Index of /php.ihc-ru.net/manual/es/


../
feeds/                                             26-Sep-2022 04:11                   -
images/                                            26-Sep-2022 04:11                   -
styles/                                            26-Sep-2022 04:10                   -
toc/                                               26-Sep-2022 04:11                   -
about.formats.php                                  26-Sep-2022 04:11                4402
about.generate.php                                 26-Sep-2022 04:11                2686
about.howtohelp.php                                26-Sep-2022 04:11                3484
about.more.php                                     26-Sep-2022 04:11                1896
about.notes.php                                    26-Sep-2022 04:11                2431
about.php                                          26-Sep-2022 04:11                1920
about.phpversions.php                              26-Sep-2022 04:11                3650
about.prototypes.php                               26-Sep-2022 04:11                7224
about.translations.php                             26-Sep-2022 04:11                3331
aliases.php                                        26-Sep-2022 04:11               32812
apache.configuration.php                           26-Sep-2022 04:10                5195
apache.constants.php                               26-Sep-2022 04:10                1140
apache.installation.php                            26-Sep-2022 04:10                1272
apache.requirements.php                            26-Sep-2022 04:10                1222
apache.resources.php                               26-Sep-2022 04:10                1226
apache.setup.php                                   26-Sep-2022 04:10                1628
apcu.configuration.php                             26-Sep-2022 04:10               14493
apcu.constants.php                                 26-Sep-2022 04:10                5334
apcu.installation.php                              26-Sep-2022 04:10                2880
apcu.requirements.php                              26-Sep-2022 04:10                1208
apcu.resources.php                                 26-Sep-2022 04:10                1212
apcu.setup.php                                     26-Sep-2022 04:10                1589
apcuiterator.construct.php                         26-Sep-2022 04:10                6852
apcuiterator.current.php                           26-Sep-2022 04:10                3021
apcuiterator.gettotalcount.php                     26-Sep-2022 04:10                3224
apcuiterator.gettotalhits.php                      26-Sep-2022 04:10                3333
apcuiterator.gettotalsize.php                      26-Sep-2022 04:10                3093
apcuiterator.key.php                               26-Sep-2022 04:10                2710
apcuiterator.next.php                              26-Sep-2022 04:10                2928
apcuiterator.rewind.php                            26-Sep-2022 04:10                2691
apcuiterator.valid.php                             26-Sep-2022 04:10                2816
appendices.php                                     26-Sep-2022 04:11               11594
appenditerator.append.php                          26-Sep-2022 04:10                5511
appenditerator.construct.php                       26-Sep-2022 04:10               10782
appenditerator.current.php                         26-Sep-2022 04:10                3507
appenditerator.getarrayiterator.php                26-Sep-2022 04:10                3187
appenditerator.getinneriterator.php                26-Sep-2022 04:10                6845
appenditerator.getiteratorindex.php                26-Sep-2022 04:10                6716
appenditerator.key.php                             26-Sep-2022 04:10                8226
appenditerator.next.php                            26-Sep-2022 04:10                3391
appenditerator.rewind.php                          26-Sep-2022 04:10                3378
appenditerator.valid.php                           26-Sep-2022 04:10                3231
array.configuration.php                            26-Sep-2022 04:10                1287
array.constants.php                                26-Sep-2022 04:10                8712
array.installation.php                             26-Sep-2022 04:10                1259
array.requirements.php                             26-Sep-2022 04:10                1215
array.resources.php                                26-Sep-2022 04:10                1219
array.setup.php                                    26-Sep-2022 04:10                1593
array.sorting.php                                  26-Sep-2022 04:10                6851
arrayaccess.offsetexists.php                       26-Sep-2022 04:10                9324
arrayaccess.offsetget.php                          26-Sep-2022 04:10                5118
arrayaccess.offsetset.php                          26-Sep-2022 04:10                5247
arrayaccess.offsetunset.php                        26-Sep-2022 04:10                2871
arrayiterator.append.php                           26-Sep-2022 04:10                3546
arrayiterator.asort.php                            26-Sep-2022 04:10                3203
arrayiterator.construct.php                        26-Sep-2022 04:10                4415
arrayiterator.count.php                            26-Sep-2022 04:10                2844
arrayiterator.current.php                          26-Sep-2022 04:10                5407
arrayiterator.getarraycopy.php                     26-Sep-2022 04:10                2987
arrayiterator.getflags.php                         26-Sep-2022 04:10                2798
arrayiterator.key.php                              26-Sep-2022 04:10                3830
arrayiterator.ksort.php                            26-Sep-2022 04:10                3198
arrayiterator.natcasesort.php                      26-Sep-2022 04:10                3582
arrayiterator.natsort.php                          26-Sep-2022 04:10                3477
arrayiterator.next.php                             26-Sep-2022 04:10                4699
arrayiterator.offsetexists.php                     26-Sep-2022 04:10                3246
arrayiterator.offsetget.php                        26-Sep-2022 04:10                3502
arrayiterator.offsetset.php                        26-Sep-2022 04:10                3770
arrayiterator.offsetunset.php                      26-Sep-2022 04:10                3395
arrayiterator.rewind.php                           26-Sep-2022 04:10                4641
arrayiterator.seek.php                             26-Sep-2022 04:10                2527
arrayiterator.serialize.php                        26-Sep-2022 04:10                2820
arrayiterator.setflags.php                         26-Sep-2022 04:10                3399
arrayiterator.uasort.php                           26-Sep-2022 04:10                3364
arrayiterator.uksort.php                           26-Sep-2022 04:10                3365
arrayiterator.unserialize.php                      26-Sep-2022 04:10                3109
arrayiterator.valid.php                            26-Sep-2022 04:10                4538
arrayobject.append.php                             26-Sep-2022 04:10                5529
arrayobject.asort.php                              26-Sep-2022 04:10                6458
arrayobject.construct.php                          26-Sep-2022 04:10                7145
arrayobject.count.php                              26-Sep-2022 04:10                5497
arrayobject.exchangearray.php                      26-Sep-2022 04:10                6188
arrayobject.getarraycopy.php                       26-Sep-2022 04:10                5338
arrayobject.getflags.php                           26-Sep-2022 04:10                6177
arrayobject.getiterator.php                        26-Sep-2022 04:10                5554
arrayobject.getiteratorclass.php                   26-Sep-2022 04:10                6822
arrayobject.ksort.php                              26-Sep-2022 04:10                6230
arrayobject.natcasesort.php                        26-Sep-2022 04:10                7172
arrayobject.natsort.php                            26-Sep-2022 04:10                7038
arrayobject.offsetexists.php                       26-Sep-2022 04:10                4831
arrayobject.offsetget.php                          26-Sep-2022 04:10                5130
arrayobject.offsetset.php                          26-Sep-2022 04:10                6931
arrayobject.offsetunset.php                        26-Sep-2022 04:10                4267
arrayobject.serialize.php                          26-Sep-2022 04:10                5123
arrayobject.setflags.php                           26-Sep-2022 04:10                6908
arrayobject.setiteratorclass.php                   26-Sep-2022 04:10                5954
arrayobject.uasort.php                             26-Sep-2022 04:10                9109
arrayobject.uksort.php                             26-Sep-2022 04:10                8546
arrayobject.unserialize.php                        26-Sep-2022 04:10                3645
bc.configuration.php                               26-Sep-2022 04:10                2514
bc.constants.php                                   26-Sep-2022 04:10                1114
bc.installation.php                                26-Sep-2022 04:10                1446
bc.requirements.php                                26-Sep-2022 04:10                1194
bc.resources.php                                   26-Sep-2022 04:10                1198
bc.setup.php                                       26-Sep-2022 04:10                1585
book.apache.php                                    26-Sep-2022 04:10                3460
book.apcu.php                                      26-Sep-2022 04:10                4575
book.array.php                                     26-Sep-2022 04:10               12935
book.bc.php                                        26-Sep-2022 04:10                3203
book.bson.php                                      26-Sep-2022 04:10               19849
book.bzip2.php                                     26-Sep-2022 04:10                3072
book.calendar.php                                  26-Sep-2022 04:10                4285
book.classobj.php                                  26-Sep-2022 04:10                4558
book.cmark.php                                     26-Sep-2022 04:10                8770
book.com.php                                       26-Sep-2022 04:11                7760
book.componere.php                                 26-Sep-2022 04:10                6408
book.csprng.php                                    26-Sep-2022 04:10                2244
book.ctype.php                                     26-Sep-2022 04:10                3339
book.cubrid.php                                    26-Sep-2022 04:10               15306
book.curl.php                                      26-Sep-2022 04:10                6792
book.datetime.php                                  26-Sep-2022 04:10               16674
book.dba.php                                       26-Sep-2022 04:10                3618
book.dbase.php                                     26-Sep-2022 04:10                3422
book.dio.php                                       26-Sep-2022 04:10                3190
book.dir.php                                       26-Sep-2022 04:10                3245
book.dom.php                                       26-Sep-2022 04:11               17608
book.ds.php                                        26-Sep-2022 04:10               25107
book.eio.php                                       26-Sep-2022 04:10                8926
book.enchant.php                                   26-Sep-2022 04:10                5482
book.errorfunc.php                                 26-Sep-2022 04:10                3662
book.ev.php                                        26-Sep-2022 04:10               13460
book.event.php                                     26-Sep-2022 04:10               23292
book.exec.php                                      26-Sep-2022 04:10                3424
book.exif.php                                      26-Sep-2022 04:10                2593
book.expect.php                                    26-Sep-2022 04:10                2524
book.fann.php                                      26-Sep-2022 04:10               25782
book.fdf.php                                       26-Sep-2022 04:10                6097
book.ffi.php                                       26-Sep-2022 04:10                5660
book.fileinfo.php                                  26-Sep-2022 04:10                3167
book.filesystem.php                                26-Sep-2022 04:10               10722
book.filter.php                                    26-Sep-2022 04:10                3532
book.fpm.php                                       26-Sep-2022 04:10                2007
book.ftp.php                                       26-Sep-2022 04:10                6152
book.funchand.php                                  26-Sep-2022 04:10                3873
book.gearman.php                                   26-Sep-2022 04:10               16777
book.gender.php                                    26-Sep-2022 04:10                2651
book.geoip.php                                     26-Sep-2022 04:10                4855
book.gettext.php                                   26-Sep-2022 04:10                3036
book.gmagick.php                                   26-Sep-2022 04:10               24603
book.gmp.php                                       26-Sep-2022 04:10                6794
book.gnupg.php                                     26-Sep-2022 04:10                5066
book.hash.php                                      26-Sep-2022 04:10                3914
book.hrtime.php                                    26-Sep-2022 04:10                3577
book.ibase.php                                     26-Sep-2022 04:10               12733
book.ibm-db2.php                                   26-Sep-2022 04:10                9120
book.iconv.php                                     26-Sep-2022 04:10                3435
book.igbinary.php                                  26-Sep-2022 04:10                2155
book.image.php                                     26-Sep-2022 04:10               16840
book.imagick.php                                   26-Sep-2022 04:10               67901
book.imap.php                                      26-Sep-2022 04:10               10891
book.info.php                                      26-Sep-2022 04:10                8529
book.inotify.php                                   26-Sep-2022 04:10                2630
book.intl.php                                      26-Sep-2022 04:10               49106
book.json.php                                      26-Sep-2022 04:10                2798
book.ldap.php                                      26-Sep-2022 04:10                9295
book.libxml.php                                    26-Sep-2022 04:11                3104
book.lua.php                                       26-Sep-2022 04:10                2724
book.luasandbox.php                                26-Sep-2022 04:10                5587
book.lzf.php                                       26-Sep-2022 04:10                2246
book.mail.php                                      26-Sep-2022 04:10                2102
book.mailparse.php                                 26-Sep-2022 04:10                4127
book.math.php                                      26-Sep-2022 04:10                6366
book.mbstring.php                                  26-Sep-2022 04:10               11110
book.mcrypt.php                                    26-Sep-2022 04:10                6795
book.memcache.php                                  26-Sep-2022 04:10                4469
book.memcached.php                                 26-Sep-2022 04:10                9167
book.mhash.php                                     26-Sep-2022 04:10                2545
book.misc.php                                      26-Sep-2022 04:10                5526
book.mongodb.php                                   26-Sep-2022 04:10               25449
book.mqseries.php                                  26-Sep-2022 04:10                3192
book.mysql-xdevapi.php                             26-Sep-2022 04:10               29013
book.mysql.php                                     26-Sep-2022 04:10                8450
book.mysqli.php                                    26-Sep-2022 04:10               19331
book.mysqlnd.php                                   26-Sep-2022 04:10                2642
book.network.php                                   26-Sep-2022 04:10                6247
book.oauth.php                                     26-Sep-2022 04:11                7600
book.oci8.php                                      26-Sep-2022 04:10               17836
book.opcache.php                                   26-Sep-2022 04:10                2710
book.openal.php                                    26-Sep-2022 04:10                4631
book.openssl.php                                   26-Sep-2022 04:10               10945
book.outcontrol.php                                26-Sep-2022 04:10                4554
book.parallel.php                                  26-Sep-2022 04:10                5702
book.parle.php                                     26-Sep-2022 04:10                8809
book.password.php                                  26-Sep-2022 04:10                2688
book.pcntl.php                                     26-Sep-2022 04:10                5078
book.pcre.php                                      26-Sep-2022 04:10                4134
