07                9158
gender.examples.php                                30-Sep-2022 11:07                1313
gender.installation.php                            30-Sep-2022 11:07                2103
gender.setup.php                                   30-Sep-2022 11:07                1365
generator.current.php                              30-Sep-2022 11:07                2147
generator.getreturn.php                            30-Sep-2022 11:07                3998
generator.key.php                                  30-Sep-2022 11:07                3998
generator.next.php                                 30-Sep-2022 11:07                2387
generator.rewind.php                               30-Sep-2022 11:07                2169
generator.send.php                                 30-Sep-2022 11:07                5807
generator.throw.php                                30-Sep-2022 11:07                5421
generator.valid.php                                30-Sep-2022 11:07                2205
generator.wakeup.php                               30-Sep-2022 11:07                2193
geoip.configuration.php                            30-Sep-2022 11:07                2425
geoip.constants.php                                30-Sep-2022 11:07                4531
geoip.installation.php                             30-Sep-2022 11:07                1818
geoip.requirements.php                             30-Sep-2022 11:07                1928
geoip.resources.php                                30-Sep-2022 11:07                1151
geoip.setup.php                                    30-Sep-2022 11:07                1514
gettext.configuration.php                          30-Sep-2022 11:07                1190
gettext.constants.php                              30-Sep-2022 11:07                1118
gettext.installation.php                           30-Sep-2022 11:07                1468
gettext.requirements.php                           30-Sep-2022 11:07                1421
gettext.resources.php                              30-Sep-2022 11:07                1165
gettext.setup.php                                  30-Sep-2022 11:07                1558
getting-started.php                                30-Sep-2022 11:07                1950
globiterator.construct.php                         30-Sep-2022 11:07                8085
globiterator.count.php                             30-Sep-2022 11:07                4479
gmagick.addimage.php                               30-Sep-2022 11:07                2983
gmagick.addnoiseimage.php                          30-Sep-2022 11:07                2936
gmagick.annotateimage.php                          30-Sep-2022 11:07                4359
gmagick.blurimage.php                              30-Sep-2022 11:07                3225
gmagick.borderimage.php                            30-Sep-2022 11:07                3712
gmagick.charcoalimage.php                          30-Sep-2022 11:07                3192
gmagick.chopimage.php                              30-Sep-2022 11:07                3730
gmagick.clear.php                                  30-Sep-2022 11:07                2728
gmagick.commentimage.php                           30-Sep-2022 11:07                2848
gmagick.compositeimage.php                         30-Sep-2022 11:07                3965
gmagick.configuration.php                          30-Sep-2022 11:07                1193
gmagick.constants.php                              30-Sep-2022 11:07               68518
gmagick.construct.php                              30-Sep-2022 11:07                2605
gmagick.cropimage.php                              30-Sep-2022 11:07                3802
gmagick.cropthumbnailimage.php                     30-Sep-2022 11:07                3281
gmagick.current.php                                30-Sep-2022 11:07                2605
gmagick.cyclecolormapimage.php                     30-Sep-2022 11:07                2985
gmagick.deconstructimages.php                      30-Sep-2022 11:07                2756
gmagick.despeckleimage.php                         30-Sep-2022 11:07                3548
gmagick.destroy.php                                30-Sep-2022 11:07                2646
gmagick.drawimage.php                              30-Sep-2022 11:07                3062
gmagick.edgeimage.php                              30-Sep-2022 11:07                2917
gmagick.embossimage.php                            30-Sep-2022 11:07                3455
gmagick.enhanceimage.php                           30-Sep-2022 11:07                2694
gmagick.equalizeimage.php                          30-Sep-2022 11:07                2635
gmagick.examples.php                               30-Sep-2022 11:07                3595
gmagick.flipimage.php                              30-Sep-2022 11:07                3014
gmagick.flopimage.php                              30-Sep-2022 11:07                3008
gmagick.frameimage.php                             30-Sep-2022 11:07                4414
gmagick.gammaimage.php                             30-Sep-2022 11:07                3259
gmagick.getcopyright.php                           30-Sep-2022 11:07                2560
gmagick.getfilename.php                            30-Sep-2022 11:07                2560
gmagick.getimagebackgroundcolor.php                30-Sep-2022 11:07                2676
gmagick.getimageblueprimary.php                    30-Sep-2022 11:07                2895
gmagick.getimagebordercolor.php                    30-Sep-2022 11:07                2748
gmagick.getimagechanneldepth.php                   30-Sep-2022 11:07                2700
gmagick.getimagecolors.php                         30-Sep-2022 11:07                2555
gmagick.getimagecolorspace.php                     30-Sep-2022 11:07                2519
gmagick.getimagecompose.php                        30-Sep-2022 11:07                2561
gmagick.getimagedelay.php                          30-Sep-2022 11:07                2460
gmagick.getimagedepth.php                          30-Sep-2022 11:07                2461
gmagick.getimagedispose.php                        30-Sep-2022 11:07                2500
gmagick.getimageextrema.php                        30-Sep-2022 11:07                2658
gmagick.getimagefilename.php                       30-Sep-2022 11:07                2593
gmagick.getimageformat.php                         30-Sep-2022 11:07                2601
gmagick.getimagegamma.php                          30-Sep-2022 11:07                2494
gmagick.getimagegreenprimary.php                   30-Sep-2022 11:07                2705
gmagick.getimageheight.php                         30-Sep-2022 11:07                2503
gmagick.getimagehistogram.php                      30-Sep-2022 11:07                2947
gmagick.getimageindex.php                          30-Sep-2022 11:07                2710
gmagick.getimageinterlacescheme.php                30-Sep-2022 11:07                2665
gmagick.getimageiterations.php                     30-Sep-2022 11:07                2549
gmagick.getimagematte.php                          30-Sep-2022 11:07                2810
gmagick.getimagemattecolor.php                     30-Sep-2022 11:07                2717
gmagick.getimageprofile.php                        30-Sep-2022 11:07                2686
gmagick.getimageredprimary.php                     30-Sep-2022 11:07                2709
gmagick.getimagerenderingintent.php                30-Sep-2022 11:07                2642
gmagick.getimageresolution.php                     30-Sep-2022 11:07                2571
gmagick.getimagescene.php                          30-Sep-2022 11:07                2488
gmagick.getimagesignature.php                      30-Sep-2022 11:07                2629
gmagick.getimagetype.php                           30-Sep-2022 11:07                2449
gmagick.getimageunits.php                          30-Sep-2022 11:07                2225
gmagick.getimagewhitepoint.php                     30-Sep-2022 11:07                2705
gmagick.getimagewidth.php                          30-Sep-2022 11:07                2454
gmagick.getpackagename.php                         30-Sep-2022 11:07                2536
gmagick.getquantumdepth.php                        30-Sep-2022 11:07                2682
gmagick.getreleasedate.php                         30-Sep-2022 11:07                2552
gmagick.getsamplingfactors.php                     30-Sep-2022 11:07                2673
gmagick.getsize.php                                30-Sep-2022 11:07                2833
gmagick.getversion.php                             30-Sep-2022 11:07                2515
gmagick.hasnextimage.php                           30-Sep-2022 11:07                2907
gmagick.haspreviousimage.php                       30-Sep-2022 11:07                2959
gmagick.implodeimage.php                           30-Sep-2022 11:07                3031
gmagick.installation.php                           30-Sep-2022 11:07                2075
gmagick.labelimage.php                             30-Sep-2022 11:07                2784
gmagick.levelimage.php                             30-Sep-2022 11:07                4666
gmagick.magnifyimage.php                           30-Sep-2022 11:07                2663
gmagick.mapimage.php                               30-Sep-2022 11:07                3243
gmagick.medianfilterimage.php                      30-Sep-2022 11:07                3054
gmagick.minifyimage.php                            30-Sep-2022 11:07                2639
gmagick.modulateimage.php                          30-Sep-2022 11:07                3731
gmagick.motionblurimage.php                        30-Sep-2022 11:07                3993
gmagick.newimage.php                               30-Sep-2022 11:07                3756
gmagick.nextimage.php                              30-Sep-2022 11:07                2639
gmagick.normalizeimage.php                         30-Sep-2022 11:07                3007
gmagick.oilpaintimage.php                          30-Sep-2022 11:07                3003
gmagick.previousimage.php                          30-Sep-2022 11:07                2638
gmagick.profileimage.php                           30-Sep-2022 11:07                3567
gmagick.quantizeimage.php                          30-Sep-2022 11:07                5265
gmagick.quantizeimages.php                         30-Sep-2022 11:07                5300
gmagick.queryfontmetrics.php                       30-Sep-2022 11:07                2881
gmagick.queryfonts.php                             30-Sep-2022 11:07                2631
gmagick.queryformats.php                           30-Sep-2022 11:07                2992
gmagick.radialblurimage.php                        30-Sep-2022 11:07                3188
gmagick.raiseimage.php                             30-Sep-2022 11:07                4270
gmagick.read.php                                   30-Sep-2022 11:07                2741
gmagick.readimage.php                              30-Sep-2022 11:07                2791
gmagick.readimageblob.php                          30-Sep-2022 11:07                3167
gmagick.readimagefile.php                          30-Sep-2022 11:07                3078
gmagick.reducenoiseimage.php                       30-Sep-2022 11:07                3232
gmagick.removeimage.php                            30-Sep-2022 11:07                2622
gmagick.removeimageprofile.php                     30-Sep-2022 11:07                2880
gmagick.requirements.php                           30-Sep-2022 11:07                1772
gmagick.resampleimage.php                          30-Sep-2022 11:07                3851
gmagick.resizeimage.php                            30-Sep-2022 11:07                3979
gmagick.rollimage.php                              30-Sep-2022 11:07                2959
gmagick.rotateimage.php                            30-Sep-2022 11:07                3183
gmagick.scaleimage.php                             30-Sep-2022 11:07                3365
gmagick.separateimagechannel.php                   30-Sep-2022 11:07                3230
gmagick.setcompressionquality.php                  30-Sep-2022 11:07                4234
gmagick.setfilename.php                            30-Sep-2022 11:07                2911
gmagick.setimagebackgroundcolor.php                30-Sep-2022 11:07                3016
gmagick.setimageblueprimary.php                    30-Sep-2022 11:07                3201
gmagick.setimagebordercolor.php                    30-Sep-2022 11:07                2997
gmagick.setimagechanneldepth.php                   30-Sep-2022 11:07                3388
gmagick.setimagecolorspace.php                     30-Sep-2022 11:07                3071
gmagick.setimagecompose.php                        30-Sep-2022 11:07                2831
gmagick.setimagedelay.php                          30-Sep-2022 11:07                2858
gmagick.setimagedepth.php                          30-Sep-2022 11:07                2858
gmagick.setimagedispose.php                        30-Sep-2022 11:07                2876
gmagick.setimagefilename.php                       30-Sep-2022 11:07                2949
gmagick.setimageformat.php                         30-Sep-2022 11:07                2923
gmagick.setimagegamma.php                          30-Sep-2022 11:07                2845
gmagick.setimagegreenprimary.php                   30-Sep-2022 11:07                3179
gmagick.setimageindex.php                          30-Sep-2022 11:07                3014
gmagick.setimageinterlacescheme.php                30-Sep-2022 11:07                3161
gmagick.setimageiterations.php                     30-Sep-2022 11:07                2943
gmagick.setimageprofile.php                        30-Sep-2022 11:07                3494
gmagick.setimageredprimary.php                     30-Sep-2022 11:07                3127
gmagick.setimagerenderingintent.php                30-Sep-2022 11:07                3198
gmagick.setimageresolution.php                     30-Sep-2022 11:07                3131
gmagick.setimagescene.php                          30-Sep-2022 11:07                2840
gmagick.setimagetype.php                           30-Sep-2022 11:07                2973
gmagick.setimageunits.php                          30-Sep-2022 11:07                3155
gmagick.setimagewhitepoint.php                     30-Sep-2022 11:07                3154
gmagick.setsamplingfactors.php                     30-Sep-2022 11:07                2996
gmagick.setsize.php                                30-Sep-2022 11:07                3355
gmagick.setup.php                                  30-Sep-2022 11:07                1479
gmagick.shearimage.php                             30-Sep-2022 11:07                3951
gmagick.solarizeimage.php                          30-Sep-2022 11:07                3095
gmagick.spreadimage.php                            30-Sep-2022 11:07                2964
gmagick.stripimage.php                             30-Sep-2022 11:07                2639
gmagick.swirlimage.php                             30-Sep-2022 11:07                3017
gmagick.thumbnailimage.php                         30-Sep-2022 11:07                3712
gmagick.trimimage.php                              30-Sep-2022 11:07                3153
gmagick.write.php                                  30-Sep-2022 11:07                1732
gmagick.writeimage.php                             30-Sep-2022 11:07                3357
gmagickdraw.annotate.php                           30-Sep-2022 11:07                3104
gmagickdraw.arc.php                                30-Sep-2022 11:07                3971
gmagickdraw.bezier.php                             30-Sep-2022 11:07                2579
gmagickdraw.ellipse.php                            30-Sep-2022 11:07                3941
gmagickdraw.getfillcolor.php                       30-Sep-2022 11:07                2475
gmagickdraw.getfillopacity.php                     30-Sep-2022 11:07                2359
gmagickdraw.getfont.php                            30-Sep-2022 11:07                2449
gmagickdraw.getfontsize.php                        30-Sep-2022 11:07                2443
gmagickdraw.getfontstyle.php                       30-Sep-2022 11:07                2560
gmagickdraw.getfontweight.php                      30-Sep-2022 11:07                2392
gmagickdraw.getstrokecolor.php                     30-Sep-2022 11:07                2504
gmagickdraw.getstrokeopacity.php                   30-Sep-2022 11:07                2356
gmagickdraw.getstrokewidth.php                     30-Sep-2022 11:07                2363
gmagickdraw.gettextdecoration.php                  30-Sep-2022 11:07                2455
gmagickdraw.gettextencoding.php                    30-Sep-2022 11:07                2600
gmagickdraw.line.php                               30-Sep-2022 11:07                3444
gmagickdraw.point.php                              30-Sep-2022 11:07                2787
gmagickdraw.polygon.php                            30-Sep-2022 11:07                2670
gmagickdraw.polyline.php                           30-Sep-2022 11:07                2707
gmagickdraw.rectangle.php                          30-Sep-2022 11:07                3500
gmagickdraw.rotate.php                             30-Sep-2022 11:07                2618
gmagickdraw.roundrectangle.php                     30-Sep-2022 11:07                4182
gmagickdraw.scale.php                              30-Sep-2022 11:07                2844
gmagickdraw.setfillcolor.php                       30-Sep-2022 11:07                2955
gmagickdraw.setfillopacity.php                     30-Sep-2022 11:07                2797
gmagickdraw.setfont.php                            30-Sep-2022 11:07                2689
gmagickdraw.setfontsize.php                        30-Sep-2022 11:07                2741
gmagickdraw.setfontstyle.php                       30-Sep-2022 11:07                2888
gmagickdraw.setfontweight.php                      30-Sep-2022 11:07                2738
gmagickdraw.setstrokecolor.php                     30-Sep-2022 11:07                2980
gmagickdraw.setstrokeopacity.php                   30-Sep-2022 11:07                2778
gmagickdraw.setstrokewidth.php                     30-Sep-2022 11:07                2728
gmagickdraw.settextdecoration.php                  30-Sep-2022 11:07                2872
gmagickdraw.settextencoding.php                    30-Sep-2022 11:07                3182
gmagickpixel.construct.php                         30-Sep-2022 11:07                2541
gmagickpixel.getcolor.php                          30-Sep-2022 11:07                3608
gmagickpixel.getcolorcount.php                     30-Sep-2022 11:07                2461
gmagickpixel.getcolorvalue.php                     30-Sep-2022 11:07                2824
gmagickpixel.setcolor.php                          30-Sep-2022 11:07                2961
gmagickpixel.setcolorvalue.php                     30-Sep-2022 11:07                3251
gmp.configuration.php                              30-Sep-2022 11:07                1165
gmp.constants.php                                  30-Sep-2022 11:07                3169
gmp.examples.php                                   30-Sep-2022 11:07                3236
gmp.installation.php                               30-Sep-2022 11:07                1397
gmp.requirements.php                               30-Sep-2022 11:07                1840
gmp.serialize.php                                  30-Sep-2022 11:07                2231
gmp.setup.php                                      30-Sep-2022 11:07                1442
gmp.unserialize.php                                30-Sep-2022 11:07                2512
gnupg.configuration.php                            30-Sep-2022 11:07                1174
gnupg.constants.php                                30-Sep-2022 11:07                6338
gnupg.examples-clearsign.php                       30-Sep-2022 11:07                6876
gnupg.examples.php                                 30-Sep-2022 11:07                1334
gnupg.installation.php                             30-Sep-2022 11:07                1634
gnupg.requirements.php                             30-Sep-2022 11:07                1260
gnupg.resources.php                                30-Sep-2022 11:07                1151
gnupg.setup.php                                    30-Sep-2022 11:07                1533
hash.configuration.php                             30-Sep-2022 11:07                1169
hash.constants.php                                 30-Sep-2022 11:07                1770
hash.installation.php                              30-Sep-2022 11:07                1777
hash.requirements.php                              30-Sep-2022 11:07                1187
hash.resources.php                                 30-Sep-2022 11:07                1341
hash.setup.php                                     30-Sep-2022 11:07                1512
hashcontext.construct.php                          30-Sep-2022 11:07                1934
hashcontext.serialize.php                          30-Sep-2022 11:07                2377
hashcontext.unserialize.php                        30-Sep-2022 11:07                2622
history.php                                        30-Sep-2022 11:08                2360
history.php.books.php                              30-Sep-2022 11:08                3094
history.php.php                                    30-Sep-2022 11:08               13304
history.php.publications.php                       30-Sep-2022 11:08                1898
history.php.related.php                            30-Sep-2022 11:08                7385
hrtime-performancecounter.getfrequency.php         30-Sep-2022 11:07                2607
hrtime-performancecounter.getticks.php             30-Sep-2022 11:07                2480
hrtime-performancecounter.gettickssince.php        30-Sep-2022 11:07                2716
hrtime-stopwatch.getelapsedticks.php               30-Sep-2022 11:07                2382
hrtime-stopwatch.getelapsedtime.php                30-Sep-2022 11:07                2711
hrtime-stopwatch.getlastelapsedticks.php           30-Sep-2022 11:07                2450
hrtime-stopwatch.getlastelapsedtime.php            30-Sep-2022 11:07                2735
hrtime-stopwatch.isrunning.php                     30-Sep-2022 11:07                2341
hrtime-stopwatch.start.php                         30-Sep-2022 11:07                2335
hrtime-stopwatch.stop.php                          30-Sep-2022 11:07                2214
hrtime.example.basic.php                           30-Sep-2022 11:07                5941
hrtime.examples.php                                30-Sep-2022 11:07                1317
hrtime.installation.php                            30-Sep-2022 11:07                2080
hrtime.setup.php                                   30-Sep-2022 11:07                1362
ibase.configuration.php                            30-Sep-2022 11:07                7385
ibase.constants.php                                30-Sep-2022 11:07               19233
ibase.installation.php                             30-Sep-2022 11:07                4010
ibase.requirements.php                             30-Sep-2022 11:07                1150
ibase.resources.php                                30-Sep-2022 11:07                1151
ibase.setup.php                                    30-Sep-2022 11:07                1553
ibm-db2.configuration.php                          30-Sep-2022 11:07               10603
ibm-db2.constants.php                              30-Sep-2022 11:07                7131
ibm-db2.installation.php                           30-Sep-2022 11:07                4212
ibm-db2.requirements.php                           30-Sep-2022 11:07                3622
ibm-db2.resources.php                              30-Sep-2022 11:07                1271
ibm-db2.setup.php                                  30-Sep-2022 11:07                1563
iconv.configuration.php                            30-Sep-2022 11:07                4866
iconv.constants.php                                30-Sep-2022 11:07                3192
iconv.installation.php                             30-Sep-2022 11:07                1666