book.pdo.php                                       26-Sep-2022 04:10                8541
book.pgsql.php                                     26-Sep-2022 04:10               12395
book.phar.php                                      26-Sep-2022 04:10               17317
book.phpdbg.php                                    26-Sep-2022 04:10                2936
book.posix.php                                     26-Sep-2022 04:10                6674
book.ps.php                                        26-Sep-2022 04:10               10372
book.pspell.php                                    26-Sep-2022 04:10                4594
book.pthreads.php                                  26-Sep-2022 04:10                5484
book.quickhash.php                                 26-Sep-2022 04:10                8921
book.radius.php                                    26-Sep-2022 04:10                5595
book.rar.php                                       26-Sep-2022 04:10                5647
book.readline.php                                  26-Sep-2022 04:10                3835
book.recode.php                                    26-Sep-2022 04:10                2390
book.reflection.php                                26-Sep-2022 04:11               34349
book.rpminfo.php                                   26-Sep-2022 04:10                2417
book.rrd.php                                       26-Sep-2022 04:10                5519
book.runkit7.php                                   26-Sep-2022 04:10                4447
book.scoutapm.php                                  26-Sep-2022 04:10                2204
book.seaslog.php                                   26-Sep-2022 04:10                5192
book.sem.php                                       26-Sep-2022 04:10                4087
book.session.php                                   26-Sep-2022 04:10                8326
book.shmop.php                                     26-Sep-2022 04:10                2866
book.simplexml.php                                 26-Sep-2022 04:11                5698
book.snmp.php                                      26-Sep-2022 04:10                5880
book.soap.php                                      26-Sep-2022 04:11                6442
book.sockets.php                                   26-Sep-2022 04:10                7113
book.sodium.php                                    26-Sep-2022 04:10               17350
book.solr.php                                      26-Sep-2022 04:10               56350
book.spl.php                                       26-Sep-2022 04:10               10137
book.sqlite3.php                                   26-Sep-2022 04:10                7621
book.sqlsrv.php                                    26-Sep-2022 04:10                5586
book.ssdeep.php                                    26-Sep-2022 04:10                2343
book.ssh2.php                                      26-Sep-2022 04:10                5543
book.stats.php                                     26-Sep-2022 04:10               11828
book.stomp.php                                     26-Sep-2022 04:10                4381
book.stream.php                                    26-Sep-2022 04:10               12403
book.strings.php                                   26-Sep-2022 04:10               14211
book.svm.php                                       26-Sep-2022 04:10                3704
book.svn.php                                       26-Sep-2022 04:10                8761
book.swoole.php                                    26-Sep-2022 04:10               37339
book.sync.php                                      26-Sep-2022 04:10                4798
book.taint.php                                     26-Sep-2022 04:10                2585
book.tcpwrap.php                                   26-Sep-2022 04:10                2074
book.tidy.php                                      26-Sep-2022 04:10                6847
book.tokenizer.php                                 26-Sep-2022 04:10                2313
book.trader.php                                    26-Sep-2022 04:10               18995
book.ui.php                                        26-Sep-2022 04:11               28750
book.uodbc.php                                     26-Sep-2022 04:10                7164
book.uopz.php                                      26-Sep-2022 04:10                5106
book.url.php                                       26-Sep-2022 04:10                3069
book.v8js.php                                      26-Sep-2022 04:10                3153
book.var.php                                       26-Sep-2022 04:11                5961
book.var_representation.php                        26-Sep-2022 04:10                2127
book.varnish.php                                   26-Sep-2022 04:10                5895
book.wddx.php                                      26-Sep-2022 04:11                2863
book.win32service.php                              26-Sep-2022 04:11                5035
book.wincache.php                                  26-Sep-2022 04:10                5813
book.wkhtmltox.php                                 26-Sep-2022 04:10                3387
book.xattr.php                                     26-Sep-2022 04:10                2513
book.xdiff.php                                     26-Sep-2022 04:10                4332
book.xhprof.php                                    26-Sep-2022 04:10                2484
book.xlswriter.php                                 26-Sep-2022 04:10                4406
book.xml.php                                       26-Sep-2022 04:11                5854
book.xmldiff.php                                   26-Sep-2022 04:11                3184
book.xmlreader.php                                 26-Sep-2022 04:11                5107
book.xmlrpc.php                                    26-Sep-2022 04:11                3974
book.xmlwriter.php                                 26-Sep-2022 04:11                7408
book.xsl.php                                       26-Sep-2022 04:11                3963
book.yac.php                                       26-Sep-2022 04:10                2680
book.yaconf.php                                    26-Sep-2022 04:10                2169
book.yaf.php                                       26-Sep-2022 04:10               37413
book.yaml.php                                      26-Sep-2022 04:10                2908
book.yar.php                                       26-Sep-2022 04:11                3778
book.yaz.php                                       26-Sep-2022 04:10                4716
book.zip.php                                       26-Sep-2022 04:10               10690
book.zlib.php                                      26-Sep-2022 04:10                5297
book.zmq.php                                       26-Sep-2022 04:10                5900
book.zookeeper.php                                 26-Sep-2022 04:10                6670
bzip2.configuration.php                            26-Sep-2022 04:10                1287
bzip2.constants.php                                26-Sep-2022 04:10                1126
bzip2.examples.php                                 26-Sep-2022 04:10                4337
bzip2.installation.php                             26-Sep-2022 04:10                1389
bzip2.requirements.php                             26-Sep-2022 04:10                1366
bzip2.resources.php                                26-Sep-2022 04:10                1274
bzip2.setup.php                                    26-Sep-2022 04:10                1614
cachingiterator.construct.php                      26-Sep-2022 04:10                2770
cachingiterator.count.php                          26-Sep-2022 04:10                2445
cachingiterator.current.php                        26-Sep-2022 04:10                2780
cachingiterator.getcache.php                       26-Sep-2022 04:10                5642
cachingiterator.getflags.php                       26-Sep-2022 04:10                2466
cachingiterator.getinneriterator.php               26-Sep-2022 04:10                2581
cachingiterator.hasnext.php                        26-Sep-2022 04:10                2499
cachingiterator.key.php                            26-Sep-2022 04:10                2215
cachingiterator.next.php                           26-Sep-2022 04:10                2390
cachingiterator.offsetexists.php                   26-Sep-2022 04:10                2900
cachingiterator.offsetget.php                      26-Sep-2022 04:10                2621
cachingiterator.offsetset.php                      26-Sep-2022 04:10                3148
cachingiterator.offsetunset.php                    26-Sep-2022 04:10                2671
cachingiterator.rewind.php                         26-Sep-2022 04:10                2401
cachingiterator.setflags.php                       26-Sep-2022 04:10                2708
cachingiterator.tostring.php                       26-Sep-2022 04:10                2592
cachingiterator.valid.php                          26-Sep-2022 04:10                2522
calendar.configuration.php                         26-Sep-2022 04:10                1308
calendar.constants.php                             26-Sep-2022 04:10                6003
calendar.installation.php                          26-Sep-2022 04:10                1493
calendar.requirements.php                          26-Sep-2022 04:10                1236
calendar.resources.php                             26-Sep-2022 04:10                1240
calendar.setup.php                                 26-Sep-2022 04:10                1654
callbackfilteriterator.accept.php                  26-Sep-2022 04:10                3357
callbackfilteriterator.construct.php               26-Sep-2022 04:10                4171
cc.license.php                                     26-Sep-2022 04:11               21030
changelog.misc.php                                 26-Sep-2022 04:10                3470
changelog.mysql.php                                26-Sep-2022 04:10                5431
changelog.mysql_xdevapi.php                        26-Sep-2022 04:10                2298
changelog.mysqli.php                               26-Sep-2022 04:10                3231
changelog.strings.php                              26-Sep-2022 04:10               13672
class.apcuiterator.php                             26-Sep-2022 04:10                6746
class.appenditerator.php                           26-Sep-2022 04:10                8662
class.argumentcounterror.php                       26-Sep-2022 04:10                5696
class.arithmeticerror.php                          26-Sep-2022 04:10                6022
class.arrayaccess.php                              26-Sep-2022 04:10               13274
class.arrayiterator.php                            26-Sep-2022 04:10               15380
class.arrayobject.php                              26-Sep-2022 04:10               15702
class.assertionerror.php                           26-Sep-2022 04:10                5709
class.badfunctioncallexception.php                 26-Sep-2022 04:10                5840
class.badmethodcallexception.php                   26-Sep-2022 04:10                5859
class.cachingiterator.php                          26-Sep-2022 04:10               14193
class.callbackfilteriterator.php                   26-Sep-2022 04:10               11180
class.closure.php                                  26-Sep-2022 04:10                6350
class.collator.php                                 26-Sep-2022 04:10               29089
class.collectable.php                              26-Sep-2022 04:10                2449
class.com-exception.php                            26-Sep-2022 04:11                5679
class.com.php                                      26-Sep-2022 04:11               21862
class.commonmark-cql.php                           26-Sep-2022 04:10                7574
class.commonmark-interfaces-ivisitable.php         26-Sep-2022 04:10                2896
class.commonmark-interfaces-ivisitor.php           26-Sep-2022 04:10                4261
class.commonmark-node-blockquote.php               26-Sep-2022 04:10                8242
class.commonmark-node-bulletlist.php               26-Sep-2022 04:10               10138
class.commonmark-node-code.php                     26-Sep-2022 04:10                9116
class.commonmark-node-codeblock.php                26-Sep-2022 04:10               10325
class.commonmark-node-customblock.php              26-Sep-2022 04:10                8871
class.commonmark-node-custominline.php             26-Sep-2022 04:10                8851
class.commonmark-node-document.php                 26-Sep-2022 04:10                8200
class.commonmark-node-heading.php                  26-Sep-2022 04:10                9486
class.commonmark-node-htmlblock.php                26-Sep-2022 04:10                9174
class.commonmark-node-htmlinline.php               26-Sep-2022 04:10                9150
class.commonmark-node-image.php                    26-Sep-2022 04:10               10210
class.commonmark-node-item.php                     26-Sep-2022 04:10                8209
class.commonmark-node-linebreak.php                26-Sep-2022 04:10                8223
class.commonmark-node-link.php                     26-Sep-2022 04:10               10203
class.commonmark-node-orderedlist.php              26-Sep-2022 04:10               10864
class.commonmark-node-paragraph.php                26-Sep-2022 04:10                8248
class.commonmark-node-softbreak.php                26-Sep-2022 04:10                8241
class.commonmark-node-text-emphasis.php            26-Sep-2022 04:10                8270
class.commonmark-node-text-strong.php              26-Sep-2022 04:10                8259
class.commonmark-node-text.php                     26-Sep-2022 04:10                9520
class.commonmark-node-thematicbreak.php            26-Sep-2022 04:10                8270
class.commonmark-node.php                          26-Sep-2022 04:10                9221
class.commonmark-parser.php                        26-Sep-2022 04:10                3648
class.compersisthelper.php                         26-Sep-2022 04:11                6506
class.compileerror.php                             26-Sep-2022 04:10                5621
class.componere-abstract-definition.php            26-Sep-2022 04:10                4610
class.componere-definition.php                     26-Sep-2022 04:10                9351
class.componere-method.php                         26-Sep-2022 04:10                4380
class.componere-patch.php                          26-Sep-2022 04:10                7777
class.componere-value.php                          26-Sep-2022 04:10                5345
class.countable.php                                26-Sep-2022 04:10                2571
class.curlfile.php                                 26-Sep-2022 04:10                6623
class.dateinterval.php                             26-Sep-2022 04:10                8211
class.dateperiod.php                               26-Sep-2022 04:10               10393
class.datetime.php                                 26-Sep-2022 04:10               19100
class.datetimeimmutable.php                        26-Sep-2022 04:10               18325
class.datetimeinterface.php                        26-Sep-2022 04:10               14119
class.datetimezone.php                             26-Sep-2022 04:10               13110
class.deflatecontext.php                           26-Sep-2022 04:10                1851
class.directory.php                                26-Sep-2022 04:10                5222
class.directoryiterator.php                        26-Sep-2022 04:10               14823
class.divisionbyzeroerror.php                      26-Sep-2022 04:10                5694
class.domainexception.php                          26-Sep-2022 04:10                5753
class.domattr.php                                  26-Sep-2022 04:11               18833
class.domcdatasection.php                          26-Sep-2022 04:11               19697
class.domcharacterdata.php                         26-Sep-2022 04:11               19566
class.domcomment.php                               26-Sep-2022 04:11               18723
class.domdocument.php                              26-Sep-2022 04:11               40900
class.domdocumentfragment.php                      26-Sep-2022 04:11               15550
class.domdocumenttype.php                          26-Sep-2022 04:11               13877
class.domelement.php                               26-Sep-2022 04:11               22919
class.domentity.php                                26-Sep-2022 04:11               13611
class.domentityreference.php                       26-Sep-2022 04:11               10365
class.domexception.php                             26-Sep-2022 04:11                5466
class.domimplementation.php                        26-Sep-2022 04:11                5478
class.domnamednodemap.php                          26-Sep-2022 04:11                4919
class.domnode.php                                  26-Sep-2022 04:11               22811
class.domnodelist.php                              26-Sep-2022 04:11                4004
class.domnotation.php                              26-Sep-2022 04:11               10615
class.domprocessinginstruction.php                 26-Sep-2022 04:11               11683
class.domtext.php                                  26-Sep-2022 04:11               12978
class.domxpath.php                                 26-Sep-2022 04:11                6279
class.dotnet.php                                   26-Sep-2022 04:11                4934
class.ds-collection.php                            26-Sep-2022 04:10                5122
class.ds-deque.php                                 26-Sep-2022 04:10               20937
class.ds-hashable.php                              26-Sep-2022 04:10                4140
class.ds-map.php                                   26-Sep-2022 04:10               22050
class.ds-pair.php                                  26-Sep-2022 04:10                3549
class.ds-priorityqueue.php                         26-Sep-2022 04:10                7925
class.ds-queue.php                                 26-Sep-2022 04:10                7551
class.ds-sequence.php                              26-Sep-2022 04:10               19174
class.ds-set.php                                   26-Sep-2022 04:10               18024
class.ds-stack.php                                 26-Sep-2022 04:10                6931
class.ds-vector.php                                26-Sep-2022 04:10               20363
class.emptyiterator.php                            26-Sep-2022 04:10                4084
class.error.php                                    26-Sep-2022 04:10                8419
class.errorexception.php                           26-Sep-2022 04:10               11780
class.ev.php                                       26-Sep-2022 04:10               38876
class.evcheck.php                                  26-Sep-2022 04:10               10084
class.evchild.php                                  26-Sep-2022 04:10               11534
class.evembed.php                                  26-Sep-2022 04:10                9266
class.event.php                                    26-Sep-2022 04:10               17111
class.eventbase.php                                26-Sep-2022 04:10               13553
class.eventbuffer.php                              26-Sep-2022 04:10               20311
class.eventbufferevent.php                         26-Sep-2022 04:10               33490
class.eventconfig.php                              26-Sep-2022 04:10                6843
class.eventdnsbase.php                             26-Sep-2022 04:10               10184
class.eventhttp.php                                26-Sep-2022 04:10                8499
class.eventhttpconnection.php                      26-Sep-2022 04:10                9471
class.eventhttprequest.php                         26-Sep-2022 04:10               19867
class.eventlistener.php                            26-Sep-2022 04:10               11616
class.eventsslcontext.php                          26-Sep-2022 04:10               16462
class.eventutil.php                                26-Sep-2022 04:10               22343
class.evfork.php                                   26-Sep-2022 04:10                8229
class.evidle.php                                   26-Sep-2022 04:10                9261
class.evio.php                                     26-Sep-2022 04:10               11935
class.evloop.php                                   26-Sep-2022 04:10               29231
class.evperiodic.php                               26-Sep-2022 04:10               13915
class.evprepare.php                                26-Sep-2022 04:10               10253
class.evsignal.php                                 26-Sep-2022 04:10               10962
class.evstat.php                                   26-Sep-2022 04:10               13347
class.evtimer.php                                  26-Sep-2022 04:10               13326
class.evwatcher.php                                26-Sep-2022 04:10                9204
class.exception.php                                26-Sep-2022 04:10                8992
class.fannconnection.php                           26-Sep-2022 04:10                6165
class.ffi-cdata.php                                26-Sep-2022 04:10                5469
class.ffi-ctype.php                                26-Sep-2022 04:10                7857
class.ffi-exception.php                            26-Sep-2022 04:10                5455
class.ffi-parserexception.php                      26-Sep-2022 04:10                5511
class.ffi.php                                      26-Sep-2022 04:10               17754
class.filesystemiterator.php                       26-Sep-2022 04:10               21236
class.filteriterator.php                           26-Sep-2022 04:10                6024
class.finfo.php                                    26-Sep-2022 04:10                4640
class.gearmanclient.php                            26-Sep-2022 04:10               30621
class.gearmanexception.php                         26-Sep-2022 04:10                5694
class.gearmanjob.php                               26-Sep-2022 04:10               10219
class.gearmantask.php                              26-Sep-2022 04:10                8382
class.gearmanworker.php                            26-Sep-2022 04:10               11849
class.gender.php                                   26-Sep-2022 04:10               33234
class.generator.php                                26-Sep-2022 04:10                6562
class.globiterator.php                             26-Sep-2022 04:10               10024
class.gmagick.php                                  26-Sep-2022 04:10               77474
class.gmagickdraw.php                              26-Sep-2022 04:10               21886
class.gmagickpixel.php                             26-Sep-2022 04:10                5222
class.gmp.php                                      26-Sep-2022 04:10                2329
class.hrtime-performancecounter.php                26-Sep-2022 04:10                3567
class.hrtime-stopwatch.php                         26-Sep-2022 04:10                6315
class.hrtime-unit.php                              26-Sep-2022 04:10                3966
class.imagick.php                                  26-Sep-2022 04:10              240043
class.imagickdraw.php                              26-Sep-2022 04:10               66174
class.imagickkernel.php                            26-Sep-2022 04:10                5696
class.imagickpixel.php                             26-Sep-2022 04:10               10790
class.imagickpixeliterator.php                     26-Sep-2022 04:10                8188
class.infiniteiterator.php                         26-Sep-2022 04:10                5810
class.inflatecontext.php                           26-Sep-2022 04:10                1828
class.intlbreakiterator.php                        26-Sep-2022 04:10               25008
class.intlcalendar.php                             26-Sep-2022 04:10               76489
class.intlchar.php                                 26-Sep-2022 04:10              345940
class.intlcodepointbreakiterator.php               26-Sep-2022 04:10               22423
class.intldateformatter.php                        26-Sep-2022 04:10               18161
class.intlexception.php                            26-Sep-2022 04:10                5904
class.intliterator.php                             26-Sep-2022 04:10                5216
class.intlpartsiterator.php                        26-Sep-2022 04:10                6988
class.intlrulebasedbreakiterator.php               26-Sep-2022 04:10               24816
class.intltimezone.php                             26-Sep-2022 04:10               17834
class.invalidargumentexception.php                 26-Sep-2022 04:10                5768
class.iterator.php                                 26-Sep-2022 04:10               12132
class.iteratoraggregate.php                        26-Sep-2022 04:10                6520
class.iteratoriterator.php                         26-Sep-2022 04:10                5952
class.jsonserializable.php                         26-Sep-2022 04:10                2912
class.lengthexception.php                          26-Sep-2022 04:10                5708
class.libxmlerror.php                              26-Sep-2022 04:11                5168
class.limititerator.php                            26-Sep-2022 04:10               10130
class.locale.php                                   26-Sep-2022 04:10               20275
class.logicexception.php                           26-Sep-2022 04:10                5783
class.lua.php                                      26-Sep-2022 04:10                7262
class.luaclosure.php                               26-Sep-2022 04:10                2674
class.luasandbox.php                               26-Sep-2022 04:10               12420
class.luasandboxerror.php                          26-Sep-2022 04:10                7690
class.luasandboxerrorerror.php                     26-Sep-2022 04:10                5727
class.luasandboxfatalerror.php                     26-Sep-2022 04:10                5849
class.luasandboxfunction.php                       26-Sep-2022 04:10                3640
class.luasandboxmemoryerror.php                    26-Sep-2022 04:10                6055
class.luasandboxruntimeerror.php                   26-Sep-2022 04:10                5869
class.luasandboxsyntaxerror.php                    26-Sep-2022 04:10                5731
class.luasandboxtimeouterror.php                   26-Sep-2022 04:10                6039
class.memcache.php                                 26-Sep-2022 04:10               15286
class.memcached.php                                26-Sep-2022 04:10               36553
class.memcachedexception.php                       26-Sep-2022 04:10                5689
class.messageformatter.php                         26-Sep-2022 04:10               10719
class.mongodb-bson-binary.php                      26-Sep-2022 04:10                9292
class.mongodb-bson-binaryinterface.php             26-Sep-2022 04:10                4497
class.mongodb-bson-dbpointer.php                   26-Sep-2022 04:10                5802
class.mongodb-bson-decimal128.php                  26-Sep-2022 04:10                7442
class.mongodb-bson-decimal128interface.php         26-Sep-2022 04:10                3742
class.mongodb-bson-int64.php                       26-Sep-2022 04:10                6528
class.mongodb-bson-javascript.php                  26-Sep-2022 04:10                5853
class.mongodb-bson-javascriptinterface.php         26-Sep-2022 04:10                4669
class.mongodb-bson-maxkey.php                      26-Sep-2022 04:10                4109
class.mongodb-bson-maxkeyinterface.php             26-Sep-2022 04:10                2153
class.mongodb-bson-minkey.php                      26-Sep-2022 04:10                4101
class.mongodb-bson-minkeyinterface.php             26-Sep-2022 04:10                2134
class.mongodb-bson-objectid.php                    26-Sep-2022 04:10                5399
class.mongodb-bson-objectidinterface.php           26-Sep-2022 04:10                4174
class.mongodb-bson-persistable.php                 26-Sep-2022 04:10                4619
class.mongodb-bson-regex.php                       26-Sep-2022 04:10                5528
class.mongodb-bson-regexinterface.php              26-Sep-2022 04:10                4514
class.mongodb-bson-serializable.php                26-Sep-2022 04:10                3081
class.mongodb-bson-symbol.php                      26-Sep-2022 04:10                5690
class.mongodb-bson-timestamp.php                   26-Sep-2022 04:10                5913
class.mongodb-bson-timestampinterface.php          26-Sep-2022 04:10                4676
class.mongodb-bson-type.php                        26-Sep-2022 04:10                1769
class.mongodb-bson-undefined.php                   26-Sep-2022 04:10                5778
class.mongodb-bson-unserializable.php              26-Sep-2022 04:10                3128
class.mongodb-bson-utcdatetime.php                 26-Sep-2022 04:10                5728
class.mongodb-bson-utcdatetimeinterface.php        26-Sep-2022 04:10                4305
class.mongodb-driver-bulkwrite.php                 26-Sep-2022 04:10               25584
class.mongodb-driver-clientencryption.php          26-Sep-2022 04:10                6879
class.mongodb-driver-command.php                   26-Sep-2022 04:10               15859
class.mongodb-driver-cursor.php                    26-Sep-2022 04:10               27598
class.mongodb-driver-cursorid.php                  26-Sep-2022 04:10                5285
class.mongodb-driver-cursorinterface.php           26-Sep-2022 04:10                5191
class.mongodb-driver-exception-authenticationex..> 26-Sep-2022 04:10                7118
class.mongodb-driver-exception-bulkwriteexcepti..> 26-Sep-2022 04:10                7965
class.mongodb-driver-exception-commandexception..> 26-Sep-2022 04:10                8755
class.mongodb-driver-exception-connectionexcept..> 26-Sep-2022 04:10                7180
class.mongodb-driver-exception-connectiontimeou..> 26-Sep-2022 04:10                7568
class.mongodb-driver-exception-encryptionexcept..> 26-Sep-2022 04:10                7114
class.mongodb-driver-exception-exception.php       26-Sep-2022 04:10                2155
class.mongodb-driver-exception-executiontimeout..> 26-Sep-2022 04:10                8231
class.mongodb-driver-exception-invalidargumente..> 26-Sep-2022 04:10                6317
class.mongodb-driver-exception-logicexception.php  26-Sep-2022 04:10                6201
class.mongodb-driver-exception-runtimeexception..> 26-Sep-2022 04:10                9636
class.mongodb-driver-exception-serverexception.php 26-Sep-2022 04:10                7191
class.mongodb-driver-exception-sslconnectionexc..> 26-Sep-2022 04:10                7462
class.mongodb-driver-exception-unexpectedvaluee..> 26-Sep-2022 04:10                6334
class.mongodb-driver-exception-writeexception.php  26-Sep-2022 04:10               10154
class.mongodb-driver-manager.php                   26-Sep-2022 04:10               18264
class.mongodb-driver-monitoring-commandfailedev..> 26-Sep-2022 04:10                6959
class.mongodb-driver-monitoring-commandstartede..> 26-Sep-2022 04:10                7049
class.mongodb-driver-monitoring-commandsubscrib..> 26-Sep-2022 04:10                5396
class.mongodb-driver-monitoring-commandsucceede..> 26-Sep-2022 04:10                7129
class.mongodb-driver-monitoring-sdamsubscriber.php 26-Sep-2022 04:10               10630
class.mongodb-driver-monitoring-serverchangedev..> 26-Sep-2022 04:10                5591
class.mongodb-driver-monitoring-serverclosedeve..> 26-Sep-2022 04:10                4238
class.mongodb-driver-monitoring-serverheartbeat..> 26-Sep-2022 04:10                5473
class.mongodb-driver-monitoring-serverheartbeat..> 26-Sep-2022 04:10                4357
class.mongodb-driver-monitoring-serverheartbeat..> 26-Sep-2022 04:10                5484
class.mongodb-driver-monitoring-serveropeningev..> 26-Sep-2022 04:10                4258
class.mongodb-driver-monitoring-subscriber.php     26-Sep-2022 04:10                2604
class.mongodb-driver-monitoring-topologychanged..> 26-Sep-2022 04:10                4704
class.mongodb-driver-monitoring-topologyclosede..> 26-Sep-2022 04:10                3315
class.mongodb-driver-monitoring-topologyopening..> 26-Sep-2022 04:10                3329
class.mongodb-driver-query.php                     26-Sep-2022 04:10                3024
class.mongodb-driver-readconcern.php               26-Sep-2022 04:10               15927
class.mongodb-driver-readpreference.php            26-Sep-2022 04:10               18004
class.mongodb-driver-server.php                    26-Sep-2022 04:10               22578
class.mongodb-driver-serverapi.php                 26-Sep-2022 04:10               14987
class.mongodb-driver-serverdescription.php         26-Sep-2022 04:10               14661
class.mongodb-driver-session.php                   26-Sep-2022 04:10               13621
class.mongodb-driver-topologydescription.php       26-Sep-2022 04:10               10217
class.mongodb-driver-writeconcern.php              26-Sep-2022 04:10                9045
class.mongodb-driver-writeconcernerror.php         26-Sep-2022 04:10                4118
class.mongodb-driver-writeerror.php                26-Sep-2022 04:10                4384
class.mongodb-driver-writeresult.php               26-Sep-2022 04:10                7853
class.multipleiterator.php                         26-Sep-2022 04:10               10428
class.mysql-xdevapi-baseresult.php                 26-Sep-2022 04:10                2896
class.mysql-xdevapi-client.php                     26-Sep-2022 04:10                3035
class.mysql-xdevapi-collection.php                 26-Sep-2022 04:10                9949
class.mysql-xdevapi-collectionadd.php              26-Sep-2022 04:10                2913
class.mysql-xdevapi-collectionfind.php             26-Sep-2022 04:10                8271
class.mysql-xdevapi-collectionmodify.php           26-Sep-2022 04:10                9428
class.mysql-xdevapi-collectionremove.php           26-Sep-2022 04:10                5011
class.mysql-xdevapi-columnresult.php               26-Sep-2022 04:10                6027
class.mysql-xdevapi-crudoperationbindable.php      26-Sep-2022 04:10                2891
class.mysql-xdevapi-crudoperationlimitable.php     26-Sep-2022 04:10                2897
class.mysql-xdevapi-crudoperationskippable.php     26-Sep-2022 04:10                2908
class.mysql-xdevapi-crudoperationsortable.php      26-Sep-2022 04:10                2882
class.mysql-xdevapi-databaseobject.php             26-Sep-2022 04:10                3394
class.mysql-xdevapi-docresult.php                  26-Sep-2022 04:10                3783
class.mysql-xdevapi-exception.php                  26-Sep-2022 04:10                2164
class.mysql-xdevapi-executable.php                 26-Sep-2022 04:10                2591
class.mysql-xdevapi-executionstatus.php            26-Sep-2022 04:10                4847
class.mysql-xdevapi-expression.php                 26-Sep-2022 04:10                3168
class.mysql-xdevapi-result.php                     26-Sep-2022 04:10                4109