iconv.requirements.php                             30-Sep-2022 11:07                1576
iconv.resources.php                                30-Sep-2022 11:07                1151
iconv.setup.php                                    30-Sep-2022 11:07                1540
igbinary.configuration.php                         30-Sep-2022 11:07                3411
igbinary.installation.php                          30-Sep-2022 11:07                2115
igbinary.requirements.php                          30-Sep-2022 11:07                1171
igbinary.setup.php                                 30-Sep-2022 11:07                1488
image.configuration.php                            30-Sep-2022 11:07                3401
image.constants.php                                30-Sep-2022 11:07               41681
image.examples-png.php                             30-Sep-2022 11:07                5020
image.examples-watermark.php                       30-Sep-2022 11:07                6217
image.examples.merged-watermark.php                30-Sep-2022 11:07                9065
image.examples.php                                 30-Sep-2022 11:07                1566
image.installation.php                             30-Sep-2022 11:07                6586
image.requirements.php                             30-Sep-2022 11:07                4248
image.resources.php                                30-Sep-2022 11:07                2079
image.setup.php                                    30-Sep-2022 11:07                1538
imagick.adaptiveblurimage.php                      30-Sep-2022 11:07                6960
imagick.adaptiveresizeimage.php                    30-Sep-2022 11:07                9390
imagick.adaptivesharpenimage.php                   30-Sep-2022 11:07                6487
imagick.adaptivethresholdimage.php                 30-Sep-2022 11:07                6120
imagick.addimage.php                               30-Sep-2022 11:07                2930
imagick.addnoiseimage.php                          30-Sep-2022 11:07                5516
imagick.affinetransformimage.php                   30-Sep-2022 11:07                6988
imagick.animateimages.php                          30-Sep-2022 11:07                3097
imagick.annotateimage.php                          30-Sep-2022 11:07                8832
imagick.appendimages.php                           30-Sep-2022 11:07                6827
imagick.autolevelimage.php                         30-Sep-2022 11:07                4359
imagick.averageimages.php                          30-Sep-2022 11:07                2814
imagick.blackthresholdimage.php                    30-Sep-2022 11:07                5446
imagick.blueshiftimage.php                         30-Sep-2022 11:07                4428
imagick.blurimage.php                              30-Sep-2022 11:07                5806
imagick.borderimage.php                            30-Sep-2022 11:07                6131
imagick.brightnesscontrastimage.php                30-Sep-2022 11:07                5480
imagick.charcoalimage.php                          30-Sep-2022 11:07                4919
imagick.chopimage.php                              30-Sep-2022 11:07                6902
imagick.clampimage.php                             30-Sep-2022 11:07                2452
imagick.clear.php                                  30-Sep-2022 11:07                2251
imagick.clipimage.php                              30-Sep-2022 11:07                2482
imagick.clipimagepath.php                          30-Sep-2022 11:07                2964
imagick.clippathimage.php                          30-Sep-2022 11:07                3456
imagick.clone.php                                  30-Sep-2022 11:07                4284
imagick.clutimage.php                              30-Sep-2022 11:07                6232
imagick.coalesceimages.php                         30-Sep-2022 11:07                2996
imagick.colorfloodfillimage.php                    30-Sep-2022 11:07                5377
imagick.colorizeimage.php                          30-Sep-2022 11:07                7148
imagick.colormatriximage.php                       30-Sep-2022 11:07                8387
imagick.combineimages.php                          30-Sep-2022 11:07                3368
imagick.commentimage.php                           30-Sep-2022 11:07                5033
imagick.compareimagechannels.php                   30-Sep-2022 11:07                3884
imagick.compareimagelayers.php                     30-Sep-2022 11:07                5619
imagick.compareimages.php                          30-Sep-2022 11:07                5629
imagick.compositeimage.php                         30-Sep-2022 11:07                7982
imagick.configuration.php                          30-Sep-2022 11:07                4254
imagick.constants.php                              30-Sep-2022 11:07              116391
imagick.construct.php                              30-Sep-2022 11:07                2762
imagick.contrastimage.php                          30-Sep-2022 11:07                5110
imagick.contraststretchimage.php                   30-Sep-2022 11:07                3747
imagick.convolveimage.php                          30-Sep-2022 11:07                6026
imagick.count.php                                  30-Sep-2022 11:07                2566
imagick.cropimage.php                              30-Sep-2022 11:07                5940
imagick.cropthumbnailimage.php                     30-Sep-2022 11:07                3270
imagick.current.php                                30-Sep-2022 11:07                2543
imagick.cyclecolormapimage.php                     30-Sep-2022 11:07                2877
imagick.decipherimage.php                          30-Sep-2022 11:07                3157
imagick.deconstructimages.php                      30-Sep-2022 11:07                2633
imagick.deleteimageartifact.php                    30-Sep-2022 11:07                3722
imagick.deleteimageproperty.php                    30-Sep-2022 11:07                2453
imagick.deskewimage.php                            30-Sep-2022 11:07               11698
imagick.despeckleimage.php                         30-Sep-2022 11:07                4313
imagick.destroy.php                                30-Sep-2022 11:07                2371
imagick.displayimage.php                           30-Sep-2022 11:07                2671
imagick.displayimages.php                          30-Sep-2022 11:07                2732
imagick.distortimage.php                           30-Sep-2022 11:07               13023
imagick.drawimage.php                              30-Sep-2022 11:07                2578
imagick.edgeimage.php                              30-Sep-2022 11:07                4661
imagick.embossimage.php                            30-Sep-2022 11:07                5375
imagick.encipherimage.php                          30-Sep-2022 11:07                3147
imagick.enhanceimage.php                           30-Sep-2022 11:07                4287
imagick.equalizeimage.php                          30-Sep-2022 11:07                4246
imagick.evaluateimage.php                          30-Sep-2022 11:07                5884
imagick.examples-1.php                             30-Sep-2022 11:07               32925
imagick.examples.php                               30-Sep-2022 11:07                1336
imagick.exportimagepixels.php                      30-Sep-2022 11:07                7953
imagick.extentimage.php                            30-Sep-2022 11:07                5289
imagick.filter.php                                 30-Sep-2022 11:07                7924
imagick.flattenimages.php                          30-Sep-2022 11:07                2925
imagick.flipimage.php                              30-Sep-2022 11:07                4617
imagick.floodfillpaintimage.php                    30-Sep-2022 11:07               11733
imagick.flopimage.php                              30-Sep-2022 11:07                4647
imagick.forwardfouriertransformimage.php           30-Sep-2022 11:07               12981
imagick.frameimage.php                             30-Sep-2022 11:07                8598
imagick.functionimage.php                          30-Sep-2022 11:07               13794
imagick.fximage.php                                30-Sep-2022 11:07                6165
imagick.gammaimage.php                             30-Sep-2022 11:07                5825
imagick.gaussianblurimage.php                      30-Sep-2022 11:07                6312
imagick.getcolorspace.php                          30-Sep-2022 11:07                2460
imagick.getcompression.php                         30-Sep-2022 11:07                2238
imagick.getcompressionquality.php                  30-Sep-2022 11:07                2306
imagick.getcopyright.php                           30-Sep-2022 11:07                2329
imagick.getfilename.php                            30-Sep-2022 11:07                2461
imagick.getfont.php                                30-Sep-2022 11:07                3168
imagick.getformat.php                              30-Sep-2022 11:07                2404
imagick.getgravity.php                             30-Sep-2022 11:07                2449
imagick.gethomeurl.php                             30-Sep-2022 11:07                2224
imagick.getimage.php                               30-Sep-2022 11:07                2543
imagick.getimagealphachannel.php                   30-Sep-2022 11:07                3480
imagick.getimageartifact.php                       30-Sep-2022 11:07                3676
imagick.getimageattribute.php                      30-Sep-2022 11:07                2719
imagick.getimagebackgroundcolor.php                30-Sep-2022 11:07                2610
imagick.getimageblob.php                           30-Sep-2022 11:07                2736
imagick.getimageblueprimary.php                    30-Sep-2022 11:07                2805
imagick.getimagebordercolor.php                    30-Sep-2022 11:07                2596
imagick.getimagechanneldepth.php                   30-Sep-2022 11:07                3024
imagick.getimagechanneldistortion.php              30-Sep-2022 11:07                3975
imagick.getimagechanneldistortions.php             30-Sep-2022 11:07                4316
imagick.getimagechannelextrema.php                 30-Sep-2022 11:07                3659
imagick.getimagechannelkurtosis.php                30-Sep-2022 11:07                3512
imagick.getimagechannelmean.php                    30-Sep-2022 11:07                3188
imagick.getimagechannelrange.php                   30-Sep-2022 11:07                3407
imagick.getimagechannelstatistics.php              30-Sep-2022 11:07                2535
imagick.getimageclipmask.php                       30-Sep-2022 11:07                3110
imagick.getimagecolormapcolor.php                  30-Sep-2022 11:07                2931
imagick.getimagecolors.php                         30-Sep-2022 11:07                2326
imagick.getimagecolorspace.php                     30-Sep-2022 11:07                2341
imagick.getimagecompose.php                        30-Sep-2022 11:07                2298
imagick.getimagecompression.php                    30-Sep-2022 11:07                2307
imagick.getimagecompressionquality.php             30-Sep-2022 11:07                2383
imagick.getimagedelay.php                          30-Sep-2022 11:07                2415
imagick.getimagedepth.php                          30-Sep-2022 11:07                2178
imagick.getimagedispose.php                        30-Sep-2022 11:07                2451
imagick.getimagedistortion.php                     30-Sep-2022 11:07                3233
imagick.getimageextrema.php                        30-Sep-2022 11:07                2921
imagick.getimagefilename.php                       30-Sep-2022 11:07                2521
imagick.getimageformat.php                         30-Sep-2022 11:07                2529
imagick.getimagegamma.php                          30-Sep-2022 11:07                2420
imagick.getimagegeometry.php                       30-Sep-2022 11:07                4100
imagick.getimagegravity.php                        30-Sep-2022 11:07                2760
imagick.getimagegreenprimary.php                   30-Sep-2022 11:07                2709
imagick.getimageheight.php                         30-Sep-2022 11:07                2431
imagick.getimagehistogram.php                      30-Sep-2022 11:07               19795
imagick.getimageindex.php                          30-Sep-2022 11:07                3088
imagick.getimageinterlacescheme.php                30-Sep-2022 11:07                2513
imagick.getimageinterpolatemethod.php              30-Sep-2022 11:07                2698
imagick.getimageiterations.php                     30-Sep-2022 11:07                2492
imagick.getimagelength.php                         30-Sep-2022 11:07                3410
imagick.getimagematte.php                          30-Sep-2022 11:07                2842
imagick.getimagemattecolor.php                     30-Sep-2022 11:07                2895
imagick.getimagemimetype.php                       30-Sep-2022 11:07                2183
imagick.getimageorientation.php                    30-Sep-2022 11:07                2619
imagick.getimagepage.php                           30-Sep-2022 11:07                2683
imagick.getimagepixelcolor.php                     30-Sep-2022 11:07                3053
imagick.getimageprofile.php                        30-Sep-2022 11:07                2749
imagick.getimageprofiles.php                       30-Sep-2022 11:07                3394
imagick.getimageproperties.php                     30-Sep-2022 11:07                5781
imagick.getimageproperty.php                       30-Sep-2022 11:07                5035
imagick.getimageredprimary.php                     30-Sep-2022 11:07                2753
imagick.getimageregion.php                         30-Sep-2022 11:07                3706
imagick.getimagerenderingintent.php                30-Sep-2022 11:07                2654
imagick.getimageresolution.php                     30-Sep-2022 11:07                2523
imagick.getimagesblob.php                          30-Sep-2022 11:07                2593
imagick.getimagescene.php                          30-Sep-2022 11:07                2406
imagick.getimagesignature.php                      30-Sep-2022 11:07                2562
imagick.getimagesize.php                           30-Sep-2022 11:07                2703
imagick.getimagetickspersecond.php                 30-Sep-2022 11:07                2546
imagick.getimagetotalinkdensity.php                30-Sep-2022 11:07                2455
imagick.getimagetype.php                           30-Sep-2022 11:07                3997
imagick.getimageunits.php                          30-Sep-2022 11:07                2453
imagick.getimagevirtualpixelmethod.php             30-Sep-2022 11:07                2626
imagick.getimagewhitepoint.php                     30-Sep-2022 11:07                2664
imagick.getimagewidth.php                          30-Sep-2022 11:07                2391
imagick.getinterlacescheme.php                     30-Sep-2022 11:07                2609
imagick.getiteratorindex.php                       30-Sep-2022 11:07                6328
imagick.getnumberimages.php                        30-Sep-2022 11:07                2531
imagick.getoption.php                              30-Sep-2022 11:07                2652
imagick.getpackagename.php                         30-Sep-2022 11:07                2472
imagick.getpage.php                                30-Sep-2022 11:07                2586
imagick.getpixeliterator.php                       30-Sep-2022 11:07                6847
imagick.getpixelregioniterator.php                 30-Sep-2022 11:07                6775
imagick.getpointsize.php                           30-Sep-2022 11:07                2805
imagick.getquantum.php                             30-Sep-2022 11:07                2150
imagick.getquantumdepth.php                        30-Sep-2022 11:07                2591
imagick.getquantumrange.php                        30-Sep-2022 11:07                2724
imagick.getregistry.php                            30-Sep-2022 11:07                2356
imagick.getreleasedate.php                         30-Sep-2022 11:07                2496
imagick.getresource.php                            30-Sep-2022 11:07                2884
imagick.getresourcelimit.php                       30-Sep-2022 11:07                3306
imagick.getsamplingfactors.php                     30-Sep-2022 11:07                2609
imagick.getsize.php                                30-Sep-2022 11:07                5835
imagick.getsizeoffset.php                          30-Sep-2022 11:07                2595
imagick.getversion.php                             30-Sep-2022 11:07                2485
imagick.haldclutimage.php                          30-Sep-2022 11:07                6169
imagick.hasnextimage.php                           30-Sep-2022 11:07                2538
imagick.haspreviousimage.php                       30-Sep-2022 11:07                2584
imagick.identifyformat.php                         30-Sep-2022 11:07                4482
imagick.identifyimage.php                          30-Sep-2022 11:07                3852
imagick.implodeimage.php                           30-Sep-2022 11:07                4682
imagick.importimagepixels.php                      30-Sep-2022 11:07               11991
imagick.installation.php                           30-Sep-2022 11:07                3260
imagick.inversefouriertransformimage.php           30-Sep-2022 11:07                3317
imagick.labelimage.php                             30-Sep-2022 11:07                2442
imagick.levelimage.php                             30-Sep-2022 11:07                7795
imagick.linearstretchimage.php                     30-Sep-2022 11:07                5655
imagick.liquidrescaleimage.php                     30-Sep-2022 11:07                4374
imagick.listregistry.php                           30-Sep-2022 11:07                2269
imagick.magnifyimage.php                           30-Sep-2022 11:07                4223
imagick.mapimage.php                               30-Sep-2022 11:07                3137
imagick.mattefloodfillimage.php                    30-Sep-2022 11:07                5598
imagick.medianfilterimage.php                      30-Sep-2022 11:07                5199
imagick.mergeimagelayers.php                       30-Sep-2022 11:07                6783
imagick.minifyimage.php                            30-Sep-2022 11:07                2255
imagick.modulateimage.php                          30-Sep-2022 11:07                5513
imagick.montageimage.php                           30-Sep-2022 11:07                4463
imagick.morphimages.php                            30-Sep-2022 11:07                2809
imagick.morphology.php                             30-Sep-2022 11:07               75633
imagick.mosaicimages.php                           30-Sep-2022 11:07                2771
imagick.motionblurimage.php                        30-Sep-2022 11:07                6897
imagick.negateimage.php                            30-Sep-2022 11:07                5561
imagick.newimage.php                               30-Sep-2022 11:07                6319
imagick.newpseudoimage.php                         30-Sep-2022 11:07                5767
imagick.nextimage.php                              30-Sep-2022 11:07                2233
imagick.normalizeimage.php                         30-Sep-2022 11:07                6545
imagick.oilpaintimage.php                          30-Sep-2022 11:07                4552
imagick.opaquepaintimage.php                       30-Sep-2022 11:07                4882
imagick.optimizeimagelayers.php                    30-Sep-2022 11:07                5477
imagick.orderedposterizeimage.php                  30-Sep-2022 11:07                6970
imagick.paintfloodfillimage.php                    30-Sep-2022 11:07                5548
imagick.paintopaqueimage.php                       30-Sep-2022 11:07                5542
imagick.painttransparentimage.php                  30-Sep-2022 11:07                4651
imagick.pingimage.php                              30-Sep-2022 11:07                2575
imagick.pingimageblob.php                          30-Sep-2022 11:07                6221
imagick.pingimagefile.php                          30-Sep-2022 11:07                5999
imagick.polaroidimage.php                          30-Sep-2022 11:07                4776
imagick.posterizeimage.php                         30-Sep-2022 11:07                5557
imagick.previewimages.php                          30-Sep-2022 11:07                3046
imagick.previousimage.php                          30-Sep-2022 11:07                2291
imagick.profileimage.php                           30-Sep-2022 11:07                3185
imagick.quantizeimage.php                          30-Sep-2022 11:07                6488
imagick.quantizeimages.php                         30-Sep-2022 11:07                3654
imagick.queryfontmetrics.php                       30-Sep-2022 11:07                5695
imagick.queryfonts.php                             30-Sep-2022 11:07                5014
imagick.queryformats.php                           30-Sep-2022 11:07                8289
imagick.radialblurimage.php                        30-Sep-2022 11:07                5605
imagick.raiseimage.php                             30-Sep-2022 11:07                6404
imagick.randomthresholdimage.php                   30-Sep-2022 11:07                6547
imagick.readimage.php                              30-Sep-2022 11:07                2412
imagick.readimageblob.php                          30-Sep-2022 11:07                5477
imagick.readimagefile.php                          30-Sep-2022 11:07                3026
imagick.readimages.php                             30-Sep-2022 11:07                2397
imagick.recolorimage.php                           30-Sep-2022 11:07                6739
imagick.reducenoiseimage.php                       30-Sep-2022 11:07                5271
imagick.remapimage.php                             30-Sep-2022 11:07                3382
imagick.removeimage.php                            30-Sep-2022 11:07                2442
imagick.removeimageprofile.php                     30-Sep-2022 11:07                2729
imagick.render.php                                 30-Sep-2022 11:07                2245
imagick.requirements.php                           30-Sep-2022 11:07                1633
imagick.resampleimage.php                          30-Sep-2022 11:07                5475
imagick.resetimagepage.php                         30-Sep-2022 11:07                2717
imagick.resizeimage.php                            30-Sep-2022 11:07               12188
imagick.resources.php                              30-Sep-2022 11:07                1165
imagick.rollimage.php                              30-Sep-2022 11:07                4738
imagick.rotateimage.php                            30-Sep-2022 11:07                5699
imagick.rotationalblurimage.php                    30-Sep-2022 11:07                5639
imagick.roundcorners.php                           30-Sep-2022 11:07                6550
imagick.sampleimage.php                            30-Sep-2022 11:07                2867
imagick.scaleimage.php                             30-Sep-2022 11:07                6966
imagick.segmentimage.php                           30-Sep-2022 11:07                6642
imagick.selectiveblurimage.php                     30-Sep-2022 11:07                6361
imagick.separateimagechannel.php                   30-Sep-2022 11:07                5431
imagick.sepiatoneimage.php                         30-Sep-2022 11:07                4904
imagick.setbackgroundcolor.php                     30-Sep-2022 11:07                3302
imagick.setcolorspace.php                          30-Sep-2022 11:07                2919
imagick.setcompression.php                         30-Sep-2022 11:07                2643