class.mysql-xdevapi-rowresult.php                  26-Sep-2022 04:10                4706
class.mysql-xdevapi-schema.php                     26-Sep-2022 04:10                7176
class.mysql-xdevapi-schemaobject.php               26-Sep-2022 04:10                2776
class.mysql-xdevapi-session.php                    26-Sep-2022 04:10                8505
class.mysql-xdevapi-sqlstatement.php               26-Sep-2022 04:10                6222
class.mysql-xdevapi-sqlstatementresult.php         26-Sep-2022 04:10                6653
class.mysql-xdevapi-statement.php                  26-Sep-2022 04:10                4648
class.mysql-xdevapi-table.php                      26-Sep-2022 04:10                7329
class.mysql-xdevapi-tabledelete.php                26-Sep-2022 04:10                4916
class.mysql-xdevapi-tableinsert.php                26-Sep-2022 04:10                3415
class.mysql-xdevapi-tableselect.php                26-Sep-2022 04:10                8010
class.mysql-xdevapi-tableupdate.php                26-Sep-2022 04:10                5873
class.mysql-xdevapi-warning.php                    26-Sep-2022 04:10                3731
class.mysqli-driver.php                            26-Sep-2022 04:10                6908
class.mysqli-result.php                            26-Sep-2022 04:10               10690
class.mysqli-sql-exception.php                     26-Sep-2022 04:10                3660
class.mysqli-stmt.php                              26-Sep-2022 04:10               13538
class.mysqli-warning.php                           26-Sep-2022 04:10                3912
class.mysqli.php                                   26-Sep-2022 04:10               26469
class.norewinditerator.php                         26-Sep-2022 04:10                7414
class.normalizer.php                               26-Sep-2022 04:10                8522
class.numberformatter.php                          26-Sep-2022 04:10               39878
class.oauth.php                                    26-Sep-2022 04:11               17327
class.oauthexception.php                           26-Sep-2022 04:11                6729
class.oauthprovider.php                            26-Sep-2022 04:11               11682
class.ocicollection.php                            26-Sep-2022 04:10                6359
class.ocilob.php                                   26-Sep-2022 04:10               12745
class.outeriterator.php                            26-Sep-2022 04:10                4408
class.outofboundsexception.php                     26-Sep-2022 04:10                5825
class.outofrangeexception.php                      26-Sep-2022 04:10                6537
class.overflowexception.php                        26-Sep-2022 04:10                6453
class.parallel-channel.php                         26-Sep-2022 04:10                8004
class.parallel-events-event-type.php               26-Sep-2022 04:10                3323
class.parallel-events-event.php                    26-Sep-2022 04:10                3298
class.parallel-events-input.php                    26-Sep-2022 04:10                4558
class.parallel-events.php                          26-Sep-2022 04:10                6675
class.parallel-future.php                          26-Sep-2022 04:10                8213
class.parallel-runtime.php                         26-Sep-2022 04:10                6152
class.parallel-sync.php                            26-Sep-2022 04:10                5227
class.parentiterator.php                           26-Sep-2022 04:10                5738
class.parle-errorinfo.php                          26-Sep-2022 04:10                3696
class.parle-lexer.php                              26-Sep-2022 04:10               11779
class.parle-lexerexception.php                     26-Sep-2022 04:10                5864
class.parle-parser.php                             26-Sep-2022 04:10               14718
class.parle-parserexception.php                    26-Sep-2022 04:10                5846
class.parle-rlexer.php                             26-Sep-2022 04:10               13420
class.parle-rparser.php                            26-Sep-2022 04:10               14869
class.parle-stack.php                              26-Sep-2022 04:10                4656
class.parle-token.php                              26-Sep-2022 04:10                4420
class.parseerror.php                               26-Sep-2022 04:10                6150
class.pdo.php                                      26-Sep-2022 04:10                9532
class.pdoexception.php                             26-Sep-2022 04:10                7357
class.pdostatement.php                             26-Sep-2022 04:10               15919
class.phar.php                                     26-Sep-2022 04:10               32485
class.phardata.php                                 26-Sep-2022 04:10               38651
class.pharexception.php                            26-Sep-2022 04:10                6161
class.pharfileinfo.php                             26-Sep-2022 04:10                8590
class.php-user-filter.php                          26-Sep-2022 04:10                4970
class.pool.php                                     26-Sep-2022 04:10                7124
class.quickhashinthash.php                         26-Sep-2022 04:10               12931
class.quickhashintset.php                          26-Sep-2022 04:10               11127
class.quickhashintstringhash.php                   26-Sep-2022 04:10               13745
class.quickhashstringinthash.php                   26-Sep-2022 04:10               11860
class.rangeexception.php                           26-Sep-2022 04:10                5983
class.rararchive.php                               26-Sep-2022 04:10                6840
class.rarentry.php                                 26-Sep-2022 04:10               43724
class.rarexception.php                             26-Sep-2022 04:10                7867
class.recursivearrayiterator.php                   26-Sep-2022 04:10               14493
class.recursivecachingiterator.php                 26-Sep-2022 04:10               12440
class.recursivecallbackfilteriterator.php          26-Sep-2022 04:10               10700
class.recursivedirectoryiterator.php               26-Sep-2022 04:10               14181
class.recursivefilteriterator.php                  26-Sep-2022 04:10                7108
class.recursiveiterator.php                        26-Sep-2022 04:10                4900
class.recursiveiteratoriterator.php                26-Sep-2022 04:10               13745
class.recursiveregexiterator.php                   26-Sep-2022 04:10                9609
class.recursivetreeiterator.php                    26-Sep-2022 04:10               23234
class.reflection.php                               26-Sep-2022 04:10                3174
class.reflectionclass.php                          26-Sep-2022 04:11               30875
class.reflectionclassconstant.php                  26-Sep-2022 04:11               12746
class.reflectionexception.php                      26-Sep-2022 04:11                5615
class.reflectionextension.php                      26-Sep-2022 04:11                9238
class.reflectionfunction.php                       26-Sep-2022 04:11               17528
class.reflectionfunctionabstract.php               26-Sep-2022 04:11               17165
class.reflectiongenerator.php                      26-Sep-2022 04:11                5525
class.reflectionmethod.php                         26-Sep-2022 04:11               25268
class.reflectionnamedtype.php                      26-Sep-2022 04:11                3592
class.reflectionobject.php                         26-Sep-2022 04:11               24113
class.reflectionparameter.php                      26-Sep-2022 04:11               14368
class.reflectionproperty.php                       26-Sep-2022 04:11               17846
class.reflectionreference.php                      26-Sep-2022 04:11                3656
class.reflectiontype.php                           26-Sep-2022 04:11                3695
class.reflectionuniontype.php                      26-Sep-2022 04:11                3225
class.reflectionzendextension.php                  26-Sep-2022 04:11                6794
class.reflector.php                                26-Sep-2022 04:11                2822
class.regexiterator.php                            26-Sep-2022 04:10               13538
class.resourcebundle.php                           26-Sep-2022 04:10                7801
class.rrdcreator.php                               26-Sep-2022 04:10                4114
class.rrdgraph.php                                 26-Sep-2022 04:10                3703
class.rrdupdater.php                               26-Sep-2022 04:10                3043
class.runtimeexception.php                         26-Sep-2022 04:10                6458
class.seaslog.php                                  26-Sep-2022 04:10               17895
class.seekableiterator.php                         26-Sep-2022 04:10               13122
class.serializable.php                             26-Sep-2022 04:10                8071
class.sessionhandler.php                           26-Sep-2022 04:10               27645
class.sessionhandlerinterface.php                  26-Sep-2022 04:10               16781
class.sessionidinterface.php                       26-Sep-2022 04:10                3135
class.sessionupdatetimestamphandlerinterface.php   26-Sep-2022 04:10                4142
class.simplexmlelement.php                         26-Sep-2022 04:11               10763
class.simplexmliterator.php                        26-Sep-2022 04:11               12619
class.snmp.php                                     26-Sep-2022 04:10               23870
class.snmpexception.php                            26-Sep-2022 04:10                6594
class.soapclient.php                               26-Sep-2022 04:11               10434
class.soapfault.php                                26-Sep-2022 04:11                7516
class.soapheader.php                               26-Sep-2022 04:11                3160
class.soapparam.php                                26-Sep-2022 04:11                2595
class.soapserver.php                               26-Sep-2022 04:11                7840
class.soapvar.php                                  26-Sep-2022 04:11                3360
class.sodiumexception.php                          26-Sep-2022 04:10                5609
class.solrclient.php                               26-Sep-2022 04:10               21612
class.solrclientexception.php                      26-Sep-2022 04:10                7591
class.solrcollapsefunction.php                     26-Sep-2022 04:10               10445
class.solrdismaxquery.php                          26-Sep-2022 04:10               94932
class.solrdocument.php                             26-Sep-2022 04:10               20336
class.solrdocumentfield.php                        26-Sep-2022 04:10                4431
class.solrexception.php                            26-Sep-2022 04:10                8086
class.solrgenericresponse.php                      26-Sep-2022 04:10               11015
class.solrillegalargumentexception.php             26-Sep-2022 04:10                7710
class.solrillegaloperationexception.php            26-Sep-2022 04:10                7754
class.solrinputdocument.php                        26-Sep-2022 04:10               16656
class.solrmissingmandatoryparameterexception.php   26-Sep-2022 04:10                6929
class.solrmodifiableparams.php                     26-Sep-2022 04:10                7935
class.solrobject.php                               26-Sep-2022 04:10                5403
class.solrparams.php                               26-Sep-2022 04:10                8253
class.solrpingresponse.php                         26-Sep-2022 04:10               10194
class.solrquery.php                                26-Sep-2022 04:10              106408
class.solrqueryresponse.php                        26-Sep-2022 04:10               10953
class.solrresponse.php                             26-Sep-2022 04:10               13035
class.solrserverexception.php                      26-Sep-2022 04:10                7556
class.solrupdateresponse.php                       26-Sep-2022 04:10               11002
class.solrutils.php                                26-Sep-2022 04:10                4415
class.spldoublylinkedlist.php                      26-Sep-2022 04:10               17179
class.splfileinfo.php                              26-Sep-2022 04:10               13879
class.splfileobject.php                            26-Sep-2022 04:10               29322
class.splfixedarray.php                            26-Sep-2022 04:10               16330
class.splheap.php                                  26-Sep-2022 04:10                8021
class.splmaxheap.php                               26-Sep-2022 04:10                7565
class.splminheap.php                               26-Sep-2022 04:10                7576
class.splobjectstorage.php                         26-Sep-2022 04:10               20434
class.splobserver.php                              26-Sep-2022 04:10                2877
class.splpriorityqueue.php                         26-Sep-2022 04:10                9517
class.splqueue.php                                 26-Sep-2022 04:10               13342
class.splstack.php                                 26-Sep-2022 04:10               12379
class.splsubject.php                               26-Sep-2022 04:10                3784
class.spltempfileobject.php                        26-Sep-2022 04:10               15450
class.spoofchecker.php                             26-Sep-2022 04:10                8590
class.sqlite3.php                                  26-Sep-2022 04:10               15587
class.sqlite3result.php                            26-Sep-2022 04:10                4789
class.sqlite3stmt.php                              26-Sep-2022 04:10                6802
class.stomp.php                                    26-Sep-2022 04:10               17032
class.stompexception.php                           26-Sep-2022 04:10                5377
class.stompframe.php                               26-Sep-2022 04:10                4098
class.streamwrapper.php                            26-Sep-2022 04:10               17037
class.svm.php                                      26-Sep-2022 04:10               15865
class.svmmodel.php                                 26-Sep-2022 04:10                5744
class.swoole-async.php                             26-Sep-2022 04:10                7061
class.swoole-atomic.php                            26-Sep-2022 04:10                4406
class.swoole-buffer.php                            26-Sep-2022 04:10                6518
class.swoole-channel.php                           26-Sep-2022 04:10                3723
class.swoole-client.php                            26-Sep-2022 04:10               14264
class.swoole-connection-iterator.php               26-Sep-2022 04:10                7046
class.swoole-coroutine.php                         26-Sep-2022 04:10               20044
class.swoole-event.php                             26-Sep-2022 04:10                6608
class.swoole-exception.php                         26-Sep-2022 04:10                3066
class.swoole-http-client.php                       26-Sep-2022 04:10               12903
class.swoole-http-request.php                      26-Sep-2022 04:10                2864
class.swoole-http-response.php                     26-Sep-2022 04:10                9472
class.swoole-http-server.php                       26-Sep-2022 04:10               21520
class.swoole-lock.php                              26-Sep-2022 04:10                4444
class.swoole-mmap.php                              26-Sep-2022 04:10                2852
class.swoole-mysql-exception.php                   26-Sep-2022 04:10                3107
class.swoole-mysql.php                             26-Sep-2022 04:10                5129
class.swoole-process.php                           26-Sep-2022 04:10               11867
class.swoole-redis-server.php                      26-Sep-2022 04:10               26093
class.swoole-serialize.php                         26-Sep-2022 04:10                3363
class.swoole-server.php                            26-Sep-2022 04:10               24769
class.swoole-table.php                             26-Sep-2022 04:10               10969
class.swoole-timer.php                             26-Sep-2022 04:10                4489
class.swoole-websocket-frame.php                   26-Sep-2022 04:10                1862
class.swoole-websocket-server.php                  26-Sep-2022 04:10                6997
class.syncevent.php                                26-Sep-2022 04:10                4296
class.syncmutex.php                                26-Sep-2022 04:10                3790
class.syncreaderwriter.php                         26-Sep-2022 04:10                4652
class.syncsemaphore.php                            26-Sep-2022 04:10                4108
class.syncsharedmemory.php                         26-Sep-2022 04:10                4951
class.thread.php                                   26-Sep-2022 04:10               10238
class.threaded.php                                 26-Sep-2022 04:10                8004
class.throwable.php                                26-Sep-2022 04:10                6087
class.tidy.php                                     26-Sep-2022 04:10               14362
class.tidynode.php                                 26-Sep-2022 04:10                9245
class.transliterator.php                           26-Sep-2022 04:10                7994
class.traversable.php                              26-Sep-2022 04:10                3887
class.typeerror.php                                26-Sep-2022 04:10                5996
class.uconverter.php                               26-Sep-2022 04:10               31808
class.ui-area.php                                  26-Sep-2022 04:11               11112
class.ui-control.php                               26-Sep-2022 04:11                5216
class.ui-controls-box.php                          26-Sep-2022 04:11                9132
class.ui-controls-button.php                       26-Sep-2022 04:11                6238
class.ui-controls-check.php                        26-Sep-2022 04:11                6964
class.ui-controls-colorbutton.php                  26-Sep-2022 04:11                6274
class.ui-controls-combo.php                        26-Sep-2022 04:11                6210
class.ui-controls-editablecombo.php                26-Sep-2022 04:11                6318
class.ui-controls-entry.php                        26-Sep-2022 04:11                8705
class.ui-controls-form.php                         26-Sep-2022 04:11                7326
class.ui-controls-grid.php                         26-Sep-2022 04:11               11293
class.ui-controls-group.php                        26-Sep-2022 04:11                7800
class.ui-controls-label.php                        26-Sep-2022 04:11                5989
class.ui-controls-multilineentry.php               26-Sep-2022 04:11                8988
class.ui-controls-picker.php                       26-Sep-2022 04:11                6871
class.ui-controls-progress.php                     26-Sep-2022 04:11                5554
class.ui-controls-radio.php                        26-Sep-2022 04:11                6189
class.ui-controls-separator.php                    26-Sep-2022 04:11                6489
class.ui-controls-slider.php                       26-Sep-2022 04:11                6521
class.ui-controls-spin.php                         26-Sep-2022 04:11                6391
class.ui-controls-tab.php                          26-Sep-2022 04:11                8251
class.ui-draw-brush-gradient.php                   26-Sep-2022 04:11                6332
class.ui-draw-brush-lineargradient.php             26-Sep-2022 04:11                5692
class.ui-draw-brush-radialgradient.php             26-Sep-2022 04:11                5820
class.ui-draw-brush.php                            26-Sep-2022 04:11                4186
class.ui-draw-color.php                            26-Sep-2022 04:11                7752
class.ui-draw-line-cap.php                         26-Sep-2022 04:11                2403
class.ui-draw-line-join.php                        26-Sep-2022 04:11                2363
class.ui-draw-matrix.php                           26-Sep-2022 04:11                5467
class.ui-draw-path.php                             26-Sep-2022 04:11                9506
class.ui-draw-pen.php                              26-Sep-2022 04:11                7979
class.ui-draw-stroke.php                           26-Sep-2022 04:11                6227
class.ui-draw-text-font-descriptor.php             26-Sep-2022 04:11                5378
class.ui-draw-text-font-italic.php                 26-Sep-2022 04:11                2593
class.ui-draw-text-font-stretch.php                26-Sep-2022 04:11                3992
class.ui-draw-text-font-weight.php                 26-Sep-2022 04:11                3971
class.ui-draw-text-font.php                        26-Sep-2022 04:11                4599
class.ui-draw-text-layout.php                      26-Sep-2022 04:11                4773
class.ui-exception-invalidargumentexception.php    26-Sep-2022 04:11                5880
class.ui-exception-runtimeexception.php            26-Sep-2022 04:11                5803
class.ui-executor.php                              26-Sep-2022 04:11                4836
class.ui-key.php                                   26-Sep-2022 04:11                9135
class.ui-menu.php                                  26-Sep-2022 04:11                5893
class.ui-menuitem.php                              26-Sep-2022 04:11                3620
class.ui-point.php                                 26-Sep-2022 04:11                5876
class.ui-size.php                                  26-Sep-2022 04:11                5979
class.ui-window.php                                26-Sep-2022 04:11               12042
class.underflowexception.php                       26-Sep-2022 04:10                6542
class.unexpectedvalueexception.php                 26-Sep-2022 04:10                6712
class.v8js.php                                     26-Sep-2022 04:10                6859
class.v8jsexception.php                            26-Sep-2022 04:10                9256
class.variant.php                                  26-Sep-2022 04:11                8602
class.varnishadmin.php                             26-Sep-2022 04:10               10334
class.varnishlog.php                               26-Sep-2022 04:10               28282
class.varnishstat.php                              26-Sep-2022 04:10                2848
class.volatile.php                                 26-Sep-2022 04:10               11436
class.vtiful-kernel-excel.php                      26-Sep-2022 04:10               10243
class.vtiful-kernel-format.php                     26-Sep-2022 04:10               13162
class.weakreference.php                            26-Sep-2022 04:10                5482
class.wkhtmltox-image-converter.php                26-Sep-2022 04:10                3806
class.wkhtmltox-pdf-converter.php                  26-Sep-2022 04:10                4220
class.wkhtmltox-pdf-object.php                     26-Sep-2022 04:10                2805
class.worker.php                                   26-Sep-2022 04:10                7744
class.xmldiff-base.php                             26-Sep-2022 04:11                4259
class.xmldiff-dom.php                              26-Sep-2022 04:11                5561
class.xmldiff-file.php                             26-Sep-2022 04:11                5184
class.xmldiff-memory.php                           26-Sep-2022 04:11                5215
class.xmlreader.php                                26-Sep-2022 04:11               32110
class.xmlwriter.php                                26-Sep-2022 04:11               41267
class.xsltprocessor.php                            26-Sep-2022 04:11                8270
class.yac.php                                      26-Sep-2022 04:10                8438
class.yaconf.php                                   26-Sep-2022 04:10                3347
class.yaf-action-abstract.php                      26-Sep-2022 04:10               12173
class.yaf-application.php                          26-Sep-2022 04:10               12733
class.yaf-bootstrap-abstract.php                   26-Sep-2022 04:10                6294
class.yaf-config-abstract.php                      26-Sep-2022 04:10                5165
class.yaf-config-ini.php                           26-Sep-2022 04:10               17005
class.yaf-config-simple.php                        26-Sep-2022 04:10               12206
class.yaf-controller-abstract.php                  26-Sep-2022 04:10               18919
class.yaf-dispatcher.php                           26-Sep-2022 04:10               19842
class.yaf-exception-dispatchfailed.php             26-Sep-2022 04:10                2600
class.yaf-exception-loadfailed-action.php          26-Sep-2022 04:10                2675
class.yaf-exception-loadfailed-controller.php      26-Sep-2022 04:10                2691
class.yaf-exception-loadfailed-module.php          26-Sep-2022 04:10                2662
class.yaf-exception-loadfailed-view.php            26-Sep-2022 04:10                2604
class.yaf-exception-loadfailed.php                 26-Sep-2022 04:10                2578
class.yaf-exception-routerfailed.php               26-Sep-2022 04:10                2589
class.yaf-exception-startuperror.php               26-Sep-2022 04:10                2587
class.yaf-exception-typeerror.php                  26-Sep-2022 04:10                2558
class.yaf-exception.php                            26-Sep-2022 04:10                6588
class.yaf-loader.php                               26-Sep-2022 04:10               18595
class.yaf-plugin-abstract.php                      26-Sep-2022 04:10               18692
class.yaf-registry.php                             26-Sep-2022 04:10                5701
class.yaf-request-abstract.php                     26-Sep-2022 04:10               21445
class.yaf-request-http.php                         26-Sep-2022 04:10               20443
class.yaf-request-simple.php                       26-Sep-2022 04:10               19604
class.yaf-response-abstract.php                    26-Sep-2022 04:10               10728
class.yaf-route-interface.php                      26-Sep-2022 04:10                3522
class.yaf-route-map.php                            26-Sep-2022 04:10                6103
class.yaf-route-regex.php                          26-Sep-2022 04:10                7490
class.yaf-route-rewrite.php                        26-Sep-2022 04:10                6819
class.yaf-route-simple.php                         26-Sep-2022 04:10                6167
class.yaf-route-static.php                         26-Sep-2022 04:10                4797
class.yaf-route-supervar.php                       26-Sep-2022 04:10                4394
class.yaf-router.php                               26-Sep-2022 04:10               12315
class.yaf-session.php                              26-Sep-2022 04:10               11659
class.yaf-view-interface.php                       26-Sep-2022 04:10                5470
class.yaf-view-simple.php                          26-Sep-2022 04:10               10038
class.yar-client-exception.php                     26-Sep-2022 04:11                6134
class.yar-client.php                               26-Sep-2022 04:11                5410
class.yar-concurrent-client.php                    26-Sep-2022 04:11                6194
class.yar-server-exception.php                     26-Sep-2022 04:11                6585
class.yar-server.php                               26-Sep-2022 04:11                3308
class.ziparchive.php                               26-Sep-2022 04:10               35372
class.zmq.php                                      26-Sep-2022 04:10               33968
class.zmqcontext.php                               26-Sep-2022 04:10                5056
class.zmqdevice.php                                26-Sep-2022 04:10                7023
class.zmqpoll.php                                  26-Sep-2022 04:10                4835
class.zmqsocket.php                                26-Sep-2022 04:10               10086
class.zookeeper.php                                26-Sep-2022 04:10               47564
class.zookeeperauthenticationexception.php         26-Sep-2022 04:10                5820
class.zookeeperconfig.php                          26-Sep-2022 04:10                5409
class.zookeeperconnectionexception.php             26-Sep-2022 04:10                5817
class.zookeeperexception.php                       26-Sep-2022 04:10                5678
class.zookeepermarshallingexception.php            26-Sep-2022 04:10                5833
class.zookeepernonodeexception.php                 26-Sep-2022 04:10                5797
class.zookeeperoperationtimeoutexception.php       26-Sep-2022 04:10                5842
class.zookeepersessionexception.php                26-Sep-2022 04:10                5785
classobj.configuration.php                         26-Sep-2022 04:10                1308
classobj.constants.php                             26-Sep-2022 04:10                1156
classobj.examples.php                              26-Sep-2022 04:10               14859
classobj.installation.php                          26-Sep-2022 04:10                1280
classobj.requirements.php                          26-Sep-2022 04:10                1236
classobj.resources.php                             26-Sep-2022 04:10                1240
classobj.setup.php                                 26-Sep-2022 04:10                1637
closure.bind.php                                   26-Sep-2022 04:10                8227
closure.bindto.php                                 26-Sep-2022 04:10                9712
closure.call.php                                   26-Sep-2022 04:10                6584
closure.construct.php                              26-Sep-2022 04:10                2718
closure.fromcallable.php                           26-Sep-2022 04:10                3147
cmark.installation.php                             26-Sep-2022 04:10                1962
cmark.requirements.php                             26-Sep-2022 04:10                1307
cmark.setup.php                                    26-Sep-2022 04:10                1434
collator.asort.php                                 26-Sep-2022 04:10                9124
collator.compare.php                               26-Sep-2022 04:10                8395
collator.construct.php                             26-Sep-2022 04:10                5789
collator.create.php                                26-Sep-2022 04:10                5336
collator.getattribute.php                          26-Sep-2022 04:10                5786
collator.geterrorcode.php                          26-Sep-2022 04:10                5246
collator.geterrormessage.php                       26-Sep-2022 04:10                5302
collator.getlocale.php                             26-Sep-2022 04:10                6568
collator.getsortkey.php                            26-Sep-2022 04:10                6272
collator.getstrength.php                           26-Sep-2022 04:10                4907
collator.setattribute.php                          26-Sep-2022 04:10                6664
collator.setstrength.php                           26-Sep-2022 04:10               13266
collator.sort.php                                  26-Sep-2022 04:10                7880
collator.sortwithsortkeys.php                      26-Sep-2022 04:10                6426
collectable.isgarbage.php                          26-Sep-2022 04:10                2667
com.configuration.php                              26-Sep-2022 04:11                8256
com.constants.php                                  26-Sep-2022 04:11               18257
com.error-handling.php                             26-Sep-2022 04:11                1606
com.examples.arrays.php                            26-Sep-2022 04:11                2598
com.examples.foreach.php                           26-Sep-2022 04:11                4211
com.examples.php                                   26-Sep-2022 04:11                1407
com.installation.php                               26-Sep-2022 04:11                1662
com.requirements.php                               26-Sep-2022 04:11                1310
com.resources.php                                  26-Sep-2022 04:11                1406
com.setup.php                                      26-Sep-2022 04:11                1596
commonmark-cql.construct.php                       26-Sep-2022 04:10                2123
commonmark-cql.invoke.php                          26-Sep-2022 04:10                3740
commonmark-interfaces-ivisitable.accept.php        26-Sep-2022 04:10                3106
commonmark-interfaces-ivisitor.enter.php           26-Sep-2022 04:10                4109
commonmark-interfaces-ivisitor.leave.php           26-Sep-2022 04:10                4111
commonmark-node-bulletlist.construct.php           26-Sep-2022 04:10                3008
commonmark-node-codeblock.construct.php            26-Sep-2022 04:10                2721
commonmark-node-heading.construct.php              26-Sep-2022 04:10                2563
commonmark-node-image.construct.php                26-Sep-2022 04:10                3104
commonmark-node-link.construct.php                 26-Sep-2022 04:10                3101
commonmark-node-orderedlist.construct.php          26-Sep-2022 04:10                3825
commonmark-node-text.construct.php                 26-Sep-2022 04:10                2605
commonmark-node.accept.php                         26-Sep-2022 04:10                2847
commonmark-node.appendchild.php                    26-Sep-2022 04:10                2711
commonmark-node.insertafter.php                    26-Sep-2022 04:10                2736
commonmark-node.insertbefore.php                   26-Sep-2022 04:10                2734
commonmark-node.prependchild.php                   26-Sep-2022 04:10                2738
commonmark-node.replace.php                        26-Sep-2022 04:10                2682
commonmark-node.unlink.php                         26-Sep-2022 04:10                2352
commonmark-parser.construct.php                    26-Sep-2022 04:10                3291
commonmark-parser.finish.php                       26-Sep-2022 04:10                2406
commonmark-parser.parse.php                        26-Sep-2022 04:10                2555
compersisthelper.construct.php                     26-Sep-2022 04:11                3458
compersisthelper.getcurfilename.php                26-Sep-2022 04:11                3022
compersisthelper.getmaxstreamsize.php              26-Sep-2022 04:11                3056
compersisthelper.initnew.php                       26-Sep-2022 04:11                2901
compersisthelper.loadfromfile.php                  26-Sep-2022 04:11                4006
compersisthelper.loadfromstream.php                26-Sep-2022 04:11                3272
compersisthelper.savetofile.php                    26-Sep-2022 04:11                5907
compersisthelper.savetostream.php                  26-Sep-2022 04:11                3299
componere-abstract-definition.addinterface.php     26-Sep-2022 04:10                3275