imagick.setcompressionquality.php                  30-Sep-2022 11:07                7419
imagick.setfilename.php                            30-Sep-2022 11:07                2485
imagick.setfirstiterator.php                       30-Sep-2022 11:07                2287
imagick.setfont.php                                30-Sep-2022 11:07                5897
imagick.setformat.php                              30-Sep-2022 11:07                2419
imagick.setgravity.php                             30-Sep-2022 11:07                2678
imagick.setimage.php                               30-Sep-2022 11:07                4797
imagick.setimagealphachannel.php                   30-Sep-2022 11:07                3657
imagick.setimageartifact.php                       30-Sep-2022 11:07                7569
imagick.setimageattribute.php                      30-Sep-2022 11:07                3162
imagick.setimagebackgroundcolor.php                30-Sep-2022 11:07                3532
imagick.setimagebias.php                           30-Sep-2022 11:07                7162
imagick.setimagebiasquantum.php                    30-Sep-2022 11:07                2897
imagick.setimageblueprimary.php                    30-Sep-2022 11:07                2935
imagick.setimagebordercolor.php                    30-Sep-2022 11:07                3516
imagick.setimagechanneldepth.php                   30-Sep-2022 11:07                2986
imagick.setimageclipmask.php                       30-Sep-2022 11:07                9562
imagick.setimagecolormapcolor.php                  30-Sep-2022 11:07                3087
imagick.setimagecolorspace.php                     30-Sep-2022 11:07                3150
imagick.setimagecompose.php                        30-Sep-2022 11:07                2824
imagick.setimagecompression.php                    30-Sep-2022 11:07                2804
imagick.setimagecompressionquality.php             30-Sep-2022 11:07                4851
imagick.setimagedelay.php                          30-Sep-2022 11:07                6201
imagick.setimagedepth.php                          30-Sep-2022 11:07                2627
imagick.setimagedispose.php                        30-Sep-2022 11:07                2663
imagick.setimageextent.php                         30-Sep-2022 11:07                2908
imagick.setimagefilename.php                       30-Sep-2022 11:07                2726
imagick.setimageformat.php                         30-Sep-2022 11:07                2656
imagick.setimagegamma.php                          30-Sep-2022 11:07                2637
imagick.setimagegravity.php                        30-Sep-2022 11:07                2877
imagick.setimagegreenprimary.php                   30-Sep-2022 11:07                2926
imagick.setimageindex.php                          30-Sep-2022 11:07                3331
imagick.setimageinterlacescheme.php                30-Sep-2022 11:07                2800
imagick.setimageinterpolatemethod.php              30-Sep-2022 11:07                2888
imagick.setimageiterations.php                     30-Sep-2022 11:07                4923
imagick.setimagematte.php                          30-Sep-2022 11:07                2697
imagick.setimagemattecolor.php                     30-Sep-2022 11:07                3794
imagick.setimageopacity.php                        30-Sep-2022 11:07                5115
imagick.setimageorientation.php                    30-Sep-2022 11:07                4689
imagick.setimagepage.php                           30-Sep-2022 11:07                3435
imagick.setimageprofile.php                        30-Sep-2022 11:07                3232
imagick.setimageproperty.php                       30-Sep-2022 11:07                5117
imagick.setimageredprimary.php                     30-Sep-2022 11:07                2926
imagick.setimagerenderingintent.php                30-Sep-2022 11:07                2811
imagick.setimageresolution.php                     30-Sep-2022 11:07                4951
imagick.setimagescene.php                          30-Sep-2022 11:07                2657
imagick.setimagetickspersecond.php                 30-Sep-2022 11:07                8006
imagick.setimagetype.php                           30-Sep-2022 11:07                2420
imagick.setimageunits.php                          30-Sep-2022 11:07                2456
imagick.setimagevirtualpixelmethod.php             30-Sep-2022 11:07                2598
imagick.setimagewhitepoint.php                     30-Sep-2022 11:07                2948
imagick.setinterlacescheme.php                     30-Sep-2022 11:07                2496
imagick.setiteratorindex.php                       30-Sep-2022 11:07                6332
imagick.setlastiterator.php                        30-Sep-2022 11:07                2303
imagick.setoption.php                              30-Sep-2022 11:07               12904
imagick.setpage.php                                30-Sep-2022 11:07                3179
imagick.setpointsize.php                           30-Sep-2022 11:07                5419
imagick.setprogressmonitor.php                     30-Sep-2022 11:07               12725
imagick.setregistry.php                            30-Sep-2022 11:07                2780
imagick.setresolution.php                          30-Sep-2022 11:07                3629
imagick.setresourcelimit.php                       30-Sep-2022 11:07                3479
imagick.setsamplingfactors.php                     30-Sep-2022 11:07                7150
imagick.setsize.php                                30-Sep-2022 11:07                2733
imagick.setsizeoffset.php                          30-Sep-2022 11:07                3261
imagick.settype.php                                30-Sep-2022 11:07                2364
imagick.setup.php                                  30-Sep-2022 11:07                1557
imagick.shadeimage.php                             30-Sep-2022 11:07                5550
imagick.shadowimage.php                            30-Sep-2022 11:07                5266
imagick.sharpenimage.php                           30-Sep-2022 11:07                5545
imagick.shaveimage.php                             30-Sep-2022 11:07                4671
imagick.shearimage.php                             30-Sep-2022 11:07                6563
imagick.sigmoidalcontrastimage.php                 30-Sep-2022 11:07                7953
imagick.sketchimage.php                            30-Sep-2022 11:07                5901
imagick.smushimages.php                            30-Sep-2022 11:07                5781
imagick.solarizeimage.php                          30-Sep-2022 11:07                4809
imagick.sparsecolorimage.php                       30-Sep-2022 11:07               31379
imagick.spliceimage.php                            30-Sep-2022 11:07                5614
imagick.spreadimage.php                            30-Sep-2022 11:07                4661
imagick.statisticimage.php                         30-Sep-2022 11:07                6697
imagick.steganoimage.php                           30-Sep-2022 11:07                2976
imagick.stereoimage.php                            30-Sep-2022 11:07                2774
imagick.stripimage.php                             30-Sep-2022 11:07                2477
imagick.subimagematch.php                          30-Sep-2022 11:07                7627
imagick.swirlimage.php                             30-Sep-2022 11:07                4721
imagick.textureimage.php                           30-Sep-2022 11:07                6457
imagick.thresholdimage.php                         30-Sep-2022 11:07                5196
imagick.thumbnailimage.php                         30-Sep-2022 11:07                7347
imagick.tintimage.php                              30-Sep-2022 11:07                8154
imagick.tostring.php                               30-Sep-2022 11:07                2900
imagick.transformimage.php                         30-Sep-2022 11:07                6230
imagick.transformimagecolorspace.php               30-Sep-2022 11:07                5801
imagick.transparentpaintimage.php                  30-Sep-2022 11:07                7411
imagick.transposeimage.php                         30-Sep-2022 11:07                4690
imagick.transverseimage.php                        30-Sep-2022 11:07                4677
imagick.trimimage.php                              30-Sep-2022 11:07                5856
imagick.uniqueimagecolors.php                      30-Sep-2022 11:07                5746
imagick.unsharpmaskimage.php                       30-Sep-2022 11:07                6602
imagick.valid.php                                  30-Sep-2022 11:07                2195
imagick.vignetteimage.php                          30-Sep-2022 11:07                6520
imagick.waveimage.php                              30-Sep-2022 11:07                6409
imagick.whitethresholdimage.php                    30-Sep-2022 11:07                5378
imagick.writeimage.php                             30-Sep-2022 11:07                2902
imagick.writeimagefile.php                         30-Sep-2022 11:07                3822
imagick.writeimages.php                            30-Sep-2022 11:07                2691
imagick.writeimagesfile.php                        30-Sep-2022 11:07                3901
imagickdraw.affine.php                             30-Sep-2022 11:07               18705
imagickdraw.annotation.php                         30-Sep-2022 11:07                3160
imagickdraw.arc.php                                30-Sep-2022 11:07                9872
imagickdraw.bezier.php                             30-Sep-2022 11:07               19662
imagickdraw.circle.php                             30-Sep-2022 11:07                9271
imagickdraw.clear.php                              30-Sep-2022 11:07                2326
imagickdraw.clone.php                              30-Sep-2022 11:07                2436
imagickdraw.color.php                              30-Sep-2022 11:07                3301
imagickdraw.comment.php                            30-Sep-2022 11:07                2665
imagickdraw.composite.php                          30-Sep-2022 11:07               12222
imagickdraw.construct.php                          30-Sep-2022 11:07                2248
imagickdraw.destroy.php                            30-Sep-2022 11:07                2344
imagickdraw.ellipse.php                            30-Sep-2022 11:07               12503
imagickdraw.getclippath.php                        30-Sep-2022 11:07                2347
imagickdraw.getcliprule.php                        30-Sep-2022 11:07                2460
imagickdraw.getclipunits.php                       30-Sep-2022 11:07                2272
imagickdraw.getfillcolor.php                       30-Sep-2022 11:07                2440
imagickdraw.getfillopacity.php                     30-Sep-2022 11:07                2340
imagickdraw.getfillrule.php                        30-Sep-2022 11:07                2390
imagickdraw.getfont.php                            30-Sep-2022 11:07                2308
imagickdraw.getfontfamily.php                      30-Sep-2022 11:07                2423
imagickdraw.getfontsize.php                        30-Sep-2022 11:07                2464
imagickdraw.getfontstretch.php                     30-Sep-2022 11:07                2253
imagickdraw.getfontstyle.php                       30-Sep-2022 11:07                2665
imagickdraw.getfontweight.php                      30-Sep-2022 11:07                2351
imagickdraw.getgravity.php                         30-Sep-2022 11:07                2515
imagickdraw.getstrokeantialias.php                 30-Sep-2022 11:07                2749
imagickdraw.getstrokecolor.php                     30-Sep-2022 11:07                2821
imagickdraw.getstrokedasharray.php                 30-Sep-2022 11:07                2453
imagickdraw.getstrokedashoffset.php                30-Sep-2022 11:07                2462
imagickdraw.getstrokelinecap.php                   30-Sep-2022 11:07                2589
imagickdraw.getstrokelinejoin.php                  30-Sep-2022 11:07                2603
imagickdraw.getstrokemiterlimit.php                30-Sep-2022 11:07                2744
imagickdraw.getstrokeopacity.php                   30-Sep-2022 11:07                2335
imagickdraw.getstrokewidth.php                     30-Sep-2022 11:07                2354
imagickdraw.gettextalignment.php                   30-Sep-2022 11:07                2496
imagickdraw.gettextantialias.php                   30-Sep-2022 11:07                2689
imagickdraw.gettextdecoration.php                  30-Sep-2022 11:07                2543
imagickdraw.gettextencoding.php                    30-Sep-2022 11:07                2512
imagickdraw.gettextinterlinespacing.php            30-Sep-2022 11:07                2313
imagickdraw.gettextinterwordspacing.php            30-Sep-2022 11:07                2337
imagickdraw.gettextkerning.php                     30-Sep-2022 11:07                2242
imagickdraw.gettextundercolor.php                  30-Sep-2022 11:07                2510
imagickdraw.getvectorgraphics.php                  30-Sep-2022 11:07                2585
imagickdraw.line.php                               30-Sep-2022 11:07                8476
imagickdraw.matte.php                              30-Sep-2022 11:07                8431
imagickdraw.pathclose.php                          30-Sep-2022 11:07                2396
imagickdraw.pathcurvetoabsolute.php                30-Sep-2022 11:07                4528
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-Sep-2022 11:07               12250
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-Sep-2022 11:07                4063
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-Sep-2022 11:07               11002
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-Sep-2022 11:07               10973
imagickdraw.pathcurvetorelative.php                30-Sep-2022 11:07                4556
imagickdraw.pathcurvetosmoothabsolute.php          30-Sep-2022 11:07                4367
imagickdraw.pathcurvetosmoothrelative.php          30-Sep-2022 11:07                4375
imagickdraw.pathellipticarcabsolute.php            30-Sep-2022 11:07                5334
imagickdraw.pathellipticarcrelative.php            30-Sep-2022 11:07                5304
imagickdraw.pathfinish.php                         30-Sep-2022 11:07                2234
imagickdraw.pathlinetoabsolute.php                 30-Sep-2022 11:07                3064
imagickdraw.pathlinetohorizontalabsolute.php       30-Sep-2022 11:07                2953
imagickdraw.pathlinetohorizontalrelative.php       30-Sep-2022 11:07                2953
imagickdraw.pathlinetorelative.php                 30-Sep-2022 11:07                3112
imagickdraw.pathlinetoverticalabsolute.php         30-Sep-2022 11:07                2929
imagickdraw.pathlinetoverticalrelative.php         30-Sep-2022 11:07                2929
imagickdraw.pathmovetoabsolute.php                 30-Sep-2022 11:07                3095
imagickdraw.pathmovetorelative.php                 30-Sep-2022 11:07                3061
imagickdraw.pathstart.php                          30-Sep-2022 11:07               12570
imagickdraw.point.php                              30-Sep-2022 11:07                7063
imagickdraw.polygon.php                            30-Sep-2022 11:07                9602
imagickdraw.polyline.php                           30-Sep-2022 11:07                9619
imagickdraw.pop.php                                30-Sep-2022 11:07                2659
imagickdraw.popclippath.php                        30-Sep-2022 11:07                2205
imagickdraw.popdefs.php                            30-Sep-2022 11:07                8115
imagickdraw.poppattern.php                         30-Sep-2022 11:07                2295
imagickdraw.push.php                               30-Sep-2022 11:07                8827
imagickdraw.pushclippath.php                       30-Sep-2022 11:07                2903
imagickdraw.pushdefs.php                           30-Sep-2022 11:07                2536
imagickdraw.pushpattern.php                        30-Sep-2022 11:07               15312
imagickdraw.rectangle.php                          30-Sep-2022 11:07                8650
imagickdraw.render.php                             30-Sep-2022 11:07                2395
imagickdraw.resetvectorgraphics.php                30-Sep-2022 11:07                2295
imagickdraw.rotate.php                             30-Sep-2022 11:07                8011
imagickdraw.roundrectangle.php                     30-Sep-2022 11:07                9422
imagickdraw.scale.php                              30-Sep-2022 11:07                8326
imagickdraw.setclippath.php                        30-Sep-2022 11:07                8823
imagickdraw.setcliprule.php                        30-Sep-2022 11:07                9940
imagickdraw.setclipunits.php                       30-Sep-2022 11:07                9235
imagickdraw.setfillalpha.php                       30-Sep-2022 11:07                8109
imagickdraw.setfillcolor.php                       30-Sep-2022 11:07                8127
imagickdraw.setfillopacity.php                     30-Sep-2022 11:07                8156
imagickdraw.setfillpatternurl.php                  30-Sep-2022 11:07                3227
imagickdraw.setfillrule.php                        30-Sep-2022 11:07               14887
imagickdraw.setfont.php                            30-Sep-2022 11:07                9681
imagickdraw.setfontfamily.php                      30-Sep-2022 11:07               10446
imagickdraw.setfontsize.php                        30-Sep-2022 11:07                8791
imagickdraw.setfontstretch.php                     30-Sep-2022 11:07               10647
imagickdraw.setfontstyle.php                       30-Sep-2022 11:07                9467
imagickdraw.setfontweight.php                      30-Sep-2022 11:07                9591
imagickdraw.setgravity.php                         30-Sep-2022 11:07               11506
imagickdraw.setresolution.php                      30-Sep-2022 11:07                2661
imagickdraw.setstrokealpha.php                     30-Sep-2022 11:07                8767
imagickdraw.setstrokeantialias.php                 30-Sep-2022 11:07                9480
imagickdraw.setstrokecolor.php                     30-Sep-2022 11:07                8896
imagickdraw.setstrokedasharray.php                 30-Sep-2022 11:07               14053
imagickdraw.setstrokedashoffset.php                30-Sep-2022 11:07               10427
imagickdraw.setstrokelinecap.php                   30-Sep-2022 11:07                9054
imagickdraw.setstrokelinejoin.php                  30-Sep-2022 11:07               12621
imagickdraw.setstrokemiterlimit.php                30-Sep-2022 11:07               12250
imagickdraw.setstrokeopacity.php                   30-Sep-2022 11:07               10717
imagickdraw.setstrokepatternurl.php                30-Sep-2022 11:07                2874
imagickdraw.setstrokewidth.php                     30-Sep-2022 11:07                8817
imagickdraw.settextalignment.php                   30-Sep-2022 11:07                9840
imagickdraw.settextantialias.php                   30-Sep-2022 11:07                9424
imagickdraw.settextdecoration.php                  30-Sep-2022 11:07                7744
imagickdraw.settextencoding.php                    30-Sep-2022 11:07                3181
imagickdraw.settextinterlinespacing.php            30-Sep-2022 11:07                2774
imagickdraw.settextinterwordspacing.php            30-Sep-2022 11:07                2567
imagickdraw.settextkerning.php                     30-Sep-2022 11:07                2693
imagickdraw.settextundercolor.php                  30-Sep-2022 11:07                8110
imagickdraw.setvectorgraphics.php                  30-Sep-2022 11:07                9676
imagickdraw.setviewbox.php                         30-Sep-2022 11:07               11056
imagickdraw.skewx.php                              30-Sep-2022 11:07                8496
imagickdraw.skewy.php                              30-Sep-2022 11:07                8489
imagickdraw.translate.php                          30-Sep-2022 11:07                8782
imagickkernel.addkernel.php                        30-Sep-2022 11:07                7598
imagickkernel.addunitykernel.php                   30-Sep-2022 11:07               15961
imagickkernel.frombuiltin.php                      30-Sep-2022 11:07               29652
imagickkernel.frommatrix.php                       30-Sep-2022 11:07               26024
imagickkernel.getmatrix.php                        30-Sep-2022 11:07                8211
imagickkernel.scale.php                            30-Sep-2022 11:07               15168
imagickkernel.separate.php                         30-Sep-2022 11:07               11728
imagickpixel.clear.php                             30-Sep-2022 11:07                2370
imagickpixel.construct.php                         30-Sep-2022 11:07               13955
imagickpixel.destroy.php                           30-Sep-2022 11:07                2490
imagickpixel.getcolor.php                          30-Sep-2022 11:07                7784
imagickpixel.getcolorasstring.php                  30-Sep-2022 11:07                4881
imagickpixel.getcolorcount.php                     30-Sep-2022 11:07                5097
imagickpixel.getcolorquantum.php                   30-Sep-2022 11:07                2804
imagickpixel.getcolorvalue.php                     30-Sep-2022 11:07                8802
imagickpixel.getcolorvaluequantum.php              30-Sep-2022 11:07                6550
imagickpixel.gethsl.php                            30-Sep-2022 11:07                4465
imagickpixel.getindex.php                          30-Sep-2022 11:07                2169
imagickpixel.ispixelsimilar.php                    30-Sep-2022 11:07                3448
imagickpixel.ispixelsimilarquantum.php             30-Sep-2022 11:07                2963
imagickpixel.issimilar.php                         30-Sep-2022 11:07               22970
imagickpixel.setcolor.php                          30-Sep-2022 11:07                7740
imagickpixel.setcolorcount.php                     30-Sep-2022 11:07                2460
imagickpixel.setcolorvalue.php                     30-Sep-2022 11:07                5071
imagickpixel.setcolorvaluequantum.php              30-Sep-2022 11:07                8559
imagickpixel.sethsl.php                            30-Sep-2022 11:07                7521
imagickpixel.setindex.php                          30-Sep-2022 11:07                2395
imagickpixeliterator.clear.php                     30-Sep-2022 11:07                7267
imagickpixeliterator.construct.php                 30-Sep-2022 11:07                6970
imagickpixeliterator.destroy.php                   30-Sep-2022 11:07                2494
imagickpixeliterator.getcurrentiteratorrow.php     30-Sep-2022 11:07                2618
imagickpixeliterator.getiteratorrow.php            30-Sep-2022 11:07                2531
imagickpixeliterator.getnextiteratorrow.php        30-Sep-2022 11:07                8052
imagickpixeliterator.getpreviousiteratorrow.php    30-Sep-2022 11:07                2665
imagickpixeliterator.newpixeliterator.php          30-Sep-2022 11:07                2714
imagickpixeliterator.newpixelregioniterator.php    30-Sep-2022 11:07                4087
imagickpixeliterator.resetiterator.php             30-Sep-2022 11:07               10578
imagickpixeliterator.setiteratorfirstrow.php       30-Sep-2022 11:07                2520
imagickpixeliterator.setiteratorlastrow.php        30-Sep-2022 11:07                2515
imagickpixeliterator.setiteratorrow.php            30-Sep-2022 11:07                7933
imagickpixeliterator.synciterator.php              30-Sep-2022 11:07                2382
imap.configuration.php                             30-Sep-2022 11:07                3341
imap.constants.php                                 30-Sep-2022 11:07               18807
imap.installation.php                              30-Sep-2022 11:07                2954
imap.requirements.php                              30-Sep-2022 11:07                3634
imap.resources.php                                 30-Sep-2022 11:07                1408
imap.setup.php                                     30-Sep-2022 11:07                1528
index.php                                          30-Sep-2022 11:08               13018
indexes.examples.php                               30-Sep-2022 11:08              716656
indexes.functions.php                              30-Sep-2022 11:08             1215656
indexes.php                                        30-Sep-2022 11:08                1356
infiniteiterator.construct.php                     30-Sep-2022 11:07                5069
infiniteiterator.next.php                          30-Sep-2022 11:07                3085
info.configuration.php                             30-Sep-2022 11:07               19861
info.constants.php                                 30-Sep-2022 11:07               17108
info.installation.php                              30-Sep-2022 11:07                1203
info.requirements.php                              30-Sep-2022 11:07                1143
info.resources.php                                 30-Sep-2022 11:07                1144
info.setup.php                                     30-Sep-2022 11:07                1515
ini.core.php                                       30-Sep-2022 11:08               76847
ini.list.php                                       30-Sep-2022 11:08               90071
ini.php                                            30-Sep-2022 11:08                1609
ini.sections.php                                   30-Sep-2022 11:08                4368
inotify.configuration.php                          30-Sep-2022 11:07                1186
inotify.constants.php                              30-Sep-2022 11:07                8616
inotify.install.php                                30-Sep-2022 11:07                1828
inotify.requirements.php                           30-Sep-2022 11:07                1210
inotify.resources.php                              30-Sep-2022 11:07                1329
inotify.setup.php                                  30-Sep-2022 11:07                1547
install.cloud.azure.php                            30-Sep-2022 11:07                4648
install.cloud.ec2.php                              30-Sep-2022 11:07                1482
install.cloud.php                                  30-Sep-2022 11:07                1726
install.fpm.configuration.php                      30-Sep-2022 11:07               37717
install.fpm.install.php                            30-Sep-2022 11:07                3504
install.fpm.php                                    30-Sep-2022 11:07                3922
install.general.php                                30-Sep-2022 11:07                5604
install.macosx.bundled.php                         30-Sep-2022 11:07               11930
install.macosx.compile.php                         30-Sep-2022 11:07                1466
install.macosx.packages.php                        30-Sep-2022 11:07                3288
install.macosx.php                                 30-Sep-2022 11:07                2101
install.pecl.downloads.php                         30-Sep-2022 11:07                4105
install.pecl.intro.php                             30-Sep-2022 11:07                3450
install.pecl.pear.php                              30-Sep-2022 11:07                3346
install.pecl.php                                   30-Sep-2022 11:07                2075
install.pecl.php-config.php                        30-Sep-2022 11:07                4239
install.pecl.phpize.php                            30-Sep-2022 11:07                3561
install.pecl.static.php                            30-Sep-2022 11:07                3435
install.pecl.windows.php                           30-Sep-2022 11:07               11127
install.php                                        30-Sep-2022 11:07                5884
install.problems.bugs.php                          30-Sep-2022 11:07                1922
install.problems.faq.php                           30-Sep-2022 11:07                1357
install.problems.php                               30-Sep-2022 11:07                1552
install.problems.support.php                       30-Sep-2022 11:07                2639
install.unix.apache2.php                           30-Sep-2022 11:07               14998
install.unix.commandline.php                       30-Sep-2022 11:07                4319
install.unix.debian.php                            30-Sep-2022 11:07                7771
install.unix.lighttpd-14.php                       30-Sep-2022 11:07                6641
install.unix.litespeed.php                         30-Sep-2022 11:07               10623
install.unix.nginx.php                             30-Sep-2022 11:07                9752
install.unix.openbsd.php                           30-Sep-2022 11:07                6632
install.unix.php                                   30-Sep-2022 11:07                8181
install.unix.solaris.php                           30-Sep-2022 11:07                4220
install.windows.apache2.php                        30-Sep-2022 11:07                7864
install.windows.building.php                       30-Sep-2022 11:07                1811
install.windows.commandline.php                    30-Sep-2022 11:07                9166
install.windows.manual.php                         30-Sep-2022 11:07                5871
install.windows.pecl.php                           30-Sep-2022 11:07                1676
install.windows.php                                30-Sep-2022 11:07                3339
install.windows.recommended.php                    30-Sep-2022 11:07                5899
install.windows.requirements.php                   30-Sep-2022 11:07                2687
install.windows.tools.php                          30-Sep-2022 11:07                1965
install.windows.troubleshooting.php                30-Sep-2022 11:07                1980
internaliterator.construct.php                     30-Sep-2022 11:07                1993
internaliterator.current.php                       30-Sep-2022 11:07                2309
internaliterator.key.php                           30-Sep-2022 11:07                2292
internaliterator.next.php                          30-Sep-2022 11:07                2205
internaliterator.rewind.php                        30-Sep-2022 11:07                2261
internaliterator.valid.php                         30-Sep-2022 11:07                2221
intl.configuration.php                             30-Sep-2022 11:07                5315
intl.constants.php                                 30-Sep-2022 11:07                7839
intl.examples.basic.php                            30-Sep-2022 11:07                4508
intl.examples.php                                  30-Sep-2022 11:07                1312
intl.installation.php                              30-Sep-2022 11:07                2669
intl.requirements.php                              30-Sep-2022 11:07                1697
intl.resources.php                                 30-Sep-2022 11:07                1144
intl.setup.php                                     30-Sep-2022 11:07                1526
intlbreakiterator.construct.php                    30-Sep-2022 11:07                2483
intlbreakiterator.createcharacterinstance.php      30-Sep-2022 11:07                3156
intlbreakiterator.createcodepointinstance.php      30-Sep-2022 11:07                2808
intlbreakiterator.createlineinstance.php           30-Sep-2022 11:07                3100
intlbreakiterator.createsentenceinstance.php       30-Sep-2022 11:07                3096
intlbreakiterator.createtitleinstance.php          30-Sep-2022 11:07                3096
intlbreakiterator.createwordinstance.php           30-Sep-2022 11:07                3046
intlbreakiterator.current.php                      30-Sep-2022 11:07                2446
intlbreakiterator.first.php                        30-Sep-2022 11:07                2421
intlbreakiterator.following.php                    30-Sep-2022 11:07                2661
intlbreakiterator.geterrorcode.php                 30-Sep-2022 11:07                2937
intlbreakiterator.geterrormessage.php              30-Sep-2022 11:07                3075
intlbreakiterator.getlocale.php                    30-Sep-2022 11:07                2672
intlbreakiterator.getpartsiterator.php             30-Sep-2022 11:07                3606
intlbreakiterator.gettext.php                      30-Sep-2022 11:07                2505
intlbreakiterator.isboundary.php                   30-Sep-2022 11:07                2641
intlbreakiterator.last.php                         30-Sep-2022 11:07                2422
intlbreakiterator.next.php                         30-Sep-2022 11:07                2697
intlbreakiterator.preceding.php                    30-Sep-2022 11:07                2656
intlbreakiterator.previous.php                     30-Sep-2022 11:07                2472
intlbreakiterator.settext.php                      30-Sep-2022 11:07                2651
intlcalendar.add.php                               30-Sep-2022 11:07                8790
intlcalendar.after.php                             30-Sep-2022 11:07                6913
intlcalendar.before.php                            30-Sep-2022 11:07                4180
intlcalendar.clear.php                             30-Sep-2022 11:07               20937
intlcalendar.construct.php                         30-Sep-2022 11:07                2423
intlcalendar.createinstance.php                    30-Sep-2022 11:07               13395
intlcalendar.equals.php                            30-Sep-2022 11:07               11189
intlcalendar.fielddifference.php                   30-Sep-2022 11:07               11489
intlcalendar.fromdatetime.php                      30-Sep-2022 11:07                7693
intlcalendar.get.php                               30-Sep-2022 11:07                8941
intlcalendar.getactualmaximum.php                  30-Sep-2022 11:07                8672
intlcalendar.getactualminimum.php                  30-Sep-2022 11:07                5833
intlcalendar.getavailablelocales.php               30-Sep-2022 11:07                4282
intlcalendar.getdayofweektype.php                  30-Sep-2022 11:07                9925
intlcalendar.geterrorcode.php                      30-Sep-2022 11:07                9586
intlcalendar.geterrormessage.php                   30-Sep-2022 11:07                6209
intlcalendar.getfirstdayofweek.php                 30-Sep-2022 11:07                8589
intlcalendar.getgreatestminimum.php                30-Sep-2022 11:07                4612
intlcalendar.getkeywordvaluesforlocale.php         30-Sep-2022 11:07                7767
intlcalendar.getleastmaximum.php                   30-Sep-2022 11:07                8477
intlcalendar.getlocale.php                         30-Sep-2022 11:07                6247
intlcalendar.getmaximum.php                        30-Sep-2022 11:07                5343
intlcalendar.getminimaldaysinfirstweek.php         30-Sep-2022 11:07                9013
intlcalendar.getminimum.php                        30-Sep-2022 11:07                4520
intlcalendar.getnow.php                            30-Sep-2022 11:07                5393
intlcalendar.getrepeatedwalltimeoption.php         30-Sep-2022 11:07               10478
intlcalendar.getskippedwalltimeoption.php          30-Sep-2022 11:07               12998
intlcalendar.gettime.php                           30-Sep-2022 11:07                6569
intlcalendar.gettimezone.php                       30-Sep-2022 11:07                7695
intlcalendar.gettype.php                           30-Sep-2022 11:07                5750
intlcalendar.getweekendtransition.php              30-Sep-2022 11:07                4773
intlcalendar.indaylighttime.php                    30-Sep-2022 11:07                8859
intlcalendar.isequivalentto.php                    30-Sep-2022 11:07                8681
intlcalendar.islenient.php                         30-Sep-2022 11:07                8497
intlcalendar.isset.php                             30-Sep-2022 11:07                4921
intlcalendar.isweekend.php                         30-Sep-2022 11:07                8986
intlcalendar.roll.php                              30-Sep-2022 11:07                9320
intlcalendar.set.php                               30-Sep-2022 11:07               14517
intlcalendar.setfirstdayofweek.php                 30-Sep-2022 11:07                7955
intlcalendar.setlenient.php                        30-Sep-2022 11:07                4316
intlcalendar.setminimaldaysinfirstweek.php         30-Sep-2022 11:07                4143
intlcalendar.setrepeatedwalltimeoption.php         30-Sep-2022 11:07                5589
intlcalendar.setskippedwalltimeoption.php          30-Sep-2022 11:07                6411
intlcalendar.settime.php                           30-Sep-2022 11:07                8679
intlcalendar.settimezone.php                       30-Sep-2022 11:07               11345
intlcalendar.todatetime.php                        30-Sep-2022 11:07                7380
intlchar.charage.php                               30-Sep-2022 11:07                5787
intlchar.chardigitvalue.php                        30-Sep-2022 11:07                5293
intlchar.chardirection.php                         30-Sep-2022 11:07                8809
intlchar.charfromname.php                          30-Sep-2022 11:07                6934
intlchar.charmirror.php                            30-Sep-2022 11:07                6473
intlchar.charname.php                              30-Sep-2022 11:07                7178
intlchar.chartype.php                              30-Sep-2022 11:07                9211
intlchar.chr.php                                   30-Sep-2022 11:07                5558
intlchar.digit.php                                 30-Sep-2022 11:07                8458
intlchar.enumcharnames.php                         30-Sep-2022 11:07                7796
intlchar.enumchartypes.php                         30-Sep-2022 11:07                6027
intlchar.foldcase.php                              30-Sep-2022 11:07                3729
intlchar.fordigit.php                              30-Sep-2022 11:07                6917
intlchar.getbidipairedbracket.php                  30-Sep-2022 11:07                5779
intlchar.getblockcode.php                          30-Sep-2022 11:07                5351
intlchar.getcombiningclass.php                     30-Sep-2022 11:07                4708
intlchar.getfc-nfkc-closure.php                    30-Sep-2022 11:07                4659
intlchar.getintpropertymaxvalue.php                30-Sep-2022 11:07                6523
intlchar.getintpropertyminvalue.php                30-Sep-2022 11:07                6510
intlchar.getintpropertyvalue.php                   30-Sep-2022 11:07                8005
intlchar.getnumericvalue.php                       30-Sep-2022 11:07                5302
intlchar.getpropertyenum.php                       30-Sep-2022 11:07                6820
intlchar.getpropertyname.php                       30-Sep-2022 11:07                8829
intlchar.getpropertyvalueenum.php                  30-Sep-2022 11:07                8219
intlchar.getpropertyvaluename.php                  30-Sep-2022 11:07               10792
intlchar.getunicodeversion.php                     30-Sep-2022 11:07                3987
intlchar.hasbinaryproperty.php                     30-Sep-2022 11:07                9013
intlchar.isalnum.php                               30-Sep-2022 11:07                5442
intlchar.isalpha.php                               30-Sep-2022 11:07                5372
intlchar.isbase.php                                30-Sep-2022 11:07                5881
intlchar.isblank.php                               30-Sep-2022 11:07                6774
intlchar.iscntrl.php                               30-Sep-2022 11:07                6101
intlchar.isdefined.php                             30-Sep-2022 11:07                6838
intlchar.isdigit.php                               30-Sep-2022 11:07                5760
intlchar.isgraph.php                               30-Sep-2022 11:07                5354
intlchar.isidignorable.php                         30-Sep-2022 11:07                6063
intlchar.isidpart.php                              30-Sep-2022 11:07                6573
intlchar.isidstart.php                             30-Sep-2022 11:07                6112
intlchar.isisocontrol.php                          30-Sep-2022 11:07                5378
intlchar.isjavaidpart.php                          30-Sep-2022 11:07                6791
intlchar.isjavaidstart.php                         30-Sep-2022 11:07                6472
intlchar.isjavaspacechar.php                       30-Sep-2022 11:07                6676
intlchar.islower.php                               30-Sep-2022 11:07                7038
intlchar.ismirrored.php                            30-Sep-2022 11:07                5410
intlchar.isprint.php                               30-Sep-2022 11:07                5660
intlchar.ispunct.php                               30-Sep-2022 11:07                5111
intlchar.isspace.php                               30-Sep-2022 11:07                6252
intlchar.istitle.php                               30-Sep-2022 11:07                6381
intlchar.isualphabetic.php                         30-Sep-2022 11:07                5703
intlchar.isulowercase.php                          30-Sep-2022 11:07                6723
intlchar.isupper.php                               30-Sep-2022 11:07                7033
intlchar.isuuppercase.php                          30-Sep-2022 11:07                6770
intlchar.isuwhitespace.php                         30-Sep-2022 11:07                7267
intlchar.iswhitespace.php                          30-Sep-2022 11:07                7363
intlchar.isxdigit.php                              30-Sep-2022 11:07                6809
intlchar.ord.php                                   30-Sep-2022 11:07                5316
intlchar.tolower.php                               30-Sep-2022 11:07                7323
intlchar.totitle.php                               30-Sep-2022 11:07                7392
intlchar.toupper.php                               30-Sep-2022 11:07                7249
intlcodepointbreakiterator.getlastcodepoint.php    30-Sep-2022 11:07                2717
intldateformatter.create.php                       30-Sep-2022 11:07               27997
intldateformatter.format.php                       30-Sep-2022 11:07               28088
intldateformatter.formatobject.php                 30-Sep-2022 11:07               14428
intldateformatter.getcalendar.php                  30-Sep-2022 11:07                9527
intldateformatter.getcalendarobject.php            30-Sep-2022 11:07                7848
intldateformatter.getdatetype.php                  30-Sep-2022 11:07               12280
intldateformatter.geterrorcode.php                 30-Sep-2022 11:07                9376
intldateformatter.geterrormessage.php              30-Sep-2022 11:07                9230
intldateformatter.getlocale.php                    30-Sep-2022 11:07               12615
intldateformatter.getpattern.php                   30-Sep-2022 11:07               10867
intldateformatter.gettimetype.php                  30-Sep-2022 11:07               12270
intldateformatter.gettimezone.php                  30-Sep-2022 11:07                8954
intldateformatter.gettimezoneid.php                30-Sep-2022 11:07                9191
intldateformatter.islenient.php                    30-Sep-2022 11:07               16001
intldateformatter.localtime.php                    30-Sep-2022 11:07               12156
intldateformatter.parse.php                        30-Sep-2022 11:07               12771
intldateformatter.setcalendar.php                  30-Sep-2022 11:07               14840
intldateformatter.setlenient.php                   30-Sep-2022 11:07               16817
intldateformatter.setpattern.php                   30-Sep-2022 11:07               11980
intldateformatter.settimezone.php                  30-Sep-2022 11:07               11822
intldatepatterngenerator.create.php                30-Sep-2022 11:07                3857
intldatepatterngenerator.getbestpattern.php        30-Sep-2022 11:07                6943
intlgregoriancalendar.construct.php                30-Sep-2022 11:07                5139
intlgregoriancalendar.getgregorianchange.php       30-Sep-2022 11:07                2652
intlgregoriancalendar.isleapyear.php               30-Sep-2022 11:07                2917
intlgregoriancalendar.setgregorianchange.php       30-Sep-2022 11:07                2897
intliterator.current.php                           30-Sep-2022 11:07                2410
intliterator.key.php                               30-Sep-2022 11:07                2383
intliterator.next.php                              30-Sep-2022 11:07                2311
intliterator.rewind.php                            30-Sep-2022 11:07                2352
intliterator.valid.php                             30-Sep-2022 11:07                2299
intlpartsiterator.getbreakiterator.php             30-Sep-2022 11:07                2603
intlrulebasedbreakiterator.construct.php           30-Sep-2022 11:07                3052
intlrulebasedbreakiterator.getbinaryrules.php      30-Sep-2022 11:07                2773
intlrulebasedbreakiterator.getrules.php            30-Sep-2022 11:07                2746
intlrulebasedbreakiterator.getrulestatus.php       30-Sep-2022 11:07                2709
intlrulebasedbreakiterator.getrulestatusvec.php    30-Sep-2022 11:07                2806
intltimezone.construct.php                         30-Sep-2022 11:07                1982
intltimezone.countequivalentids.php                30-Sep-2022 11:07                3408
intltimezone.createdefault.php                     30-Sep-2022 11:07                3050
intltimezone.createenumeration.php                 30-Sep-2022 11:07                4174
intltimezone.createtimezone.php                    30-Sep-2022 11:07                3453
intltimezone.createtimezoneidenumeration.php       30-Sep-2022 11:07                5139
intltimezone.fromdatetimezone.php                  30-Sep-2022 11:07                3693
intltimezone.getcanonicalid.php                    30-Sep-2022 11:07                3959
intltimezone.getdisplayname.php                    30-Sep-2022 11:07                4824
intltimezone.getdstsavings.php                     30-Sep-2022 11:07                3065
intltimezone.getequivalentid.php                   30-Sep-2022 11:07                3692
intltimezone.geterrorcode.php                      30-Sep-2022 11:07                3169
intltimezone.geterrormessage.php                   30-Sep-2022 11:07                3196
intltimezone.getgmt.php                            30-Sep-2022 11:07                2885
intltimezone.getid.php                             30-Sep-2022 11:07                3058
intltimezone.getidforwindowsid.php                 30-Sep-2022 11:07                5430
intltimezone.getoffset.php                         30-Sep-2022 11:07                4537
intltimezone.getrawoffset.php                      30-Sep-2022 11:07                2989
intltimezone.getregion.php                         30-Sep-2022 11:07                3404
intltimezone.gettzdataversion.php                  30-Sep-2022 11:07                3106
intltimezone.getunknown.php                        30-Sep-2022 11:07                3147
intltimezone.getwindowsid.php                      30-Sep-2022 11:07                4266
intltimezone.hassamerules.php                      30-Sep-2022 11:07                3477
intltimezone.todatetimezone.php                    30-Sep-2022 11:07                3421
intltimezone.usedaylighttime.php                   30-Sep-2022 11:07                3046
intro-whatcando.php                                30-Sep-2022 11:07                9094