componere-abstract-definition.addmethod.php        26-Sep-2022 04:10                4006
componere-abstract-definition.addtrait.php         26-Sep-2022 04:10                3225
componere-abstract-definition.getreflector.php     26-Sep-2022 04:10                2345
componere-definition.addconstant.php               26-Sep-2022 04:10                4335
componere-definition.addproperty.php               26-Sep-2022 04:10                3724
componere-definition.construct.php                 26-Sep-2022 04:10                5545
componere-definition.getclosure.php                26-Sep-2022 04:10                3402
componere-definition.getclosures.php               26-Sep-2022 04:10                2637
componere-definition.isregistered.php              26-Sep-2022 04:10                2186
componere-definition.register.php                  26-Sep-2022 04:10                2396
componere-method.construct.php                     26-Sep-2022 04:10                2161
componere-method.getreflector.php                  26-Sep-2022 04:10                2153
componere-method.setprivate.php                    26-Sep-2022 04:10                2450
componere-method.setprotected.php                  26-Sep-2022 04:10                2465
componere-method.setstatic.php                     26-Sep-2022 04:10                2030
componere-patch.apply.php                          26-Sep-2022 04:10                1820
componere-patch.construct.php                      26-Sep-2022 04:10                3463
componere-patch.derive.php                         26-Sep-2022 04:10                3212
componere-patch.getclosure.php                     26-Sep-2022 04:10                2994
componere-patch.getclosures.php                    26-Sep-2022 04:10                2116
componere-patch.isapplied.php                      26-Sep-2022 04:10                1749
componere-patch.revert.php                         26-Sep-2022 04:10                1819
componere-value.construct.php                      26-Sep-2022 04:10                2609
componere-value.hasdefault.php                     26-Sep-2022 04:10                1794
componere-value.isprivate.php                      26-Sep-2022 04:10                1812
componere-value.isprotected.php                    26-Sep-2022 04:10                1822
componere-value.isstatic.php                       26-Sep-2022 04:10                1806
componere-value.setprivate.php                     26-Sep-2022 04:10                2471
componere-value.setprotected.php                   26-Sep-2022 04:10                2485
componere-value.setstatic.php                      26-Sep-2022 04:10                2045
componere.cast.php                                 26-Sep-2022 04:10                4914
componere.cast_by_ref.php                          26-Sep-2022 04:10                5098
componere.installation.php                         26-Sep-2022 04:10                1346
componere.requirements.php                         26-Sep-2022 04:10                1197
componere.setup.php                                26-Sep-2022 04:10                1473
configuration.changes.modes.php                    26-Sep-2022 04:10                3878
configuration.changes.php                          26-Sep-2022 04:10                8907
configuration.file.per-user.php                    26-Sep-2022 04:10                3199
configuration.file.php                             26-Sep-2022 04:10               10921
configuration.php                                  26-Sep-2022 04:10                1775
configure.about.php                                26-Sep-2022 04:11               20578
configure.php                                      26-Sep-2022 04:11                1471
context.curl.php                                   26-Sep-2022 04:10                8892
context.ftp.php                                    26-Sep-2022 04:10                4693
context.http.php                                   26-Sep-2022 04:10               17781
context.params.php                                 26-Sep-2022 04:10                2510
context.phar.php                                   26-Sep-2022 04:10                2811
context.php                                        26-Sep-2022 04:10                2986
context.socket.php                                 26-Sep-2022 04:10                8083
context.ssl.php                                    26-Sep-2022 04:10               12600
context.zip.php                                    26-Sep-2022 04:10                4272
control-structures.alternative-syntax.php          26-Sep-2022 04:10                7226
control-structures.break.php                       26-Sep-2022 04:10                6204
control-structures.continue.php                    26-Sep-2022 04:10                8735
control-structures.declare.php                     26-Sep-2022 04:10               12907
control-structures.do.while.php                    26-Sep-2022 04:10                5688
control-structures.else.php                        26-Sep-2022 04:10                3150
control-structures.elseif.php                      26-Sep-2022 04:10                8033
control-structures.for.php                         26-Sep-2022 04:10               12570
control-structures.foreach.php                     26-Sep-2022 04:10               24920
control-structures.goto.php                        26-Sep-2022 04:10                7412
control-structures.if.php                          26-Sep-2022 04:10                4813
control-structures.intro.php                       26-Sep-2022 04:10                1726
control-structures.match.php                       26-Sep-2022 04:10               17844
control-structures.switch.php                      26-Sep-2022 04:10               17256
control-structures.while.php                       26-Sep-2022 04:10                4916
copyright.php                                      26-Sep-2022 04:10                2018
countable.count.php                                26-Sep-2022 04:10                5569
csprng.configuration.php                           26-Sep-2022 04:10                1294
csprng.constants.php                               26-Sep-2022 04:10                1140
csprng.installation.php                            26-Sep-2022 04:10                1266
csprng.requirements.php                            26-Sep-2022 04:10                1222
csprng.resources.php                               26-Sep-2022 04:10                1226
csprng.setup.php                                   26-Sep-2022 04:10                1605
ctype.configuration.php                            26-Sep-2022 04:10                1287
ctype.constants.php                                26-Sep-2022 04:10                1131
ctype.installation.php                             26-Sep-2022 04:10                1443
ctype.requirements.php                             26-Sep-2022 04:10                1237
ctype.resources.php                                26-Sep-2022 04:10                1219
ctype.setup.php                                    26-Sep-2022 04:10                1598
cubrid.configuration.php                           26-Sep-2022 04:10                1247
cubrid.constants.php                               26-Sep-2022 04:10               14291
cubrid.examples.php                                26-Sep-2022 04:10               21695
cubrid.installation.php                            26-Sep-2022 04:10                2155
cubrid.requirements.php                            26-Sep-2022 04:10                1290
cubrid.resources.php                               26-Sep-2022 04:10                3184
cubrid.setup.php                                   26-Sep-2022 04:10                1617
cubridmysql.cubrid.php                             26-Sep-2022 04:10                5264
curl.configuration.php                             26-Sep-2022 04:10                2494
curl.constants.php                                 26-Sep-2022 04:10               61506
curl.examples-basic.php                            26-Sep-2022 04:10                4095
curl.examples.php                                  26-Sep-2022 04:10                1356
curl.installation.php                              26-Sep-2022 04:10                2522
curl.requirements.php                              26-Sep-2022 04:10                1355
curl.resources.php                                 26-Sep-2022 04:10                1247
curl.setup.php                                     26-Sep-2022 04:10                1615
curlfile.construct.php                             26-Sep-2022 04:10               10374
curlfile.getfilename.php                           26-Sep-2022 04:10                2077
curlfile.getmimetype.php                           26-Sep-2022 04:10                2065
curlfile.getpostfilename.php                       26-Sep-2022 04:10                2132
curlfile.setmimetype.php                           26-Sep-2022 04:10                2322
curlfile.setpostfilename.php                       26-Sep-2022 04:10                2362
dateinterval.construct.php                         26-Sep-2022 04:10               10043
dateinterval.createfromdatestring.php              26-Sep-2022 04:10                8414
dateinterval.format.php                            26-Sep-2022 04:10               13457
dateperiod.construct.php                           26-Sep-2022 04:10               13965
dateperiod.getdateinterval.php                     26-Sep-2022 04:10                4614
dateperiod.getenddate.php                          26-Sep-2022 04:10                7474
dateperiod.getrecurrences.php                      26-Sep-2022 04:10                2612
dateperiod.getstartdate.php                        26-Sep-2022 04:10                5035
datetime.add.php                                   26-Sep-2022 04:10               12714
datetime.configuration.php                         26-Sep-2022 04:10                5587
datetime.constants.php                             26-Sep-2022 04:10                2571
datetime.construct.php                             26-Sep-2022 04:10               16515
datetime.createfromformat.php                      26-Sep-2022 04:10               28110
datetime.createfromimmutable.php                   26-Sep-2022 04:10                4266
datetime.createfrominterface.php                   26-Sep-2022 04:10                4883
datetime.diff.php                                  26-Sep-2022 04:10               11986
datetime.examples-arithmetic.php                   26-Sep-2022 04:10               15610
datetime.examples.php                              26-Sep-2022 04:10                1410
datetime.format.php                                26-Sep-2022 04:10                6984
datetime.formats.compound.php                      26-Sep-2022 04:10                9486
datetime.formats.date.php                          26-Sep-2022 04:10               13781
datetime.formats.php                               26-Sep-2022 04:10                2749
datetime.formats.relative.php                      26-Sep-2022 04:10               15067
datetime.formats.time.php                          26-Sep-2022 04:10                7276
datetime.getlasterrors.php                         26-Sep-2022 04:10                5868
datetime.getoffset.php                             26-Sep-2022 04:10                7836
datetime.gettimestamp.php                          26-Sep-2022 04:10                6162
datetime.gettimezone.php                           26-Sep-2022 04:10                7356
datetime.installation.php                          26-Sep-2022 04:10                2262
datetime.modify.php                                26-Sep-2022 04:10               10812
datetime.requirements.php                          26-Sep-2022 04:10                1236
datetime.resources.php                             26-Sep-2022 04:10                1240
datetime.set-state.php                             26-Sep-2022 04:10                2501
datetime.setdate.php                               26-Sep-2022 04:10               11185
datetime.setisodate.php                            26-Sep-2022 04:10               14232
datetime.settime.php                               26-Sep-2022 04:10               14036
datetime.settimestamp.php                          26-Sep-2022 04:10                9511
datetime.settimezone.php                           26-Sep-2022 04:10                9350
datetime.setup.php                                 26-Sep-2022 04:10                1671
datetime.sub.php                                   26-Sep-2022 04:10               12664
datetime.wakeup.php                                26-Sep-2022 04:10                2713
datetimeimmutable.add.php                          26-Sep-2022 04:10                2341
datetimeimmutable.construct.php                    26-Sep-2022 04:10                3411
datetimeimmutable.createfromformat.php             26-Sep-2022 04:10                3775
datetimeimmutable.createfrominterface.php          26-Sep-2022 04:10                5147
datetimeimmutable.createfrommutable.php            26-Sep-2022 04:10                4457
datetimeimmutable.getlasterrors.php                26-Sep-2022 04:10                2200
datetimeimmutable.modify.php                       26-Sep-2022 04:10                3296
datetimeimmutable.set-state.php                    26-Sep-2022 04:10                2319
datetimeimmutable.setdate.php                      26-Sep-2022 04:10                2464
datetimeimmutable.setisodate.php                   26-Sep-2022 04:10                2524
datetimeimmutable.settime.php                      26-Sep-2022 04:10                2767
datetimeimmutable.settimestamp.php                 26-Sep-2022 04:10                2360
datetimeimmutable.settimezone.php                  26-Sep-2022 04:10                2378
datetimeimmutable.sub.php                          26-Sep-2022 04:10                2344
datetimezone.construct.php                         26-Sep-2022 04:10                6710
datetimezone.getlocation.php                       26-Sep-2022 04:10                5110
datetimezone.getname.php                           26-Sep-2022 04:10                3071
datetimezone.getoffset.php                         26-Sep-2022 04:10                7432
datetimezone.gettransitions.php                    26-Sep-2022 04:10                7368
datetimezone.listabbreviations.php                 26-Sep-2022 04:10                4997
datetimezone.listidentifiers.php                   26-Sep-2022 04:10                7086
dba.configuration.php                              26-Sep-2022 04:10                2267
dba.constants.php                                  26-Sep-2022 04:10                1110
dba.example.php                                    26-Sep-2022 04:10                6809
dba.examples.php                                   26-Sep-2022 04:10                1306
dba.installation.php                               26-Sep-2022 04:10                9095
dba.requirements.php                               26-Sep-2022 04:10                7390
dba.resources.php                                  26-Sep-2022 04:10                1505
dba.setup.php                                      26-Sep-2022 04:10                1588
dbase.configuration.php                            26-Sep-2022 04:10                1287
dbase.constants.php                                26-Sep-2022 04:10                1131
dbase.installation.php                             26-Sep-2022 04:10                1331
dbase.requirements.php                             26-Sep-2022 04:10                1215
dbase.resources.php                                26-Sep-2022 04:10                1219
dbase.setup.php                                    26-Sep-2022 04:10                1614
debugger-about.php                                 26-Sep-2022 04:11                1865
debugger.php                                       26-Sep-2022 04:11                1387
dio.configuration.php                              26-Sep-2022 04:10                1273
dio.constants.php                                  26-Sep-2022 04:10                7373
dio.installation.php                               26-Sep-2022 04:10                2067
dio.requirements.php                               26-Sep-2022 04:10                1201
dio.resources.php                                  26-Sep-2022 04:10                1332
dio.setup.php                                      26-Sep-2022 04:10                1594
dir.configuration.php                              26-Sep-2022 04:10                1273
dir.constants.php                                  26-Sep-2022 04:10                2277
dir.installation.php                               26-Sep-2022 04:10                1245
dir.requirements.php                               26-Sep-2022 04:10                1201
dir.resources.php                                  26-Sep-2022 04:10                1205
dir.setup.php                                      26-Sep-2022 04:10                1586
directory.close.php                                26-Sep-2022 04:10                2077
directory.read.php                                 26-Sep-2022 04:10                2034
directory.rewind.php                               26-Sep-2022 04:10                2064
directoryiterator.construct.php                    26-Sep-2022 04:10                6361
directoryiterator.current.php                      26-Sep-2022 04:10                6319
directoryiterator.getatime.php                     26-Sep-2022 04:10                5735
directoryiterator.getbasename.php                  26-Sep-2022 04:10                6846
directoryiterator.getctime.php                     26-Sep-2022 04:10                5881