intro-whatis.php                                   30-Sep-2022 11:07                4923
intro.apache.php                                   30-Sep-2022 11:08                1174
intro.apcu.php                                     30-Sep-2022 11:07                1818
intro.array.php                                    30-Sep-2022 11:08                1994
intro.bc.php                                       30-Sep-2022 11:07                4663
intro.bzip2.php                                    30-Sep-2022 11:07                1177
intro.calendar.php                                 30-Sep-2022 11:07                2333
intro.classobj.php                                 30-Sep-2022 11:08                1913
intro.cmark.php                                    30-Sep-2022 11:08                6343
intro.com.php                                      30-Sep-2022 11:08                3829
intro.componere.php                                30-Sep-2022 11:07                6106
intro.csprng.php                                   30-Sep-2022 11:07                1731
intro.ctype.php                                    30-Sep-2022 11:08                4276
intro.cubrid.php                                   30-Sep-2022 11:07                1523
intro.curl.php                                     30-Sep-2022 11:08                1722
intro.datetime.php                                 30-Sep-2022 11:07                2307
intro.dba.php                                      30-Sep-2022 11:07                1566
intro.dbase.php                                    30-Sep-2022 11:07                6271
intro.dio.php                                      30-Sep-2022 11:07                1733
intro.dom.php                                      30-Sep-2022 11:08                1741
intro.ds.php                                       30-Sep-2022 11:08                1355
intro.eio.php                                      30-Sep-2022 11:07               16190
intro.enchant.php                                  30-Sep-2022 11:07                2858
intro.errorfunc.php                                30-Sep-2022 11:07                2179
intro.ev.php                                       30-Sep-2022 11:07                2607
intro.event.php                                    30-Sep-2022 11:08                1937
intro.exec.php                                     30-Sep-2022 11:07                1879
intro.exif.php                                     30-Sep-2022 11:07                1519
intro.expect.php                                   30-Sep-2022 11:07                1473
intro.fann.php                                     30-Sep-2022 11:07                1376
intro.fdf.php                                      30-Sep-2022 11:07                4451
intro.ffi.php                                      30-Sep-2022 11:07                2809
intro.fileinfo.php                                 30-Sep-2022 11:07                1433
intro.filesystem.php                               30-Sep-2022 11:07                1536
intro.filter.php                                   30-Sep-2022 11:08                2970
intro.fpm.php                                      30-Sep-2022 11:08                1327
intro.ftp.php                                      30-Sep-2022 11:08                1924
intro.funchand.php                                 30-Sep-2022 11:08                1164
intro.gearman.php                                  30-Sep-2022 11:08                1860
intro.gender.php                                   30-Sep-2022 11:07                1398
intro.geoip.php                                    30-Sep-2022 11:07                1611
intro.gettext.php                                  30-Sep-2022 11:07                1583
intro.gmagick.php                                  30-Sep-2022 11:07                1838
intro.gmp.php                                      30-Sep-2022 11:07                3356
intro.gnupg.php                                    30-Sep-2022 11:07                1209
intro.hash.php                                     30-Sep-2022 11:07                1297
intro.hrtime.php                                   30-Sep-2022 11:07                1620
intro.ibase.php                                    30-Sep-2022 11:07                3674
intro.ibm-db2.php                                  30-Sep-2022 11:07                1292
intro.iconv.php                                    30-Sep-2022 11:07                2207
intro.igbinary.php                                 30-Sep-2022 11:07                1790
intro.image.php                                    30-Sep-2022 11:07                6989
intro.imagick.php                                  30-Sep-2022 11:07                1863
intro.imap.php                                     30-Sep-2022 11:07                1790
intro.info.php                                     30-Sep-2022 11:07                1520
intro.inotify.php                                  30-Sep-2022 11:07                2454
intro.intl.php                                     30-Sep-2022 11:07                5289
intro.json.php                                     30-Sep-2022 11:07                1697
intro.ldap.php                                     30-Sep-2022 11:08                4615
intro.libxml.php                                   30-Sep-2022 11:08                1801
intro.lua.php                                      30-Sep-2022 11:07                1301
intro.luasandbox.php                               30-Sep-2022 11:07                2319
intro.lzf.php                                      30-Sep-2022 11:07                1558
intro.mail.php                                     30-Sep-2022 11:07                1210
intro.mailparse.php                                30-Sep-2022 11:07                2181
intro.math.php                                     30-Sep-2022 11:07                1667
intro.mbstring.php                                 30-Sep-2022 11:07                3113
intro.mcrypt.php                                   30-Sep-2022 11:07                2478
intro.memcache.php                                 30-Sep-2022 11:08                1827
intro.memcached.php                                30-Sep-2022 11:08                2043
intro.mhash.php                                    30-Sep-2022 11:07                3189
intro.misc.php                                     30-Sep-2022 11:07                1154
intro.mqseries.php                                 30-Sep-2022 11:08                1907
intro.mysql-xdevapi.php                            30-Sep-2022 11:07                2118
intro.mysql.php                                    30-Sep-2022 11:07                1986
intro.mysqli.php                                   30-Sep-2022 11:07                2380
intro.mysqlnd.php                                  30-Sep-2022 11:07                2279
intro.network.php                                  30-Sep-2022 11:08                1157
intro.oauth.php                                    30-Sep-2022 11:08                1455
intro.oci8.php                                     30-Sep-2022 11:07                1649
intro.opcache.php                                  30-Sep-2022 11:07                1594
intro.openal.php                                   30-Sep-2022 11:07                1262
intro.openssl.php                                  30-Sep-2022 11:07                1693
intro.outcontrol.php                               30-Sep-2022 11:07                1888
intro.parallel.php                                 30-Sep-2022 11:07                6813
intro.parle.php                                    30-Sep-2022 11:08                3393
intro.password.php                                 30-Sep-2022 11:07                1461
intro.pcntl.php                                    30-Sep-2022 11:07                2975
intro.pcre.php                                     30-Sep-2022 11:08                3007
intro.pdo.php                                      30-Sep-2022 11:07                2645
intro.pgsql.php                                    30-Sep-2022 11:07                1865
intro.phar.php                                     30-Sep-2022 11:07               11737
intro.phpdbg.php                                   30-Sep-2022 11:07                7125
intro.posix.php                                    30-Sep-2022 11:07                1780
intro.ps.php                                       30-Sep-2022 11:07                1944
intro.pspell.php                                   30-Sep-2022 11:07                1202
intro.pthreads.php                                 30-Sep-2022 11:07               10823
intro.quickhash.php                                30-Sep-2022 11:08                1221
intro.radius.php                                   30-Sep-2022 11:07                2225
intro.rar.php                                      30-Sep-2022 11:07                1677
intro.readline.php                                 30-Sep-2022 11:07                2231
intro.recode.php                                   30-Sep-2022 11:07                2530
intro.reflection.php                               30-Sep-2022 11:08                2054
intro.rpminfo.php                                  30-Sep-2022 11:07                1180
intro.rrd.php                                      30-Sep-2022 11:08                1390
intro.runkit7.php                                  30-Sep-2022 11:07                1433
intro.scoutapm.php                                 30-Sep-2022 11:08                1508
intro.seaslog.php                                  30-Sep-2022 11:07                4127
intro.sem.php                                      30-Sep-2022 11:07                3621
intro.session.php                                  30-Sep-2022 11:08                5551
intro.shmop.php                                    30-Sep-2022 11:07                1236
intro.simplexml.php                                30-Sep-2022 11:08                1394
intro.snmp.php                                     30-Sep-2022 11:08                1723
intro.soap.php                                     30-Sep-2022 11:08                1539
intro.sockets.php                                  30-Sep-2022 11:08                2940
intro.sodium.php                                   30-Sep-2022 11:07                1395
intro.solr.php                                     30-Sep-2022 11:08                1951
intro.spl.php                                      30-Sep-2022 11:07                1573
intro.sqlite3.php                                  30-Sep-2022 11:07                1148
intro.sqlsrv.php                                   30-Sep-2022 11:07                2328
intro.ssdeep.php                                   30-Sep-2022 11:08                1713
intro.ssh2.php                                     30-Sep-2022 11:08                1370
intro.stats.php                                    30-Sep-2022 11:07                1465
intro.stomp.php                                    30-Sep-2022 11:08                1298
intro.stream.php                                   30-Sep-2022 11:07                5204
intro.strings.php                                  30-Sep-2022 11:08                1673
intro.svm.php                                      30-Sep-2022 11:08                1277
intro.svn.php                                      30-Sep-2022 11:08                1912
intro.swoole.php                                   30-Sep-2022 11:07                1622
intro.sync.php                                     30-Sep-2022 11:07                2308
intro.taint.php                                    30-Sep-2022 11:08                4634
intro.tcpwrap.php                                  30-Sep-2022 11:08                1305
intro.tidy.php                                     30-Sep-2022 11:08                1445
intro.tokenizer.php                                30-Sep-2022 11:08                1526
intro.trader.php                                   30-Sep-2022 11:07                2342
intro.ui.php                                       30-Sep-2022 11:08                1165
intro.uodbc.php                                    30-Sep-2022 11:07                2922
intro.uopz.php                                     30-Sep-2022 11:07                2681
intro.url.php                                      30-Sep-2022 11:08                1118
intro.v8js.php                                     30-Sep-2022 11:08                1212
intro.var.php                                      30-Sep-2022 11:08                1322
intro.var_representation.php                       30-Sep-2022 11:08                1383
intro.varnish.php                                  30-Sep-2022 11:08                1380
intro.wddx.php                                     30-Sep-2022 11:08                2495
intro.win32service.php                             30-Sep-2022 11:08                1403
intro.wincache.php                                 30-Sep-2022 11:07                6185
intro.wkhtmltox.php                                30-Sep-2022 11:07                1317
intro.xattr.php                                    30-Sep-2022 11:07                1150
intro.xdiff.php                                    30-Sep-2022 11:07                3186
intro.xhprof.php                                   30-Sep-2022 11:07                3221
intro.xlswriter.php                                30-Sep-2022 11:07                1169
intro.xml.php                                      30-Sep-2022 11:08                2521
intro.xmldiff.php                                  30-Sep-2022 11:08                1365
intro.xmlreader.php                                30-Sep-2022 11:08                1643
intro.xmlrpc.php                                   30-Sep-2022 11:08                2079
intro.xmlwriter.php                                30-Sep-2022 11:08                1657
intro.xsl.php                                      30-Sep-2022 11:08                1336
intro.yac.php                                      30-Sep-2022 11:07                1156
intro.yaconf.php                                   30-Sep-2022 11:08                2514
intro.yaf.php                                      30-Sep-2022 11:08                1601
intro.yaml.php                                     30-Sep-2022 11:08                1443
intro.yar.php                                      30-Sep-2022 11:08                1225
intro.yaz.php                                      30-Sep-2022 11:08                2932
intro.zip.php                                      30-Sep-2022 11:07                1205
intro.zlib.php                                     30-Sep-2022 11:07                1753
intro.zmq.php                                      30-Sep-2022 11:08                1341
intro.zookeeper.php                                30-Sep-2022 11:08                1402
introduction.php                                   30-Sep-2022 11:07                1398
iterator.current.php                               30-Sep-2022 11:07                2190
iterator.key.php                                   30-Sep-2022 11:07                2477
iterator.next.php                                  30-Sep-2022 11:07                2387
iterator.rewind.php                                30-Sep-2022 11:07                2632
iterator.valid.php                                 30-Sep-2022 11:07                2587
iteratoraggregate.getiterator.php                  30-Sep-2022 11:07                2897
iteratoriterator.construct.php                     30-Sep-2022 11:07                2956
iteratoriterator.current.php                       30-Sep-2022 11:07                2764
iteratoriterator.getinneriterator.php              30-Sep-2022 11:07                3148
iteratoriterator.key.php                           30-Sep-2022 11:07                2722
iteratoriterator.next.php                          30-Sep-2022 11:07                2817
iteratoriterator.rewind.php                        30-Sep-2022 11:07                2841
iteratoriterator.valid.php                         30-Sep-2022 11:07                2949
json.configuration.php                             30-Sep-2022 11:07                1169
json.constants.php                                 30-Sep-2022 11:07               13492
json.installation.php                              30-Sep-2022 11:07                1916
json.requirements.php                              30-Sep-2022 11:07                1187
json.resources.php                                 30-Sep-2022 11:07                1144
json.setup.php                                     30-Sep-2022 11:07                1496
jsonserializable.jsonserialize.php                 30-Sep-2022 11:07               12763
langref.php                                        30-Sep-2022 11:07               19728
language.attributes.classes.php                    30-Sep-2022 11:07                5864
language.attributes.overview.php                   30-Sep-2022 11:07               12276
language.attributes.php                            30-Sep-2022 11:07                1802
language.attributes.reflection.php                 30-Sep-2022 11:07                9283
language.attributes.syntax.php                     30-Sep-2022 11:07                5433
language.basic-syntax.comments.php                 30-Sep-2022 11:07                4252
language.basic-syntax.instruction-separation.php   30-Sep-2022 11:07                4486
language.basic-syntax.php                          30-Sep-2022 11:07                1625
language.basic-syntax.phpmode.php                  30-Sep-2022 11:07                4924
language.basic-syntax.phptags.php                  30-Sep-2022 11:07                5551
language.constants.magic.php                       30-Sep-2022 11:07                5464
language.constants.php                             30-Sep-2022 11:07                6585
language.constants.predefined.php                  30-Sep-2022 11:07                1609
language.constants.syntax.php                      30-Sep-2022 11:07               11088
language.control-structures.php                    30-Sep-2022 11:07                2701
language.enumerations.backed.php                   30-Sep-2022 11:07               11568
language.enumerations.basics.php                   30-Sep-2022 11:07                8311
language.enumerations.constants.php                30-Sep-2022 11:07                2525
language.enumerations.examples.php                 30-Sep-2022 11:07                8130
language.enumerations.expressions.php              30-Sep-2022 11:07                6075
language.enumerations.listing.php                  30-Sep-2022 11:07                2363
language.enumerations.methods.php                  30-Sep-2022 11:07               16501
language.enumerations.object-differences.php       30-Sep-2022 11:07                5690
language.enumerations.overview.php                 30-Sep-2022 11:07                2481
language.enumerations.php                          30-Sep-2022 11:07                2391
language.enumerations.serialization.php            30-Sep-2022 11:07                5322
language.enumerations.static-methods.php           30-Sep-2022 11:07                3841
language.enumerations.traits.php                   30-Sep-2022 11:07                5256
language.errors.basics.php                         30-Sep-2022 11:07                5690
language.errors.php                                30-Sep-2022 11:07                1977
language.errors.php7.php                           30-Sep-2022 11:07                5947
language.exceptions.extending.php                  30-Sep-2022 11:07               24704
language.exceptions.php                            30-Sep-2022 11:07               32089
language.expressions.php                           30-Sep-2022 11:07               17772
language.fibers.php                                30-Sep-2022 11:07                7091
language.functions.php                             30-Sep-2022 11:07                1879
language.generators.comparison.php                 30-Sep-2022 11:07               10579
language.generators.overview.php                   30-Sep-2022 11:07               10846
language.generators.php                            30-Sep-2022 11:07                1847
language.generators.syntax.php                     30-Sep-2022 11:07               28067
language.namespaces.basics.php                     30-Sep-2022 11:07               13535
language.namespaces.definition.php                 30-Sep-2022 11:07                4699
language.namespaces.definitionmultiple.php         30-Sep-2022 11:07               10252
language.namespaces.dynamic.php                    30-Sep-2022 11:07                9045
language.namespaces.fallback.php                   30-Sep-2022 11:07                6871
language.namespaces.faq.php                        30-Sep-2022 11:07               35639
language.namespaces.global.php                     30-Sep-2022 11:07                3186
language.namespaces.importing.php                  30-Sep-2022 11:07               19835
language.namespaces.nested.php                     30-Sep-2022 11:07                3022
language.namespaces.nsconstants.php                30-Sep-2022 11:07               10252
language.namespaces.php                            30-Sep-2022 11:07                2476
language.namespaces.rationale.php                  30-Sep-2022 11:07                7416
language.namespaces.rules.php                      30-Sep-2022 11:07               16544
language.oop5.abstract.php                         30-Sep-2022 11:07               12544
language.oop5.anonymous.php                        30-Sep-2022 11:07               12456
language.oop5.autoload.php                         30-Sep-2022 11:07                7267
language.oop5.basic.php                            30-Sep-2022 11:07               51318
language.oop5.changelog.php                        30-Sep-2022 11:07               15236
language.oop5.cloning.php                          30-Sep-2022 11:07               10242
language.oop5.constants.php                        30-Sep-2022 11:07                9831
language.oop5.decon.php                            30-Sep-2022 11:07               32492
language.oop5.final.php                            30-Sep-2022 11:07                6982
language.oop5.inheritance.php                      30-Sep-2022 11:07               15451
language.oop5.interfaces.php                       30-Sep-2022 11:07               24906
language.oop5.iterations.php                       30-Sep-2022 11:07                6607
language.oop5.late-static-bindings.php             30-Sep-2022 11:07               17089
language.oop5.magic.php                            30-Sep-2022 11:07               47281
language.oop5.object-comparison.php                30-Sep-2022 11:07                9986
language.oop5.overloading.php                      30-Sep-2022 11:07               27525
language.oop5.paamayim-nekudotayim.php             30-Sep-2022 11:07                9393
language.oop5.php                                  30-Sep-2022 11:07                3511
language.oop5.properties.php                       30-Sep-2022 11:07               29631
language.oop5.references.php                       30-Sep-2022 11:07                6565
language.oop5.serialization.php                    30-Sep-2022 11:07                8052
language.oop5.static.php                           30-Sep-2022 11:07               10159
language.oop5.traits.php                           30-Sep-2022 11:07               36372
language.oop5.variance.php                         30-Sep-2022 11:07               17654
language.oop5.visibility.php                       30-Sep-2022 11:07               29264
language.operators.arithmetic.php                  30-Sep-2022 11:07                6071
language.operators.array.php                       30-Sep-2022 11:07                9348
language.operators.assignment.php                  30-Sep-2022 11:07               12271
language.operators.bitwise.php                     30-Sep-2022 11:07               47676
language.operators.comparison.php                  30-Sep-2022 11:07               44221
language.operators.errorcontrol.php                30-Sep-2022 11:07                6540