directoryiterator.getextension.php                 26-Sep-2022 04:10                6236
directoryiterator.getfilename.php                  26-Sep-2022 04:10                5462
directoryiterator.getgroup.php                     26-Sep-2022 04:10                5892
directoryiterator.getinode.php                     26-Sep-2022 04:10                4705
directoryiterator.getmtime.php                     26-Sep-2022 04:10                5785
directoryiterator.getowner.php                     26-Sep-2022 04:10                5263
directoryiterator.getpath.php                      26-Sep-2022 04:10                4855
directoryiterator.getpathname.php                  26-Sep-2022 04:10                5236
directoryiterator.getperms.php                     26-Sep-2022 04:10                6170
directoryiterator.getsize.php                      26-Sep-2022 04:10                4959
directoryiterator.gettype.php                      26-Sep-2022 04:10                5768
directoryiterator.isdir.php                        26-Sep-2022 04:10                5619
directoryiterator.isdot.php                        26-Sep-2022 04:10                5839
directoryiterator.isexecutable.php                 26-Sep-2022 04:10                5500
directoryiterator.isfile.php                       26-Sep-2022 04:10                5799
directoryiterator.islink.php                       26-Sep-2022 04:10                7437
directoryiterator.isreadable.php                   26-Sep-2022 04:10                5342
directoryiterator.iswritable.php                   26-Sep-2022 04:10                5549
directoryiterator.key.php                          26-Sep-2022 04:10                5916
directoryiterator.next.php                         26-Sep-2022 04:10                5535
directoryiterator.rewind.php                       26-Sep-2022 04:10                5461
directoryiterator.seek.php                         26-Sep-2022 04:10                5510
directoryiterator.tostring.php                     26-Sep-2022 04:10                4674
directoryiterator.valid.php                        26-Sep-2022 04:10                5805
doc.changelog.php                                  26-Sep-2022 04:11              141337
dom.configuration.php                              26-Sep-2022 04:11                1273
dom.constants.php                                  26-Sep-2022 04:11               14250
dom.examples.php                                   26-Sep-2022 04:11                2933
dom.installation.php                               26-Sep-2022 04:11                1345
dom.requirements.php                               26-Sep-2022 04:11                1440
dom.resources.php                                  26-Sep-2022 04:11                1205
dom.setup.php                                      26-Sep-2022 04:11                1582
domattr.construct.php                              26-Sep-2022 04:11                5482
domattr.isid.php                                   26-Sep-2022 04:11                4783
domcdatasection.construct.php                      26-Sep-2022 04:11                5176
domcharacterdata.appenddata.php                    26-Sep-2022 04:11                3742
domcharacterdata.deletedata.php                    26-Sep-2022 04:11                4767
domcharacterdata.insertdata.php                    26-Sep-2022 04:11                4469
domcharacterdata.replacedata.php                   26-Sep-2022 04:11                5124
domcharacterdata.substringdata.php                 26-Sep-2022 04:11                4650
domcomment.construct.php                           26-Sep-2022 04:11                5025
domdocument.construct.php                          26-Sep-2022 04:11                4267
domdocument.createattribute.php                    26-Sep-2022 04:11                5723
domdocument.createattributens.php                  26-Sep-2022 04:11                6526
domdocument.createcdatasection.php                 26-Sep-2022 04:11                5407
domdocument.createcomment.php                      26-Sep-2022 04:11                5352
domdocument.createdocumentfragment.php             26-Sep-2022 04:11                5011
domdocument.createelement.php                      26-Sep-2022 04:11               11375
domdocument.createelementns.php                    26-Sep-2022 04:11               13955
domdocument.createentityreference.php              26-Sep-2022 04:11                6048
domdocument.createprocessinginstruction.php        26-Sep-2022 04:11                6325
domdocument.createtextnode.php                     26-Sep-2022 04:11                5343
domdocument.getelementbyid.php                     26-Sep-2022 04:11                7533
domdocument.getelementsbytagname.php               26-Sep-2022 04:11                6291
domdocument.getelementsbytagnamens.php             26-Sep-2022 04:11                7193
domdocument.importnode.php                         26-Sep-2022 04:11                8898
domdocument.load.php                               26-Sep-2022 04:11                6042
domdocument.loadhtml.php                           26-Sep-2022 04:11                7131
domdocument.loadhtmlfile.php                       26-Sep-2022 04:11                6767
domdocument.loadxml.php                            26-Sep-2022 04:11                6446
domdocument.normalizedocument.php                  26-Sep-2022 04:11                2762
domdocument.registernodeclass.php                  26-Sep-2022 04:11               16249
domdocument.relaxngvalidate.php                    26-Sep-2022 04:11                3803
domdocument.relaxngvalidatesource.php              26-Sep-2022 04:11                3838
domdocument.save.php                               26-Sep-2022 04:11                8019
domdocument.savehtml.php                           26-Sep-2022 04:11                7780
domdocument.savehtmlfile.php                       26-Sep-2022 04:11                7930
domdocument.savexml.php                            26-Sep-2022 04:11                9261
domdocument.schemavalidate.php                     26-Sep-2022 04:11                4694
domdocument.schemavalidatesource.php               26-Sep-2022 04:11                4767
domdocument.validate.php                           26-Sep-2022 04:11                5779
domdocument.xinclude.php                           26-Sep-2022 04:11                7039
domdocumentfragment.appendxml.php                  26-Sep-2022 04:11                5348
domdocumentfragment.construct.php                  26-Sep-2022 04:11                2073
domelement.construct.php                           26-Sep-2022 04:11                6443
domelement.getattribute.php                        26-Sep-2022 04:11                3384
domelement.getattributenode.php                    26-Sep-2022 04:11                3811
domelement.getattributenodens.php                  26-Sep-2022 04:11                4209
domelement.getattributens.php                      26-Sep-2022 04:11                3851
domelement.getelementsbytagname.php                26-Sep-2022 04:11                3657
domelement.getelementsbytagnamens.php              26-Sep-2022 04:11                3837
domelement.hasattribute.php                        26-Sep-2022 04:11                3591
domelement.hasattributens.php                      26-Sep-2022 04:11                3964
domelement.removeattribute.php                     26-Sep-2022 04:11                3750
domelement.removeattributenode.php                 26-Sep-2022 04:11                4102
domelement.removeattributens.php                   26-Sep-2022 04:11                4129
domelement.setattribute.php                        26-Sep-2022 04:11                5860
domelement.setattributenode.php                    26-Sep-2022 04:11                3891
domelement.setattributenodens.php                  26-Sep-2022 04:11                3872
domelement.setattributens.php                      26-Sep-2022 04:11                4828
domelement.setidattribute.php                      26-Sep-2022 04:11                4457
domelement.setidattributenode.php                  26-Sep-2022 04:11                4561
domelement.setidattributens.php                    26-Sep-2022 04:11                4886
domentityreference.construct.php                   26-Sep-2022 04:11                4830
domimplementation.construct.php                    26-Sep-2022 04:11                1902
domimplementation.createdocument.php               26-Sep-2022 04:11                5724
domimplementation.createdocumenttype.php           26-Sep-2022 04:11                9196
domimplementation.hasfeature.php                   26-Sep-2022 04:11                9650
domnamednodemap.count.php                          26-Sep-2022 04:11                2324
domnamednodemap.getnameditem.php                   26-Sep-2022 04:11                3201
domnamednodemap.getnameditemns.php                 26-Sep-2022 04:11                3553
domnamednodemap.item.php                           26-Sep-2022 04:11                2772
domnode.appendchild.php                            26-Sep-2022 04:11                8197
domnode.c14n.php                                   26-Sep-2022 04:11                3960
domnode.c14nfile.php                               26-Sep-2022 04:11                4324
domnode.clonenode.php                              26-Sep-2022 04:11                2495
domnode.getlineno.php                              26-Sep-2022 04:11                4919
domnode.getnodepath.php                            26-Sep-2022 04:11                5152
domnode.hasattributes.php                          26-Sep-2022 04:11                2542
domnode.haschildnodes.php                          26-Sep-2022 04:11                2454
domnode.insertbefore.php                           26-Sep-2022 04:11                4755
domnode.isdefaultnamespace.php                     26-Sep-2022 04:11                2732
domnode.issamenode.php                             26-Sep-2022 04:11                2605
domnode.issupported.php                            26-Sep-2022 04:11                3655
domnode.lookupnamespaceuri.php                     26-Sep-2022 04:11                3016
domnode.lookupprefix.php                           26-Sep-2022 04:11                2964
domnode.normalize.php                              26-Sep-2022 04:11                2586
domnode.removechild.php                            26-Sep-2022 04:11                6617
domnode.replacechild.php                           26-Sep-2022 04:11                5167
domnodelist.count.php                              26-Sep-2022 04:11                2246
domnodelist.item.php                               26-Sep-2022 04:11                6624
domprocessinginstruction.construct.php             26-Sep-2022 04:11                6622
domtext.construct.php                              26-Sep-2022 04:11                4809
domtext.iselementcontentwhitespace.php             26-Sep-2022 04:11                2448
domtext.iswhitespaceinelementcontent.php           26-Sep-2022 04:11                2483
domtext.splittext.php                              26-Sep-2022 04:11                3071
domxpath.construct.php                             26-Sep-2022 04:11                2544
domxpath.evaluate.php                              26-Sep-2022 04:11                7963
domxpath.query.php                                 26-Sep-2022 04:11               12800
domxpath.registernamespace.php                     26-Sep-2022 04:11                2993
domxpath.registerphpfunctions.php                  26-Sep-2022 04:11               14198
ds-collection.clear.php                            26-Sep-2022 04:10                3952
ds-collection.copy.php                             26-Sep-2022 04:10                4396
ds-collection.isempty.php                          26-Sep-2022 04:10                4239
ds-collection.toarray.php                          26-Sep-2022 04:10                4009
ds-deque.allocate.php                              26-Sep-2022 04:10                4602
ds-deque.apply.php                                 26-Sep-2022 04:10                5086
ds-deque.capacity.php                              26-Sep-2022 04:10                3911
ds-deque.clear.php                                 26-Sep-2022 04:10                3834
ds-deque.construct.php                             26-Sep-2022 04:10                4358
ds-deque.contains.php                              26-Sep-2022 04:10                7516
ds-deque.copy.php                                  26-Sep-2022 04:10                4223
ds-deque.count.php                                 26-Sep-2022 04:10                1529
ds-deque.filter.php                                26-Sep-2022 04:10                7520
ds-deque.find.php                                  26-Sep-2022 04:10                5482
ds-deque.first.php                                 26-Sep-2022 04:10                3826
ds-deque.get.php                                   26-Sep-2022 04:10                6684
ds-deque.insert.php                                26-Sep-2022 04:10                7025
ds-deque.isempty.php                               26-Sep-2022 04:10                4086
ds-deque.join.php                                  26-Sep-2022 04:10                5759
ds-deque.jsonserialize.php                         26-Sep-2022 04:10                1809
ds-deque.last.php                                  26-Sep-2022 04:10                3814
ds-deque.map.php                                   26-Sep-2022 04:10                5462
ds-deque.merge.php                                 26-Sep-2022 04:10                4893
ds-deque.pop.php                                   26-Sep-2022 04:10                4311
ds-deque.push.php                                  26-Sep-2022 04:10                4719
ds-deque.reduce.php                                26-Sep-2022 04:10                8687
ds-deque.remove.php                                26-Sep-2022 04:10                4883
ds-deque.reverse.php                               26-Sep-2022 04:10                3670
ds-deque.reversed.php                              26-Sep-2022 04:10                4038
ds-deque.rotate.php                                26-Sep-2022 04:10                5096
ds-deque.set.php                                   26-Sep-2022 04:10                6153
ds-deque.shift.php                                 26-Sep-2022 04:10                4412
ds-deque.slice.php                                 26-Sep-2022 04:10                7242
ds-deque.sort.php                                  26-Sep-2022 04:10                7553
ds-deque.sorted.php                                26-Sep-2022 04:10                7607
ds-deque.sum.php                                   26-Sep-2022 04:10                5133
ds-deque.toarray.php                               26-Sep-2022 04:10                3860
ds-deque.unshift.php                               26-Sep-2022 04:10                4799
ds-hashable.equals.php                             26-Sep-2022 04:10                3398
ds-hashable.hash.php                               26-Sep-2022 04:10                8546
ds-map.allocate.php                                26-Sep-2022 04:10                4468
ds-map.apply.php                                   26-Sep-2022 04:10                5858
ds-map.capacity.php                                26-Sep-2022 04:10                3196
ds-map.clear.php                                   26-Sep-2022 04:10                4390
ds-map.construct.php                               26-Sep-2022 04:10                4890
ds-map.copy.php                                    26-Sep-2022 04:10                4153
ds-map.count.php                                   26-Sep-2022 04:10                1490
ds-map.diff.php                                    26-Sep-2022 04:10                5648
ds-map.filter.php                                  26-Sep-2022 04:10                8385
ds-map.first.php                                   26-Sep-2022 04:10                4114
ds-map.get.php                                     26-Sep-2022 04:10                8700
ds-map.haskey.php                                  26-Sep-2022 04:10                4642
ds-map.hasvalue.php                                26-Sep-2022 04:10                4686
ds-map.intersect.php                               26-Sep-2022 04:10                6169
ds-map.isempty.php                                 26-Sep-2022 04:10                4338
ds-map.jsonserialize.php                           26-Sep-2022 04:10                1787
ds-map.keys.php                                    26-Sep-2022 04:10                3990
ds-map.ksort.php                                   26-Sep-2022 04:10                8285
ds-map.ksorted.php                                 26-Sep-2022 04:10                8401
ds-map.last.php                                    26-Sep-2022 04:10                4099
ds-map.map.php                                     26-Sep-2022 04:10                6502
ds-map.merge.php                                   26-Sep-2022 04:10                5802
ds-map.pairs.php                                   26-Sep-2022 04:10                4381
ds-map.put.php                                     26-Sep-2022 04:10               14872
ds-map.putall.php                                  26-Sep-2022 04:10                5450
ds-map.reduce.php                                  26-Sep-2022 04:10                9737
ds-map.remove.php                                  26-Sep-2022 04:10                7129
ds-map.reverse.php                                 26-Sep-2022 04:10                4152
ds-map.reversed.php                                26-Sep-2022 04:10                4278
ds-map.skip.php                                    26-Sep-2022 04:10                4607