language.operators.execution.php                   30-Sep-2022 11:07                3578
language.operators.increment.php                   30-Sep-2022 11:07               11709
language.operators.logical.php                     30-Sep-2022 11:07                8002
language.operators.php                             30-Sep-2022 11:07                4020
language.operators.precedence.php                  30-Sep-2022 11:07               22248
language.operators.string.php                      30-Sep-2022 11:07                3186
language.operators.type.php                        30-Sep-2022 11:07               19566
language.references.arent.php                      30-Sep-2022 11:07                3533
language.references.pass.php                       30-Sep-2022 11:07                7416
language.references.php                            30-Sep-2022 11:07                2006
language.references.return.php                     30-Sep-2022 11:07                7988
language.references.spot.php                       30-Sep-2022 11:07                2752
language.references.unset.php                      30-Sep-2022 11:07                2390
language.references.whatare.php                    30-Sep-2022 11:07                2372
language.references.whatdo.php                     30-Sep-2022 11:07               20225
language.types.array.php                           30-Sep-2022 11:07              113412
language.types.boolean.php                         30-Sep-2022 11:07                9403
language.types.callable.php                        30-Sep-2022 11:07               12946
language.types.declarations.php                    30-Sep-2022 11:07               55924
language.types.enumerations.php                    30-Sep-2022 11:07                3638
language.types.float.php                           30-Sep-2022 11:07                9889
language.types.integer.php                         30-Sep-2022 11:07               20814
language.types.intro.php                           30-Sep-2022 11:07                8575
language.types.iterable.php                        30-Sep-2022 11:07                6927
language.types.null.php                            30-Sep-2022 11:07                3660
language.types.numeric-strings.php                 30-Sep-2022 11:07               11260
language.types.object.php                          30-Sep-2022 11:07                5793
language.types.php                                 30-Sep-2022 11:07                2363
language.types.resource.php                        30-Sep-2022 11:07                3327
language.types.string.php                          30-Sep-2022 11:07               87333
language.types.type-juggling.php                   30-Sep-2022 11:07               19650
language.variables.basics.php                      30-Sep-2022 11:07               14086
language.variables.external.php                    30-Sep-2022 11:07               18225
language.variables.php                             30-Sep-2022 11:07                1682
language.variables.predefined.php                  30-Sep-2022 11:07                3147
language.variables.scope.php                       30-Sep-2022 11:07               31019
language.variables.superglobals.php                30-Sep-2022 11:07                4695
language.variables.variable.php                    30-Sep-2022 11:07               10860
ldap.configuration.php                             30-Sep-2022 11:08                2304
ldap.constants.php                                 30-Sep-2022 11:08               25953
ldap.controls.php                                  30-Sep-2022 11:08                9923
ldap.examples-basic.php                            30-Sep-2022 11:08                9474
ldap.examples-controls.php                         30-Sep-2022 11:08               19079
ldap.examples.php                                  30-Sep-2022 11:08                1389
ldap.installation.php                              30-Sep-2022 11:08                3314
ldap.requirements.php                              30-Sep-2022 11:08                1596
ldap.resources.php                                 30-Sep-2022 11:08                1495
ldap.setup.php                                     30-Sep-2022 11:08                1527
ldap.using.php                                     30-Sep-2022 11:08                2435
libxml.configuration.php                           30-Sep-2022 11:08                1183
libxml.constants.php                               30-Sep-2022 11:08               10554
libxml.installation.php                            30-Sep-2022 11:08                2624
libxml.requirements.php                            30-Sep-2022 11:08                1253
libxml.resources.php                               30-Sep-2022 11:08                1158
libxml.setup.php                                   30-Sep-2022 11:08                1538
limititerator.construct.php                        30-Sep-2022 11:07                7489
limititerator.current.php                          30-Sep-2022 11:07                3635
limititerator.getinneriterator.php                 30-Sep-2022 11:07                3122
limititerator.getposition.php                      30-Sep-2022 11:07                5977
limititerator.key.php                              30-Sep-2022 11:07                3709
limititerator.next.php                             30-Sep-2022 11:07                3393
limititerator.rewind.php                           30-Sep-2022 11:07                3573
limititerator.seek.php                             30-Sep-2022 11:07                4164
limititerator.valid.php                            30-Sep-2022 11:07                3506
locale.acceptfromhttp.php                          30-Sep-2022 11:07                5842
locale.canonicalize.php                            30-Sep-2022 11:07                2939
locale.composelocale.php                           30-Sep-2022 11:07               14171
locale.filtermatches.php                           30-Sep-2022 11:07                8710
locale.getallvariants.php                          30-Sep-2022 11:07                6244
locale.getdefault.php                              30-Sep-2022 11:07                5897
locale.getdisplaylanguage.php                      30-Sep-2022 11:07                9415
locale.getdisplayname.php                          30-Sep-2022 11:07               10779
locale.getdisplayregion.php                        30-Sep-2022 11:07                9371
locale.getdisplayscript.php                        30-Sep-2022 11:07                9378
locale.getdisplayvariant.php                       30-Sep-2022 11:07                9423
locale.getkeywords.php                             30-Sep-2022 11:07                7043
locale.getprimarylanguage.php                      30-Sep-2022 11:07                5716
locale.getregion.php                               30-Sep-2022 11:07                5663
locale.getscript.php                               30-Sep-2022 11:07                5400
locale.lookup.php                                  30-Sep-2022 11:07                9384
locale.parselocale.php                             30-Sep-2022 11:07                7354
locale.setdefault.php                              30-Sep-2022 11:07                5176
lua.assign.php                                     30-Sep-2022 11:07                4593
lua.call.php                                       30-Sep-2022 11:07                7489
lua.configuration.php                              30-Sep-2022 11:07                1162
lua.construct.php                                  30-Sep-2022 11:07                2355
lua.eval.php                                       30-Sep-2022 11:07                3750
lua.getversion.php                                 30-Sep-2022 11:07                2238
lua.include.php                                    30-Sep-2022 11:07                2689
lua.installation.php                               30-Sep-2022 11:07                2110
lua.registercallback.php                           30-Sep-2022 11:07                4536
lua.requirements.php                               30-Sep-2022 11:07                1322
lua.resources.php                                  30-Sep-2022 11:07                1144
lua.setup.php                                      30-Sep-2022 11:07                1483
luaclosure.invoke.php                              30-Sep-2022 11:07                4249
luasandbox.callfunction.php                        30-Sep-2022 11:07                4858
luasandbox.configuration.php                       30-Sep-2022 11:07                1211
luasandbox.disableprofiler.php                     30-Sep-2022 11:07                2843
luasandbox.enableprofiler.php                      30-Sep-2022 11:07                3376
luasandbox.examples-basic.php                      30-Sep-2022 11:07                7389
luasandbox.examples.php                            30-Sep-2022 11:07                1409
luasandbox.getcpuusage.php                         30-Sep-2022 11:07                3577
luasandbox.getmemoryusage.php                      30-Sep-2022 11:07                3155
luasandbox.getpeakmemoryusage.php                  30-Sep-2022 11:07                3205
luasandbox.getprofilerfunctionreport.php           30-Sep-2022 11:07                5626
luasandbox.getversioninfo.php                      30-Sep-2022 11:07                2907
luasandbox.installation.php                        30-Sep-2022 11:07                2204
luasandbox.loadbinary.php                          30-Sep-2022 11:07                3491
luasandbox.loadstring.php                          30-Sep-2022 11:07                5605
luasandbox.pauseusagetimer.php                     30-Sep-2022 11:07               10281
luasandbox.registerlibrary.php                     30-Sep-2022 11:07                6853
luasandbox.requirements.php                        30-Sep-2022 11:07                1731
luasandbox.resources.php                           30-Sep-2022 11:07                1209
luasandbox.setcpulimit.php                         30-Sep-2022 11:07                5979
luasandbox.setmemorylimit.php                      30-Sep-2022 11:07                5632
luasandbox.setup.php                               30-Sep-2022 11:07                1574
luasandbox.unpauseusagetimer.php                   30-Sep-2022 11:07                3139
luasandbox.wrapphpfunction.php                     30-Sep-2022 11:07                4309
luasandboxfunction.call.php                        30-Sep-2022 11:07                6840
luasandboxfunction.construct.php                   30-Sep-2022 11:07                2670
luasandboxfunction.dump.php                        30-Sep-2022 11:07                2366
lzf.configuration.php                              30-Sep-2022 11:07                1162
lzf.constants.php                                  30-Sep-2022 11:07                1082
lzf.installation.php                               30-Sep-2022 11:07                2687
lzf.requirements.php                               30-Sep-2022 11:07                1136
lzf.resources.php                                  30-Sep-2022 11:07                1137
lzf.setup.php                                      30-Sep-2022 11:07                1505
mail.configuration.php                             30-Sep-2022 11:07                7954
mail.constants.php                                 30-Sep-2022 11:07                1101
mail.installation.php                              30-Sep-2022 11:07                1203
mail.requirements.php                              30-Sep-2022 11:07                2078
mail.resources.php                                 30-Sep-2022 11:07                1144
mail.setup.php                                     30-Sep-2022 11:07                1525
mailparse.configuration.php                        30-Sep-2022 11:07                2435
mailparse.constants.php                            30-Sep-2022 11:07                1987
mailparse.installation.php                         30-Sep-2022 11:07                2767
mailparse.requirements.php                         30-Sep-2022 11:07                1178
mailparse.resources.php                            30-Sep-2022 11:07                1558
mailparse.setup.php                                30-Sep-2022 11:07                1584
manual.php                                         30-Sep-2022 11:07                1248
math.configuration.php                             30-Sep-2022 11:07                1169
math.constants.php                                 30-Sep-2022 11:07                5999
math.installation.php                              30-Sep-2022 11:07                1203
math.requirements.php                              30-Sep-2022 11:07                1143
math.resources.php                                 30-Sep-2022 11:07                1144
math.setup.php                                     30-Sep-2022 11:07                1512
mbstring.configuration.php                         30-Sep-2022 11:07               15630
mbstring.constants.php                             30-Sep-2022 11:07                6164
mbstring.encodings.php                             30-Sep-2022 11:07               16869
mbstring.http.php                                  30-Sep-2022 11:07                5705
mbstring.installation.php                          30-Sep-2022 11:07                3915
mbstring.ja-basic.php                              30-Sep-2022 11:07                4355
mbstring.overload.php                              30-Sep-2022 11:07                7587
mbstring.php4.req.php                              30-Sep-2022 11:07                4490
mbstring.requirements.php                          30-Sep-2022 11:07                1171
mbstring.resources.php                             30-Sep-2022 11:07                1172
mbstring.setup.php                                 30-Sep-2022 11:07                1598
mbstring.supported-encodings.php                   30-Sep-2022 11:07                8613
mcrypt.ciphers.php                                 30-Sep-2022 11:07                6666
mcrypt.configuration.php                           30-Sep-2022 11:07                3526
mcrypt.constants.php                               30-Sep-2022 11:07                6297
mcrypt.installation.php                            30-Sep-2022 11:07                1914
mcrypt.requirements.php                            30-Sep-2022 11:07                2334
mcrypt.resources.php                               30-Sep-2022 11:07                1267
mcrypt.setup.php                                   30-Sep-2022 11:07                1553
memcache.add.php                                   30-Sep-2022 11:08                7246
memcache.addserver.php                             30-Sep-2022 11:08               15054
memcache.close.php                                 30-Sep-2022 11:08                5351
memcache.connect.php                               30-Sep-2022 11:08                7783
memcache.constants.php                             30-Sep-2022 11:08                4449
memcache.decrement.php                             30-Sep-2022 11:08                7434
memcache.delete.php                                30-Sep-2022 11:08                6609
memcache.examples-overview.php                     30-Sep-2022 11:08                6838
memcache.examples.php                              30-Sep-2022 11:08                1356
memcache.flush.php                                 30-Sep-2022 11:08                4710
memcache.get.php                                   30-Sep-2022 11:08                8960
memcache.getextendedstats.php                      30-Sep-2022 11:08                8369
memcache.getserverstatus.php                       30-Sep-2022 11:08                6371
memcache.getstats.php                              30-Sep-2022 11:08                4819
memcache.getversion.php                            30-Sep-2022 11:08                5148
memcache.increment.php                             30-Sep-2022 11:08                7225
memcache.ini.php                                   30-Sep-2022 11:08               10392
memcache.installation.php                          30-Sep-2022 11:08                2352
memcache.pconnect.php                              30-Sep-2022 11:08                6618
memcache.replace.php                               30-Sep-2022 11:08                7335
memcache.requirements.php                          30-Sep-2022 11:08                1429
memcache.resources.php                             30-Sep-2022 11:08                1267
memcache.set.php                                   30-Sep-2022 11:08               10300
memcache.setcompressthreshold.php                  30-Sep-2022 11:08                5947
memcache.setserverparams.php                       30-Sep-2022 11:08               11636
memcache.setup.php                                 30-Sep-2022 11:08                1566
memcached.add.php                                  30-Sep-2022 11:08                4509
memcached.addbykey.php                             30-Sep-2022 11:08                5535
memcached.addserver.php                            30-Sep-2022 11:08                7880
memcached.addservers.php                           30-Sep-2022 11:08                5575
memcached.append.php                               30-Sep-2022 11:08                6965
memcached.appendbykey.php                          30-Sep-2022 11:08                4649
memcached.callbacks.php                            30-Sep-2022 11:08                1512
memcached.callbacks.read-through.php               30-Sep-2022 11:08                4923
memcached.callbacks.result.php                     30-Sep-2022 11:08                5211
memcached.cas.php                                  30-Sep-2022 11:08                9950
memcached.casbykey.php                             30-Sep-2022 11:08                5571
memcached.configuration.php                        30-Sep-2022 11:08               27900
memcached.constants.php                            30-Sep-2022 11:08               25628
memcached.construct.php                            30-Sep-2022 11:08                4554
memcached.decrement.php                            30-Sep-2022 11:08                8962
memcached.decrementbykey.php                       30-Sep-2022 11:08                5751
memcached.delete.php                               30-Sep-2022 11:08                6046
memcached.deletebykey.php                          30-Sep-2022 11:08                4929
memcached.deletemulti.php                          30-Sep-2022 11:08                5150
memcached.deletemultibykey.php                     30-Sep-2022 11:08                4989
memcached.expiration.php                           30-Sep-2022 11:08                2047
memcached.fetch.php                                30-Sep-2022 11:08                6647
memcached.fetchall.php                             30-Sep-2022 11:08                6550
memcached.flush.php                                30-Sep-2022 11:08                4745
memcached.get.php                                  30-Sep-2022 11:08               10568
memcached.getallkeys.php                           30-Sep-2022 11:08                2898
memcached.getbykey.php                             30-Sep-2022 11:08                6299
memcached.getdelayed.php                           30-Sep-2022 11:08                8592
memcached.getdelayedbykey.php                      30-Sep-2022 11:08                5414
memcached.getmulti.php                             30-Sep-2022 11:08               21597
memcached.getmultibykey.php                        30-Sep-2022 11:08                5617
memcached.getoption.php                            30-Sep-2022 11:08                5250
memcached.getresultcode.php                        30-Sep-2022 11:08                4315
memcached.getresultmessage.php                     30-Sep-2022 11:08                4764
memcached.getserverbykey.php                       30-Sep-2022 11:08                7394
memcached.getserverlist.php                        30-Sep-2022 11:08                4663
memcached.getstats.php                             30-Sep-2022 11:08                5213
memcached.getversion.php                           30-Sep-2022 11:08                3968
memcached.increment.php                            30-Sep-2022 11:08                8267
memcached.incrementbykey.php                       30-Sep-2022 11:08                5669
memcached.installation.php                         30-Sep-2022 11:08                3130
memcached.ispersistent.php                         30-Sep-2022 11:08                2941
memcached.ispristine.php                           30-Sep-2022 11:08                2904
memcached.prepend.php                              30-Sep-2022 11:08                7033
memcached.prependbykey.php                         30-Sep-2022 11:08                4715
memcached.quit.php                                 30-Sep-2022 11:08                2312
memcached.replace.php                              30-Sep-2022 11:08                4562
memcached.replacebykey.php                         30-Sep-2022 11:08                5612
memcached.requirements.php                         30-Sep-2022 11:08                1635
memcached.resetserverlist.php                      30-Sep-2022 11:08                3140
memcached.resources.php                            30-Sep-2022 11:08                1179
memcached.sessions.php                             30-Sep-2022 11:08                2686
memcached.set.php                                  30-Sep-2022 11:08                9293
memcached.setbykey.php                             30-Sep-2022 11:08                7054
memcached.setmulti.php                             30-Sep-2022 11:08                6320
memcached.setmultibykey.php                        30-Sep-2022 11:08                4902
memcached.setoption.php                            30-Sep-2022 11:08                7553
memcached.setoptions.php                           30-Sep-2022 11:08                7001
memcached.setsaslauthdata.php                      30-Sep-2022 11:08                3262
memcached.setup.php                                30-Sep-2022 11:08                1584
memcached.touch.php                                30-Sep-2022 11:08                3574
memcached.touchbykey.php                           30-Sep-2022 11:08                4525
messageformatter.create.php                        30-Sep-2022 11:07               11062
messageformatter.format.php                        30-Sep-2022 11:07               10004
messageformatter.formatmessage.php                 30-Sep-2022 11:07               10133
messageformatter.geterrorcode.php                  30-Sep-2022 11:07                3725
messageformatter.geterrormessage.php               30-Sep-2022 11:07                7889
messageformatter.getlocale.php                     30-Sep-2022 11:07                5486
messageformatter.getpattern.php                    30-Sep-2022 11:07               10475
messageformatter.parse.php                         30-Sep-2022 11:07                9821
messageformatter.parsemessage.php                  30-Sep-2022 11:07               10558
messageformatter.setpattern.php                    30-Sep-2022 11:07               10949
mhash.configuration.php                            30-Sep-2022 11:07                1176
mhash.constants.php                                30-Sep-2022 11:07                5001
mhash.examples.php                                 30-Sep-2022 11:07                3423
mhash.installation.php                             30-Sep-2022 11:07                1798
mhash.requirements.php                             30-Sep-2022 11:07                1379
mhash.resources.php                                30-Sep-2022 11:07                1151
mhash.setup.php                                    30-Sep-2022 11:07                1531
migration56.changed-functions.php                  30-Sep-2022 11:08                7163
migration56.constants.php                          30-Sep-2022 11:08                5244
migration56.deprecated.php                         30-Sep-2022 11:08                6499
migration56.extensions.php                         30-Sep-2022 11:08                4704
migration56.incompatible.php                       30-Sep-2022 11:08                9716
migration56.new-features.php                       30-Sep-2022 11:08               32315
migration56.new-functions.php                      30-Sep-2022 11:08                7525
migration56.openssl.php                            30-Sep-2022 11:08               28374
migration56.php                                    30-Sep-2022 11:08                2594
migration70.changed-functions.php                  30-Sep-2022 11:08                5739
migration70.classes.php                            30-Sep-2022 11:08                3951
migration70.constants.php                          30-Sep-2022 11:08                7111
migration70.deprecated.php                         30-Sep-2022 11:08                6256
migration70.incompatible.php                       30-Sep-2022 11:08               67191
migration70.new-features.php                       30-Sep-2022 11:08               46415
migration70.new-functions.php                      30-Sep-2022 11:08                7447
migration70.other-changes.php                      30-Sep-2022 11:08                3875
migration70.php                                    30-Sep-2022 11:08                3094
migration70.removed-exts-sapis.php                 30-Sep-2022 11:08                3211
migration70.sapi-changes.php                       30-Sep-2022 11:08                2280
migration71.changed-functions.php                  30-Sep-2022 11:08                7854
migration71.constants.php                          30-Sep-2022 11:08                7240
migration71.deprecated.php                         30-Sep-2022 11:08                2385
migration71.incompatible.php                       30-Sep-2022 11:08               35512
migration71.new-features.php                       30-Sep-2022 11:08               29986
migration71.new-functions.php                      30-Sep-2022 11:08                5045
migration71.other-changes.php                      30-Sep-2022 11:08                9330
migration71.php                                    30-Sep-2022 11:08                2613
migration71.windows-support.php                    30-Sep-2022 11:08                9272
migration72.constants.php                          30-Sep-2022 11:08               24704
migration72.deprecated.php                         30-Sep-2022 11:08               11069
migration72.incompatible.php                       30-Sep-2022 11:08               21747
migration72.new-features.php                       30-Sep-2022 11:08               20003
migration72.new-functions.php                      30-Sep-2022 11:08               24400
migration72.other-changes.php                      30-Sep-2022 11:08                6222
migration72.php                                    30-Sep-2022 11:08                2507
migration73.constants.php                          30-Sep-2022 11:08               17686
migration73.deprecated.php                         30-Sep-2022 11:08                9141
migration73.incompatible.php                       30-Sep-2022 11:08               21126
migration73.new-features.php                       30-Sep-2022 11:08               18333
migration73.new-functions.php                      30-Sep-2022 11:08                7360
migration73.other-changes.php                      30-Sep-2022 11:08               17563
migration73.php                                    30-Sep-2022 11:08                2635
migration73.windows-support.php                    30-Sep-2022 11:08                2184
migration74.constants.php                          30-Sep-2022 11:08                5916
migration74.deprecated.php                         30-Sep-2022 11:08               17090
migration74.incompatible.php                       30-Sep-2022 11:08               19756
migration74.new-classes.php                        30-Sep-2022 11:08                1535
migration74.new-features.php                       30-Sep-2022 11:08               24397
migration74.new-functions.php                      30-Sep-2022 11:08                3778
migration74.other-changes.php                      30-Sep-2022 11:08               23665
migration74.php                                    30-Sep-2022 11:08                2904
migration74.removed-extensions.php                 30-Sep-2022 11:08                2008
migration74.windows-support.php                    30-Sep-2022 11:08                4391
migration80.deprecated.php                         30-Sep-2022 11:08               20548
migration80.incompatible.php                       30-Sep-2022 11:08              110531
migration80.new-features.php                       30-Sep-2022 11:08               36682
migration80.other-changes.php                      30-Sep-2022 11:08               16575
migration80.php                                    30-Sep-2022 11:08                2480
migration81.constants.php                          30-Sep-2022 11:08                6330
migration81.deprecated.php                         30-Sep-2022 11:08               20232
migration81.incompatible.php                       30-Sep-2022 11:08               26453
migration81.new-classes.php                        30-Sep-2022 11:08                2171
migration81.new-features.php                       30-Sep-2022 11:08               26308
migration81.new-functions.php                      30-Sep-2022 11:08                8550
migration81.other-changes.php                      30-Sep-2022 11:08               11567
migration81.php                                    30-Sep-2022 11:08                2782
migration82.constants.php                          30-Sep-2022 11:08               16187
migration82.deprecated.php                         30-Sep-2022 11:08                7004
migration82.incompatible.php                       30-Sep-2022 11:08                9312
migration82.new-features.php                       30-Sep-2022 11:08                7963
migration82.new-functions.php                      30-Sep-2022 11:08                3444
migration82.other-changes.php                      30-Sep-2022 11:08               26617
migration82.php                                    30-Sep-2022 11:08                2813
migration82.windows-support.php                    30-Sep-2022 11:08                2543
misc.configuration.php                             30-Sep-2022 11:07                5375
misc.constants.php                                 30-Sep-2022 11:07                2133
misc.installation.php                              30-Sep-2022 11:07                1203
misc.requirements.php                              30-Sep-2022 11:07                1143
misc.resources.php                                 30-Sep-2022 11:07                1144
misc.setup.php                                     30-Sep-2022 11:07                1508
mongodb-bson-binary.construct.php                  30-Sep-2022 11:07                7100
mongodb-bson-binary.getdata.php                    30-Sep-2022 11:07                4686
mongodb-bson-binary.gettype.php                    30-Sep-2022 11:07                4670
mongodb-bson-binary.jsonserialize.php              30-Sep-2022 11:07                5539
mongodb-bson-binary.serialize.php                  30-Sep-2022 11:07                3494
mongodb-bson-binary.tostring.php                   30-Sep-2022 11:07                4468
mongodb-bson-binary.unserialize.php                30-Sep-2022 11:07                4328
mongodb-bson-binaryinterface.getdata.php           30-Sep-2022 11:07                2776
mongodb-bson-binaryinterface.gettype.php           30-Sep-2022 11:07                2788
mongodb-bson-binaryinterface.tostring.php          30-Sep-2022 11:07                3292
mongodb-bson-dbpointer.construct.php               30-Sep-2022 11:07                2667
mongodb-bson-dbpointer.jsonserialize.php           30-Sep-2022 11:07                5608
mongodb-bson-dbpointer.serialize.php               30-Sep-2022 11:07                3569
mongodb-bson-dbpointer.tostring.php                30-Sep-2022 11:07                2618
mongodb-bson-dbpointer.unserialize.php             30-Sep-2022 11:07                3797
mongodb-bson-decimal128.construct.php              30-Sep-2022 11:07                6211
mongodb-bson-decimal128.jsonserialize.php          30-Sep-2022 11:07                5629
mongodb-bson-decimal128.serialize.php              30-Sep-2022 11:07                3594
mongodb-bson-decimal128.tostring.php               30-Sep-2022 11:07                4948
mongodb-bson-decimal128.unserialize.php            30-Sep-2022 11:07                4420
mongodb-bson-decimal128interface.tostring.php      30-Sep-2022 11:07                2939
mongodb-bson-int64.construct.php                   30-Sep-2022 11:07                2615
mongodb-bson-int64.jsonserialize.php               30-Sep-2022 11:07                5283
mongodb-bson-int64.serialize.php                   30-Sep-2022 11:07                3471
mongodb-bson-int64.tostring.php                    30-Sep-2022 11:07                3852
mongodb-bson-int64.unserialize.php                 30-Sep-2022 11:07                4299
mongodb-bson-javascript.construct.php              30-Sep-2022 11:07                7200
mongodb-bson-javascript.getcode.php                30-Sep-2022 11:07                4534
mongodb-bson-javascript.getscope.php               30-Sep-2022 11:07                5602
mongodb-bson-javascript.jsonserialize.php          30-Sep-2022 11:07                5625
mongodb-bson-javascript.serialize.php              30-Sep-2022 11:07                3594
mongodb-bson-javascript.tostring.php               30-Sep-2022 11:07                4338
mongodb-bson-javascript.unserialize.php            30-Sep-2022 11:07                4412
mongodb-bson-javascriptinterface.getcode.php       30-Sep-2022 11:07                2870
mongodb-bson-javascriptinterface.getscope.php      30-Sep-2022 11:07                2979
mongodb-bson-javascriptinterface.tostring.php      30-Sep-2022 11:07                3390
mongodb-bson-maxkey.construct.php                  30-Sep-2022 11:07                3820
mongodb-bson-maxkey.jsonserialize.php              30-Sep-2022 11:07                5545
mongodb-bson-maxkey.serialize.php                  30-Sep-2022 11:07                3498
mongodb-bson-maxkey.unserialize.php                30-Sep-2022 11:07                3730
mongodb-bson-minkey.construct.php                  30-Sep-2022 11:07                3820
mongodb-bson-minkey.jsonserialize.php              30-Sep-2022 11:07                5545
mongodb-bson-minkey.serialize.php                  30-Sep-2022 11:07                3498
mongodb-bson-minkey.unserialize.php                30-Sep-2022 11:07                3734
mongodb-bson-objectid.construct.php                30-Sep-2022 11:07                5423
mongodb-bson-objectid.gettimestamp.php             30-Sep-2022 11:07                5778
mongodb-bson-objectid.jsonserialize.php            30-Sep-2022 11:07                5591
mongodb-bson-objectid.serialize.php                30-Sep-2022 11:07                3546
mongodb-bson-objectid.tostring.php                 30-Sep-2022 11:07                4440
mongodb-bson-objectid.unserialize.php              30-Sep-2022 11:07                4366
mongodb-bson-objectidinterface.gettimestamp.php    30-Sep-2022 11:07                2941
mongodb-bson-objectidinterface.tostring.php        30-Sep-2022 11:07                2923
mongodb-bson-regex.construct.php                   30-Sep-2022 11:07                6992
mongodb-bson-regex.getflags.php                    30-Sep-2022 11:07                4655
mongodb-bson-regex.getpattern.php                  30-Sep-2022 11:07                4502
mongodb-bson-regex.jsonserialize.php               30-Sep-2022 11:07                5524
mongodb-bson-regex.serialize.php                   30-Sep-2022 11:07                3469
mongodb-bson-regex.tostring.php                    30-Sep-2022 11:07                3978
mongodb-bson-regex.unserialize.php                 30-Sep-2022 11:07                4303
mongodb-bson-regexinterface.getflags.php           30-Sep-2022 11:07                2775
mongodb-bson-regexinterface.getpattern.php         30-Sep-2022 11:07                2818
mongodb-bson-regexinterface.tostring.php           30-Sep-2022 11:07                2849
mongodb-bson-serializable.bsonserialize.php        30-Sep-2022 11:07               16234
mongodb-bson-symbol.construct.php                  30-Sep-2022 11:07                2607
mongodb-bson-symbol.jsonserialize.php              30-Sep-2022 11:07                5545
mongodb-bson-symbol.serialize.php                  30-Sep-2022 11:07                3494
mongodb-bson-symbol.tostring.php                   30-Sep-2022 11:07                2596
mongodb-bson-symbol.unserialize.php                30-Sep-2022 11:07                3736
mongodb-bson-timestamp.construct.php               30-Sep-2022 11:07                4774
mongodb-bson-timestamp.getincrement.php            30-Sep-2022 11:07                4292
mongodb-bson-timestamp.gettimestamp.php            30-Sep-2022 11:07                4277
mongodb-bson-timestamp.jsonserialize.php           30-Sep-2022 11:07                5612
mongodb-bson-timestamp.serialize.php               30-Sep-2022 11:07                3569
mongodb-bson-timestamp.tostring.php                30-Sep-2022 11:07                4128
mongodb-bson-timestamp.unserialize.php             30-Sep-2022 11:07                4399
mongodb-bson-timestampinterface.getincrement.php   30-Sep-2022 11:07                3304
mongodb-bson-timestampinterface.gettimestamp.php   30-Sep-2022 11:07                3319
mongodb-bson-timestampinterface.tostring.php       30-Sep-2022 11:07                2941
mongodb-bson-undefined.construct.php               30-Sep-2022 11:07                2667
mongodb-bson-undefined.jsonserialize.php           30-Sep-2022 11:07                5608
mongodb-bson-undefined.serialize.php               30-Sep-2022 11:07                3569
mongodb-bson-undefined.tostring.php                30-Sep-2022 11:07                2618
mongodb-bson-undefined.unserialize.php             30-Sep-2022 11:07                3798
mongodb-bson-unserializable.bsonunserialize.php    30-Sep-2022 11:07                7538
mongodb-bson-utcdatetime.construct.php             30-Sep-2022 11:07                8154
mongodb-bson-utcdatetime.jsonserialize.php         30-Sep-2022 11:07                5650
mongodb-bson-utcdatetime.serialize.php             30-Sep-2022 11:07                3621
mongodb-bson-utcdatetime.todatetime.php            30-Sep-2022 11:07                6036
mongodb-bson-utcdatetime.tostring.php              30-Sep-2022 11:07                4071
mongodb-bson-utcdatetime.unserialize.php           30-Sep-2022 11:07                4431
mongodb-bson-utcdatetimeinterface.todatetime.php   30-Sep-2022 11:07                3278
mongodb-bson-utcdatetimeinterface.tostring.php     30-Sep-2022 11:07                2957
mongodb-driver-bulkwrite.construct.php             30-Sep-2022 11:07               20304
mongodb-driver-bulkwrite.count.php                 30-Sep-2022 11:07                7147
mongodb-driver-bulkwrite.delete.php                30-Sep-2022 11:07               12010
mongodb-driver-bulkwrite.insert.php                30-Sep-2022 11:07               10098
mongodb-driver-bulkwrite.update.php                30-Sep-2022 11:07               15267
mongodb-driver-clientencryption.construct.php      30-Sep-2022 11:07                8185
mongodb-driver-clientencryption.createdatakey.php  30-Sep-2022 11:07               10251
mongodb-driver-clientencryption.decrypt.php        30-Sep-2022 11:07                4284
mongodb-driver-clientencryption.encrypt.php        30-Sep-2022 11:07                9890
mongodb-driver-command.construct.php               30-Sep-2022 11:07               15453
mongodb-driver-commandexception.getresultdocume..> 30-Sep-2022 11:07                3191
mongodb-driver-cursor.construct.php                30-Sep-2022 11:07                3386
mongodb-driver-cursor.current.php                  30-Sep-2022 11:07                2870
mongodb-driver-cursor.getid.php                    30-Sep-2022 11:07                8390
mongodb-driver-cursor.getserver.php                30-Sep-2022 11:07                8038
mongodb-driver-cursor.isdead.php                   30-Sep-2022 11:07               11151
mongodb-driver-cursor.key.php                      30-Sep-2022 11:07                2590
mongodb-driver-cursor.next.php                     30-Sep-2022 11:07                3601
mongodb-driver-cursor.rewind.php                   30-Sep-2022 11:07                4036
mongodb-driver-cursor.settypemap.php               30-Sep-2022 11:07                8440
mongodb-driver-cursor.toarray.php                  30-Sep-2022 11:07                8135
mongodb-driver-cursor.valid.php                    30-Sep-2022 11:07                2688
mongodb-driver-cursorid.construct.php              30-Sep-2022 11:07                2829
mongodb-driver-cursorid.serialize.php              30-Sep-2022 11:07                3592
mongodb-driver-cursorid.tostring.php               30-Sep-2022 11:07                7535
mongodb-driver-cursorid.unserialize.php            30-Sep-2022 11:07                4438
mongodb-driver-cursorinterface.getid.php           30-Sep-2022 11:07                4090
mongodb-driver-cursorinterface.getserver.php       30-Sep-2022 11:07                4176
mongodb-driver-cursorinterface.isdead.php          30-Sep-2022 11:07                4022
mongodb-driver-cursorinterface.settypemap.php      30-Sep-2022 11:07                4019
mongodb-driver-cursorinterface.toarray.php         30-Sep-2022 11:07                3922
mongodb-driver-manager.addsubscriber.php           30-Sep-2022 11:07                5140
mongodb-driver-manager.construct.php               30-Sep-2022 11:07               72948
mongodb-driver-manager.createclientencryption.php  30-Sep-2022 11:07                9921
mongodb-driver-manager.executebulkwrite.php        30-Sep-2022 11:07               24174
mongodb-driver-manager.executecommand.php          30-Sep-2022 11:07               26514
mongodb-driver-manager.executequery.php            30-Sep-2022 11:07               17298
mongodb-driver-manager.executereadcommand.php      30-Sep-2022 11:07               10238
mongodb-driver-manager.executereadwritecommand.php 30-Sep-2022 11:07               11228
mongodb-driver-manager.executewritecommand.php     30-Sep-2022 11:07               11305
mongodb-driver-manager.getencryptedfieldsmap.php   30-Sep-2022 11:07                3733
mongodb-driver-manager.getreadconcern.php          30-Sep-2022 11:07                6268
mongodb-driver-manager.getreadpreference.php       30-Sep-2022 11:07                6863
mongodb-driver-manager.getservers.php              30-Sep-2022 11:07                8179
mongodb-driver-manager.getwriteconcern.php         30-Sep-2022 11:07                6321
mongodb-driver-manager.removesubscriber.php        30-Sep-2022 11:07                5000
mongodb-driver-manager.selectserver.php            30-Sep-2022 11:07                7134
mongodb-driver-manager.startsession.php            30-Sep-2022 11:07               11952
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                3702
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                3797
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                3686
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                4856
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                3996
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                4268
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                4254
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                3906
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:07                3748
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:07                4003
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:07                3734
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:07                3636
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:07                5180
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:07                4744
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:07                4560
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:07                3926
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:07                3768
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:07                4965
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:07                5015
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:07                5030
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:07                3759
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:07                3866
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:07                4943
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:07                4053
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:07                4331
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:07                4789
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:07                3966
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:07                3794
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:07                4833
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:07                4803
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:07                5370
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:07                5415
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:07                5446
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:07                4833
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:07                4908
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:07                4845
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:07                4828
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:07                3160
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:07                3536
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:07                3230
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:07                3613
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:07                3336
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:07                3122
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:07                3174
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:07                3292
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:07                3610
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:07                3520
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:07                3297
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:07                3328
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:07                3579
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:07                3302
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:07                3346
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:07                3599
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:07                3662
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:07                3369
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:07                3380
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:07                4190
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:07                3615
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:07                3140
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:07                3192
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:07                3324
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:07                3605
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:07                3683
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:07                3344
mongodb-driver-monitoring-topologyclosedevent.g..> 30-Sep-2022 11:07                3289
mongodb-driver-monitoring-topologyopeningevent...> 30-Sep-2022 11:07                3299
mongodb-driver-query.construct.php                 30-Sep-2022 11:07               31946
mongodb-driver-readconcern.bsonserialize.php       30-Sep-2022 11:07                7818
mongodb-driver-readconcern.construct.php           30-Sep-2022 11:07                6536
mongodb-driver-readconcern.getlevel.php            30-Sep-2022 11:07                6464
mongodb-driver-readconcern.isdefault.php           30-Sep-2022 11:07                8742
mongodb-driver-readconcern.serialize.php           30-Sep-2022 11:07                3669
mongodb-driver-readconcern.unserialize.php         30-Sep-2022 11:07                4489
mongodb-driver-readpreference.bsonserialize.php    30-Sep-2022 11:07               12476
mongodb-driver-readpreference.construct.php        30-Sep-2022 11:07               18300
mongodb-driver-readpreference.gethedge.php         30-Sep-2022 11:07                3354
mongodb-driver-readpreference.getmaxstalenessse..> 30-Sep-2022 11:07                9638
mongodb-driver-readpreference.getmode.php          30-Sep-2022 11:07                8983
mongodb-driver-readpreference.getmodestring.php    30-Sep-2022 11:07                9187
mongodb-driver-readpreference.gettagsets.php       30-Sep-2022 11:07                9184
mongodb-driver-readpreference.serialize.php        30-Sep-2022 11:07                3746
mongodb-driver-readpreference.unserialize.php      30-Sep-2022 11:07                4568
mongodb-driver-runtimeexception.haserrorlabel.php  30-Sep-2022 11:07                4156
mongodb-driver-server.construct.php                30-Sep-2022 11:07                3388
mongodb-driver-server.executebulkwrite.php         30-Sep-2022 11:07               11147
mongodb-driver-server.executecommand.php           30-Sep-2022 11:07               13148
mongodb-driver-server.executequery.php             30-Sep-2022 11:07                8407
mongodb-driver-server.executereadcommand.php       30-Sep-2022 11:07               10562
mongodb-driver-server.executereadwritecommand.php  30-Sep-2022 11:07               11742
mongodb-driver-server.executewritecommand.php      30-Sep-2022 11:07               11785
mongodb-driver-server.gethost.php                  30-Sep-2022 11:07                5905
mongodb-driver-server.getinfo.php                  30-Sep-2022 11:07               10943
mongodb-driver-server.getlatency.php               30-Sep-2022 11:07                7438
mongodb-driver-server.getport.php                  30-Sep-2022 11:07                5949
mongodb-driver-server.getserverdescription.php     30-Sep-2022 11:07                3460
mongodb-driver-server.gettags.php                  30-Sep-2022 11:07                3597
mongodb-driver-server.gettype.php                  30-Sep-2022 11:07                3708
mongodb-driver-server.isarbiter.php                30-Sep-2022 11:07                3522
mongodb-driver-server.ishidden.php                 30-Sep-2022 11:07                3516
mongodb-driver-server.ispassive.php                30-Sep-2022 11:07                3584
mongodb-driver-server.isprimary.php                30-Sep-2022 11:07                3529
mongodb-driver-server.issecondary.php              30-Sep-2022 11:07                3564
mongodb-driver-serverapi.bsonserialize.php         30-Sep-2022 11:07                3296
mongodb-driver-serverapi.construct.php             30-Sep-2022 11:07                3128
mongodb-driver-serverapi.serialize.php             30-Sep-2022 11:07                3622
mongodb-driver-serverapi.unserialize.php           30-Sep-2022 11:07                4456
mongodb-driver-serverdescription.gethellorespon..> 30-Sep-2022 11:07                5216
mongodb-driver-serverdescription.gethost.php       30-Sep-2022 11:07                3433
mongodb-driver-serverdescription.getlastupdatet..> 30-Sep-2022 11:07                3579
mongodb-driver-serverdescription.getport.php       30-Sep-2022 11:07                3490
mongodb-driver-serverdescription.getroundtripti..> 30-Sep-2022 11:07                3833
mongodb-driver-serverdescription.gettype.php       30-Sep-2022 11:07                3703
mongodb-driver-session.aborttransaction.php        30-Sep-2022 11:07                4268
mongodb-driver-session.advanceclustertime.php      30-Sep-2022 11:07                4784
mongodb-driver-session.advanceoperationtime.php    30-Sep-2022 11:07                4842
mongodb-driver-session.committransaction.php       30-Sep-2022 11:07                5676
mongodb-driver-session.construct.php               30-Sep-2022 11:07                2896
mongodb-driver-session.endsession.php              30-Sep-2022 11:07                4402
mongodb-driver-session.getclustertime.php          30-Sep-2022 11:07                3803
mongodb-driver-session.getlogicalsessionid.php     30-Sep-2022 11:07                3110
mongodb-driver-session.getoperationtime.php        30-Sep-2022 11:07                3943
mongodb-driver-session.getserver.php               30-Sep-2022 11:07                3827
mongodb-driver-session.gettransactionoptions.php   30-Sep-2022 11:07                3653
mongodb-driver-session.gettransactionstate.php     30-Sep-2022 11:07                3735
mongodb-driver-session.isdirty.php                 30-Sep-2022 11:07                2996
mongodb-driver-session.isintransaction.php         30-Sep-2022 11:07                3680
mongodb-driver-session.starttransaction.php        30-Sep-2022 11:07                9061
mongodb-driver-topologydescription.getservers.php  30-Sep-2022 11:07                3439
mongodb-driver-topologydescription.gettype.php     30-Sep-2022 11:07                3365
mongodb-driver-topologydescription.hasreadables..> 30-Sep-2022 11:07                3844
mongodb-driver-topologydescription.haswritables..> 30-Sep-2022 11:07                3206
mongodb-driver-writeconcern.bsonserialize.php      30-Sep-2022 11:07                8273
mongodb-driver-writeconcern.construct.php          30-Sep-2022 11:07               10673
mongodb-driver-writeconcern.getjournal.php         30-Sep-2022 11:07                6383
mongodb-driver-writeconcern.getw.php               30-Sep-2022 11:07                5579
mongodb-driver-writeconcern.getwtimeout.php        30-Sep-2022 11:07                6327
mongodb-driver-writeconcern.isdefault.php          30-Sep-2022 11:07                8241
mongodb-driver-writeconcern.serialize.php          30-Sep-2022 11:07                3694
mongodb-driver-writeconcern.unserialize.php        30-Sep-2022 11:07                4528
mongodb-driver-writeconcernerror.getcode.php       30-Sep-2022 11:07                7065
mongodb-driver-writeconcernerror.getinfo.php       30-Sep-2022 11:07                7282
mongodb-driver-writeconcernerror.getmessage.php    30-Sep-2022 11:07                7154
mongodb-driver-writeerror.getcode.php              30-Sep-2022 11:07                6240
mongodb-driver-writeerror.getindex.php             30-Sep-2022 11:07                6777
mongodb-driver-writeerror.getinfo.php              30-Sep-2022 11:07                3000
mongodb-driver-writeerror.getmessage.php           30-Sep-2022 11:07                6374
mongodb-driver-writeexception.getwriteresult.php   30-Sep-2022 11:07                8747
mongodb-driver-writeresult.getdeletedcount.php     30-Sep-2022 11:07                8493
mongodb-driver-writeresult.getinsertedcount.php    30-Sep-2022 11:07                8575
mongodb-driver-writeresult.getmatchedcount.php     30-Sep-2022 11:07                9153
mongodb-driver-writeresult.getmodifiedcount.php    30-Sep-2022 11:07                9400
mongodb-driver-writeresult.getserver.php           30-Sep-2022 11:07                7201
mongodb-driver-writeresult.getupsertedcount.php    30-Sep-2022 11:07                8730
mongodb-driver-writeresult.getupsertedids.php      30-Sep-2022 11:07                9278
mongodb-driver-writeresult.getwriteconcernerror..> 30-Sep-2022 11:07                7909
mongodb-driver-writeresult.getwriteerrors.php      30-Sep-2022 11:07               14540
mongodb-driver-writeresult.isacknowledged.php      30-Sep-2022 11:07                8867
mongodb.architecture.php                           30-Sep-2022 11:07                1922
mongodb.configuration.php                          30-Sep-2022 11:07                3849
mongodb.connection-handling.php                    30-Sep-2022 11:07                9592
mongodb.constants.php                              30-Sep-2022 11:07                1888
mongodb.exceptions.php                             30-Sep-2022 11:07                5149
mongodb.exceptions.tree.php                        30-Sep-2022 11:07                5559
mongodb.installation.homebrew.php                  30-Sep-2022 11:07                1987
mongodb.installation.manual.php                    30-Sep-2022 11:07                6522
mongodb.installation.pecl.php                      30-Sep-2022 11:07                3728
mongodb.installation.php                           30-Sep-2022 11:07                1778
mongodb.installation.windows.php                   30-Sep-2022 11:07                3184
mongodb.monitoring.php                             30-Sep-2022 11:07               18561
mongodb.overview.php                               30-Sep-2022 11:07                7234
mongodb.persistence.deserialization.php            30-Sep-2022 11:07               20739
mongodb.persistence.php                            30-Sep-2022 11:07                1797
mongodb.persistence.serialization.php              30-Sep-2022 11:07               23894
mongodb.requirements.php                           30-Sep-2022 11:07                3113
mongodb.security.php                               30-Sep-2022 11:07                1484
mongodb.security.request_injection.php             30-Sep-2022 11:07                3004
mongodb.security.script_injection.php              30-Sep-2022 11:07               10544
mongodb.setup.php                                  30-Sep-2022 11:07                2006
mongodb.tutorial.apm.php                           30-Sep-2022 11:07               24275
mongodb.tutorial.library.php                       30-Sep-2022 11:07               11315
mongodb.tutorial.php                               30-Sep-2022 11:07                1692
mqseries.configure.php                             30-Sep-2022 11:08                3231
mqseries.constants.php                             30-Sep-2022 11:08                2226
mqseries.ini.php                                   30-Sep-2022 11:08                1265
mqseries.requirements.php                          30-Sep-2022 11:08                1714
mqseries.resources.php                             30-Sep-2022 11:08                1723
mqseries.setup.php                                 30-Sep-2022 11:08                1570
multipleiterator.attachiterator.php                30-Sep-2022 11:07                4308
multipleiterator.construct.php                     30-Sep-2022 11:07                8250
multipleiterator.containsiterator.php              30-Sep-2022 11:07                3457
multipleiterator.countiterators.php                30-Sep-2022 11:07                3190
multipleiterator.current.php                       30-Sep-2022 11:07                4836
multipleiterator.detachiterator.php                30-Sep-2022 11:07                3291
multipleiterator.getflags.php                      30-Sep-2022 11:07                3276
multipleiterator.key.php                           30-Sep-2022 11:07                4710
multipleiterator.next.php                          30-Sep-2022 11:07                3009
multipleiterator.rewind.php                        30-Sep-2022 11:07                3027
multipleiterator.setflags.php                      30-Sep-2022 11:07                3572
multipleiterator.valid.php                         30-Sep-2022 11:07                3072
mysql-xdevapi-baseresult.getwarnings.php           30-Sep-2022 11:07                7197
mysql-xdevapi-baseresult.getwarningscount.php      30-Sep-2022 11:07                6848
mysql-xdevapi-client.close.php                     30-Sep-2022 11:07                2397
mysql-xdevapi-client.construct.php                 30-Sep-2022 11:07                3648
mysql-xdevapi-client.getsession.php                30-Sep-2022 11:07                2501
mysql-xdevapi-collection.add.php                   30-Sep-2022 11:07               10480
mysql-xdevapi-collection.addorreplaceone.php       30-Sep-2022 11:07                9099
mysql-xdevapi-collection.construct.php             30-Sep-2022 11:07                6874
mysql-xdevapi-collection.count.php                 30-Sep-2022 11:07                6997
mysql-xdevapi-collection.createindex.php           30-Sep-2022 11:07               10707
mysql-xdevapi-collection.dropindex.php             30-Sep-2022 11:07                7060
mysql-xdevapi-collection.existsindatabase.php      30-Sep-2022 11:07                6505
mysql-xdevapi-collection.find.php                  30-Sep-2022 11:07               10466
mysql-xdevapi-collection.getname.php               30-Sep-2022 11:07                5298
mysql-xdevapi-collection.getone.php                30-Sep-2022 11:07                7636
mysql-xdevapi-collection.getschema.php             30-Sep-2022 11:07                5570
mysql-xdevapi-collection.getsession.php            30-Sep-2022 11:07                5841
mysql-xdevapi-collection.modify.php                30-Sep-2022 11:07                8816
mysql-xdevapi-collection.remove.php                30-Sep-2022 11:07                9107
mysql-xdevapi-collection.removeone.php             30-Sep-2022 11:07                8270
mysql-xdevapi-collection.replaceone.php            30-Sep-2022 11:07                8596
mysql-xdevapi-collectionadd.construct.php          30-Sep-2022 11:07                8562
mysql-xdevapi-collectionadd.execute.php            30-Sep-2022 11:07                8445
mysql-xdevapi-collectionfind.bind.php              30-Sep-2022 11:07                8600
mysql-xdevapi-collectionfind.construct.php         30-Sep-2022 11:07                7322
mysql-xdevapi-collectionfind.execute.php           30-Sep-2022 11:07                7533
mysql-xdevapi-collectionfind.fields.php            30-Sep-2022 11:07                7927
mysql-xdevapi-collectionfind.groupby.php           30-Sep-2022 11:07                4430
mysql-xdevapi-collectionfind.having.php            30-Sep-2022 11:07                4580
mysql-xdevapi-collectionfind.limit.php             30-Sep-2022 11:07                8612
mysql-xdevapi-collectionfind.lockexclusive.php     30-Sep-2022 11:07                6922
mysql-xdevapi-collectionfind.lockshared.php        30-Sep-2022 11:07                6754
mysql-xdevapi-collectionfind.offset.php            30-Sep-2022 11:07                8416
mysql-xdevapi-collectionfind.sort.php              30-Sep-2022 11:07                8444
mysql-xdevapi-collectionmodify.arrayappend.php     30-Sep-2022 11:07                8478
mysql-xdevapi-collectionmodify.arrayinsert.php     30-Sep-2022 11:07                8987
mysql-xdevapi-collectionmodify.bind.php            30-Sep-2022 11:07                8732
mysql-xdevapi-collectionmodify.construct.php       30-Sep-2022 11:07                7228
mysql-xdevapi-collectionmodify.execute.php         30-Sep-2022 11:07                3329
mysql-xdevapi-collectionmodify.limit.php           30-Sep-2022 11:07                9066
mysql-xdevapi-collectionmodify.patch.php           30-Sep-2022 11:07                4334
mysql-xdevapi-collectionmodify.replace.php         30-Sep-2022 11:07                8276
mysql-xdevapi-collectionmodify.set.php             30-Sep-2022 11:07                8198
mysql-xdevapi-collectionmodify.skip.php            30-Sep-2022 11:07                4937
mysql-xdevapi-collectionmodify.sort.php            30-Sep-2022 11:07                4950
mysql-xdevapi-collectionmodify.unset.php           30-Sep-2022 11:07                4576
mysql-xdevapi-collectionremove.bind.php            30-Sep-2022 11:07                5393
mysql-xdevapi-collectionremove.construct.php       30-Sep-2022 11:07                7751
mysql-xdevapi-collectionremove.execute.php         30-Sep-2022 11:07                4145
mysql-xdevapi-collectionremove.limit.php           30-Sep-2022 11:07                4554
mysql-xdevapi-collectionremove.sort.php            30-Sep-2022 11:07                4633
mysql-xdevapi-columnresult.construct.php           30-Sep-2022 11:07               10091
mysql-xdevapi-columnresult.getcharactersetname.php 30-Sep-2022 11:07                3303
mysql-xdevapi-columnresult.getcollationname.php    30-Sep-2022 11:07                3272
mysql-xdevapi-columnresult.getcolumnlabel.php      30-Sep-2022 11:07                3246
mysql-xdevapi-columnresult.getcolumnname.php       30-Sep-2022 11:07                3233
mysql-xdevapi-columnresult.getfractionaldigits.php 30-Sep-2022 11:07                3346
mysql-xdevapi-columnresult.getlength.php           30-Sep-2022 11:07                3204
mysql-xdevapi-columnresult.getschemaname.php       30-Sep-2022 11:07                3292
mysql-xdevapi-columnresult.gettablelabel.php       30-Sep-2022 11:07                3226
mysql-xdevapi-columnresult.gettablename.php        30-Sep-2022 11:07                3264
mysql-xdevapi-columnresult.gettype.php             30-Sep-2022 11:07                3147
mysql-xdevapi-columnresult.isnumbersigned.php      30-Sep-2022 11:07                3468
mysql-xdevapi-columnresult.ispadded.php            30-Sep-2022 11:07                3300
mysql-xdevapi-crudoperationbindable.bind.php       30-Sep-2022 11:07                5899
mysql-xdevapi-crudoperationlimitable.limit.php     30-Sep-2022 11:07                5969
mysql-xdevapi-crudoperationskippable.skip.php      30-Sep-2022 11:07                4642
mysql-xdevapi-crudoperationsortable.sort.php       30-Sep-2022 11:07                4736
mysql-xdevapi-databaseobject.existsindatabase.php  30-Sep-2022 11:07                3658
mysql-xdevapi-databaseobject.getname.php           30-Sep-2022 11:07                3546
mysql-xdevapi-databaseobject.getsession.php        30-Sep-2022 11:07                3642
mysql-xdevapi-docresult.construct.php              30-Sep-2022 11:07                7888
mysql-xdevapi-docresult.fetchall.php               30-Sep-2022 11:07                8345
mysql-xdevapi-docresult.fetchone.php               30-Sep-2022 11:07                7950
mysql-xdevapi-docresult.getwarnings.php            30-Sep-2022 11:07                9051
mysql-xdevapi-docresult.getwarningscount.php       30-Sep-2022 11:07                8821
mysql-xdevapi-executable.execute.php               30-Sep-2022 11:07                6882
mysql-xdevapi-executionstatus.construct.php        30-Sep-2022 11:07                3022
mysql-xdevapi-expression.construct.php             30-Sep-2022 11:07                3100
mysql-xdevapi-result.construct.php                 30-Sep-2022 11:07                7404
mysql-xdevapi-result.getaffecteditemscount.php     30-Sep-2022 11:07                6185
mysql-xdevapi-result.getautoincrementvalue.php     30-Sep-2022 11:07                7767
mysql-xdevapi-result.getgeneratedids.php           30-Sep-2022 11:07                7096
mysql-xdevapi-result.getwarnings.php               30-Sep-2022 11:07                7076
mysql-xdevapi-result.getwarningscount.php          30-Sep-2022 11:07                6667
mysql-xdevapi-rowresult.construct.php              30-Sep-2022 11:07                5069
mysql-xdevapi-rowresult.fetchall.php               30-Sep-2022 11:07                6807
mysql-xdevapi-rowresult.fetchone.php               30-Sep-2022 11:07                6986
mysql-xdevapi-rowresult.getcolumncount.php         30-Sep-2022 11:07                6289
mysql-xdevapi-rowresult.getcolumnnames.php         30-Sep-2022 11:07                6327
mysql-xdevapi-rowresult.getcolumns.php             30-Sep-2022 11:07                7292
mysql-xdevapi-rowresult.getwarnings.php            30-Sep-2022 11:07                7105
mysql-xdevapi-rowresult.getwarningscount.php       30-Sep-2022 11:07                6727
mysql-xdevapi-schema.construct.php                 30-Sep-2022 11:07                5622
mysql-xdevapi-schema.createcollection.php          30-Sep-2022 11:07               10553
mysql-xdevapi-schema.dropcollection.php            30-Sep-2022 11:07                6714
mysql-xdevapi-schema.existsindatabase.php          30-Sep-2022 11:07                6758
mysql-xdevapi-schema.getcollection.php             30-Sep-2022 11:07                5777
mysql-xdevapi-schema.getcollectionastable.php      30-Sep-2022 11:07                7501
mysql-xdevapi-schema.getcollections.php            30-Sep-2022 11:07                6587
mysql-xdevapi-schema.getname.php                   30-Sep-2022 11:07                4906
mysql-xdevapi-schema.getsession.php                30-Sep-2022 11:07                5438
mysql-xdevapi-schema.gettable.php                  30-Sep-2022 11:07                6966
mysql-xdevapi-schema.gettables.php                 30-Sep-2022 11:07                7237
mysql-xdevapi-schemaobject.getschema.php           30-Sep-2022 11:07                4207
mysql-xdevapi-session.close.php                    30-Sep-2022 11:07                4025
mysql-xdevapi-session.commit.php                   30-Sep-2022 11:07                4846
mysql-xdevapi-session.construct.php                30-Sep-2022 11:07                3201
mysql-xdevapi-session.createschema.php             30-Sep-2022 11:07                5093
mysql-xdevapi-session.dropschema.php               30-Sep-2022 11:07                4162
mysql-xdevapi-session.generateuuid.php             30-Sep-2022 11:07                4005
mysql-xdevapi-session.getdefaultschema.php         30-Sep-2022 11:07                4246
mysql-xdevapi-session.getschema.php                30-Sep-2022 11:07                4408
mysql-xdevapi-session.getschemas.php               30-Sep-2022 11:07                4201
mysql-xdevapi-session.getserverversion.php         30-Sep-2022 11:07                4085
mysql-xdevapi-session.listclients.php              30-Sep-2022 11:07                4391
mysql-xdevapi-session.quotename.php                30-Sep-2022 11:07                5483
mysql-xdevapi-session.releasesavepoint.php         30-Sep-2022 11:07                5784
mysql-xdevapi-session.rollback.php                 30-Sep-2022 11:07                5480
mysql-xdevapi-session.rollbackto.php               30-Sep-2022 11:07                5928
mysql-xdevapi-session.setsavepoint.php             30-Sep-2022 11:07                6158
mysql-xdevapi-session.sql.php                      30-Sep-2022 11:07                4079
mysql-xdevapi-session.starttransaction.php         30-Sep-2022 11:07                5545
mysql-xdevapi-sqlstatement.bind.php                30-Sep-2022 11:07                3403
mysql-xdevapi-sqlstatement.construct.php           30-Sep-2022 11:07                2961
mysql-xdevapi-sqlstatement.execute.php             30-Sep-2022 11:07                3230
mysql-xdevapi-sqlstatement.getnextresult.php       30-Sep-2022 11:07                3294
mysql-xdevapi-sqlstatement.getresult.php           30-Sep-2022 11:07                3262
mysql-xdevapi-sqlstatement.hasmoreresults.php      30-Sep-2022 11:07                3374
mysql-xdevapi-sqlstatementresult.construct.php     30-Sep-2022 11:07                3087
mysql-xdevapi-sqlstatementresult.fetchall.php      30-Sep-2022 11:07                7258
mysql-xdevapi-sqlstatementresult.fetchone.php      30-Sep-2022 11:07                7060
mysql-xdevapi-sqlstatementresult.getaffectedite..> 30-Sep-2022 11:07                3433
mysql-xdevapi-sqlstatementresult.getcolumncount..> 30-Sep-2022 11:07                4028
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 30-Sep-2022 11:07                3343
mysql-xdevapi-sqlstatementresult.getcolumns.php    30-Sep-2022 11:07                3301
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 30-Sep-2022 11:07                3502
mysql-xdevapi-sqlstatementresult.getlastinserti..> 30-Sep-2022 11:07                3428