ds-map.slice.php                                   26-Sep-2022 04:10                8143
ds-map.sort.php                                    26-Sep-2022 04:10                8203
ds-map.sorted.php                                  26-Sep-2022 04:10                8380
ds-map.sum.php                                     26-Sep-2022 04:10                5660
ds-map.toarray.php                                 26-Sep-2022 04:10                4829
ds-map.union.php                                   26-Sep-2022 04:10                6153
ds-map.values.php                                  26-Sep-2022 04:10                3984
ds-map.xor.php                                     26-Sep-2022 04:10                5710
ds-pair.clear.php                                  26-Sep-2022 04:10                3730
ds-pair.construct.php                              26-Sep-2022 04:10                2632
ds-pair.copy.php                                   26-Sep-2022 04:10                4142
ds-pair.isempty.php                                26-Sep-2022 04:10                4031
ds-pair.jsonserialize.php                          26-Sep-2022 04:10                1807
ds-pair.toarray.php                                26-Sep-2022 04:10                3785
ds-priorityqueue.allocate.php                      26-Sep-2022 04:10                4768
ds-priorityqueue.capacity.php                      26-Sep-2022 04:10                3405
ds-priorityqueue.clear.php                         26-Sep-2022 04:10                4501
ds-priorityqueue.construct.php                     26-Sep-2022 04:10                2938
ds-priorityqueue.copy.php                          26-Sep-2022 04:10                4526
ds-priorityqueue.count.php                         26-Sep-2022 04:10                1638
ds-priorityqueue.isempty.php                       26-Sep-2022 04:10                5006
ds-priorityqueue.jsonserialize.php                 26-Sep-2022 04:10                1927
ds-priorityqueue.peek.php                          26-Sep-2022 04:10                4814
ds-priorityqueue.pop.php                           26-Sep-2022 04:10                5584
ds-priorityqueue.push.php                          26-Sep-2022 04:10                5601
ds-priorityqueue.toarray.php                       26-Sep-2022 04:10                4969
ds-queue.allocate.php                              26-Sep-2022 04:10                4795
ds-queue.capacity.php                              26-Sep-2022 04:10                3917
ds-queue.clear.php                                 26-Sep-2022 04:10                3819
ds-queue.construct.php                             26-Sep-2022 04:10                4356
ds-queue.copy.php                                  26-Sep-2022 04:10                4360
ds-queue.count.php                                 26-Sep-2022 04:10                1526
ds-queue.isempty.php                               26-Sep-2022 04:10                4102
ds-queue.jsonserialize.php                         26-Sep-2022 04:10                1837
ds-queue.peek.php                                  26-Sep-2022 04:10                4398
ds-queue.pop.php                                   26-Sep-2022 04:10                4932
ds-queue.push.php                                  26-Sep-2022 04:10                4789
ds-queue.toarray.php                               26-Sep-2022 04:10                4027
ds-sequence.allocate.php                           26-Sep-2022 04:10                4506
ds-sequence.apply.php                              26-Sep-2022 04:10                5201
ds-sequence.capacity.php                           26-Sep-2022 04:10                4476
ds-sequence.contains.php                           26-Sep-2022 04:10                7643
ds-sequence.filter.php                             26-Sep-2022 04:10                7659
ds-sequence.find.php                               26-Sep-2022 04:10                5594
ds-sequence.first.php                              26-Sep-2022 04:10                3941
ds-sequence.get.php                                26-Sep-2022 04:10                6812
ds-sequence.insert.php                             26-Sep-2022 04:10                7144
ds-sequence.join.php                               26-Sep-2022 04:10                5855
ds-sequence.last.php                               26-Sep-2022 04:10                3908
ds-sequence.map.php                                26-Sep-2022 04:10                5591
ds-sequence.merge.php                              26-Sep-2022 04:10                5019
ds-sequence.pop.php                                26-Sep-2022 04:10                4423
ds-sequence.push.php                               26-Sep-2022 04:10                4841
ds-sequence.reduce.php                             26-Sep-2022 04:10                8806
ds-sequence.remove.php                             26-Sep-2022 04:10                4995
ds-sequence.reverse.php                            26-Sep-2022 04:10                3783
ds-sequence.reversed.php                           26-Sep-2022 04:10                4161
ds-sequence.rotate.php                             26-Sep-2022 04:10                5233
ds-sequence.set.php                                26-Sep-2022 04:10                6277
ds-sequence.shift.php                              26-Sep-2022 04:10                4524
ds-sequence.slice.php                              26-Sep-2022 04:10                7407
ds-sequence.sort.php                               26-Sep-2022 04:10                7680
ds-sequence.sorted.php                             26-Sep-2022 04:10                7734
ds-sequence.sum.php                                26-Sep-2022 04:10                5258
ds-sequence.unshift.php                            26-Sep-2022 04:10                4910
ds-set.add.php                                     26-Sep-2022 04:10               13056
ds-set.allocate.php                                26-Sep-2022 04:10                4481
ds-set.capacity.php                                26-Sep-2022 04:10                3870
ds-set.clear.php                                   26-Sep-2022 04:10                3765
ds-set.construct.php                               26-Sep-2022 04:10                4310
ds-set.contains.php                                26-Sep-2022 04:10                7475
ds-set.copy.php                                    26-Sep-2022 04:10                4299
ds-set.count.php                                   26-Sep-2022 04:10                1490
ds-set.diff.php                                    26-Sep-2022 04:10                4878
ds-set.filter.php                                  26-Sep-2022 04:10                7468
ds-set.first.php                                   26-Sep-2022 04:10                3779
ds-set.get.php                                     26-Sep-2022 04:10                6628
ds-set.intersect.php                               26-Sep-2022 04:10                5109
ds-set.isempty.php                                 26-Sep-2022 04:10                4044
ds-set.join.php                                    26-Sep-2022 04:10                5705
ds-set.jsonserialize.php                           26-Sep-2022 04:10                1781
ds-set.last.php                                    26-Sep-2022 04:10                3780
ds-set.merge.php                                   26-Sep-2022 04:10                4819
ds-set.reduce.php                                  26-Sep-2022 04:10                8633
ds-set.remove.php                                  26-Sep-2022 04:10                5230
ds-set.reverse.php                                 26-Sep-2022 04:10                3618
ds-set.reversed.php                                26-Sep-2022 04:10                3976
ds-set.slice.php                                   26-Sep-2022 04:10                7156
ds-set.sort.php                                    26-Sep-2022 04:10                7489
ds-set.sorted.php                                  26-Sep-2022 04:10                7543
ds-set.sum.php                                     26-Sep-2022 04:10                5073
ds-set.toarray.php                                 26-Sep-2022 04:10                3806
ds-set.union.php                                   26-Sep-2022 04:10                5072
ds-set.xor.php                                     26-Sep-2022 04:10                5044
ds-stack.allocate.php                              26-Sep-2022 04:10                2719
ds-stack.capacity.php                              26-Sep-2022 04:10                2076
ds-stack.clear.php                                 26-Sep-2022 04:10                3815
ds-stack.construct.php                             26-Sep-2022 04:10                4322
ds-stack.copy.php                                  26-Sep-2022 04:10                4360
ds-stack.count.php                                 26-Sep-2022 04:10                1526
ds-stack.isempty.php                               26-Sep-2022 04:10                4102
ds-stack.jsonserialize.php                         26-Sep-2022 04:10                1815
ds-stack.peek.php                                  26-Sep-2022 04:10                4392
ds-stack.pop.php                                   26-Sep-2022 04:10                4926
ds-stack.push.php                                  26-Sep-2022 04:10                4754
ds-stack.toarray.php                               26-Sep-2022 04:10                3847
ds-vector.allocate.php                             26-Sep-2022 04:10                4423
ds-vector.apply.php                                26-Sep-2022 04:10                5112
ds-vector.capacity.php                             26-Sep-2022 04:10                4381
ds-vector.clear.php                                26-Sep-2022 04:10                3846
ds-vector.construct.php                            26-Sep-2022 04:10                4390
ds-vector.contains.php                             26-Sep-2022 04:10                7546
ds-vector.copy.php                                 26-Sep-2022 04:10                4384
ds-vector.count.php                                26-Sep-2022 04:10                1543
ds-vector.filter.php                               26-Sep-2022 04:10                7554
ds-vector.find.php                                 26-Sep-2022 04:10                5507
ds-vector.first.php                                26-Sep-2022 04:10                3852
ds-vector.get.php                                  26-Sep-2022 04:10                6715
ds-vector.insert.php                               26-Sep-2022 04:10                7055
ds-vector.isempty.php                              26-Sep-2022 04:10                4110
ds-vector.join.php                                 26-Sep-2022 04:10                5786
ds-vector.jsonserialize.php                        26-Sep-2022 04:10                1823
ds-vector.last.php                                 26-Sep-2022 04:10                3839
ds-vector.map.php                                  26-Sep-2022 04:10                5494
ds-vector.merge.php                                26-Sep-2022 04:10                4924
ds-vector.pop.php                                  26-Sep-2022 04:10                4336
ds-vector.push.php                                 26-Sep-2022 04:10                4748
ds-vector.reduce.php                               26-Sep-2022 04:10                8715
ds-vector.remove.php                               26-Sep-2022 04:10                4908
ds-vector.reverse.php                              26-Sep-2022 04:10                3696
ds-vector.reversed.php                             26-Sep-2022 04:10                4068
ds-vector.rotate.php                               26-Sep-2022 04:10                5130
ds-vector.set.php                                  26-Sep-2022 04:10                6184
ds-vector.shift.php                                26-Sep-2022 04:10                4437
ds-vector.slice.php                                26-Sep-2022 04:10                7288
ds-vector.sort.php                                 26-Sep-2022 04:10                7585
ds-vector.sorted.php                               26-Sep-2022 04:10                7639
ds-vector.sum.php                                  26-Sep-2022 04:10                5163
ds-vector.toarray.php                              26-Sep-2022 04:10                3885
ds-vector.unshift.php                              26-Sep-2022 04:10                4829
ds.constants.php                                   26-Sep-2022 04:10                1119
ds.examples.php                                    26-Sep-2022 04:10                4882
ds.installation.php                                26-Sep-2022 04:10                2489
ds.requirements.php                                26-Sep-2022 04:10                1198
ds.setup.php                                       26-Sep-2022 04:10                1410
eio.configuration.php                              26-Sep-2022 04:10                1271
eio.constants.php                                  26-Sep-2022 04:10               16847
eio.examples.php                                   26-Sep-2022 04:10               30304
eio.installation.php                               26-Sep-2022 04:10                1768
eio.requirements.php                               26-Sep-2022 04:10                1336
eio.resources.php                                  26-Sep-2022 04:10                1236
eio.setup.php                                      26-Sep-2022 04:10                1591
emptyiterator.current.php                          26-Sep-2022 04:10                2764
emptyiterator.key.php                              26-Sep-2022 04:10                2664
emptyiterator.next.php                             26-Sep-2022 04:10                2349
emptyiterator.rewind.php                           26-Sep-2022 04:10                2371
emptyiterator.valid.php                            26-Sep-2022 04:10                2366
enchant.configuration.php                          26-Sep-2022 04:10                1301
enchant.constants.php                              26-Sep-2022 04:10                2203
enchant.examples.php                               26-Sep-2022 04:10                5933
enchant.installation.php                           26-Sep-2022 04:10                1757
enchant.requirements.php                           26-Sep-2022 04:10                1820
enchant.resources.php                              26-Sep-2022 04:10                1329
enchant.setup.php                                  26-Sep-2022 04:10                1645
error.clone.php                                    26-Sep-2022 04:10                2338
error.construct.php                                26-Sep-2022 04:10                3168
error.getcode.php                                  26-Sep-2022 04:10                4158
error.getfile.php                                  26-Sep-2022 04:10                3759
error.getline.php                                  26-Sep-2022 04:10                4043
error.getmessage.php                               26-Sep-2022 04:10                3834
error.getprevious.php                              26-Sep-2022 04:10                6876
error.gettrace.php                                 26-Sep-2022 04:10                4226
error.gettraceasstring.php                         26-Sep-2022 04:10                4125
error.tostring.php                                 26-Sep-2022 04:10                3876
errorexception.construct.php                       26-Sep-2022 04:10                5037
errorexception.getseverity.php                     26-Sep-2022 04:10                4411
errorfunc.configuration.php                        26-Sep-2022 04:10               24420
errorfunc.constants.php                            26-Sep-2022 04:10               10155
errorfunc.examples.php                             26-Sep-2022 04:10               24282
errorfunc.installation.php                         26-Sep-2022 04:10                1287
errorfunc.requirements.php                         26-Sep-2022 04:10                1243
errorfunc.resources.php                            26-Sep-2022 04:10                1247
errorfunc.setup.php                                26-Sep-2022 04:10                1659
ev.backend.php                                     26-Sep-2022 04:10                3434
ev.configuration.php                               26-Sep-2022 04:10                1266
ev.depth.php                                       26-Sep-2022 04:10                3257
ev.embeddablebackends.php                          26-Sep-2022 04:10                6935
ev.examples.php                                    26-Sep-2022 04:10               47767
ev.feedsignal.php                                  26-Sep-2022 04:10                3279
ev.feedsignalevent.php                             26-Sep-2022 04:10                3066
ev.global.constants.php                            26-Sep-2022 04:10                1290
ev.installation.php                                26-Sep-2022 04:10                1757
ev.iteration.php                                   26-Sep-2022 04:10                2569
ev.now.php                                         26-Sep-2022 04:10                3021
ev.nowupdate.php                                   26-Sep-2022 04:10                3153
ev.periodic-modes.php                              26-Sep-2022 04:10                7866
ev.recommendedbackends.php                         26-Sep-2022 04:10                7677
ev.requirements.php                                26-Sep-2022 04:10                1256
ev.resources.php                                   26-Sep-2022 04:10                1205
ev.resume.php                                      26-Sep-2022 04:10                3743
ev.run.php                                         26-Sep-2022 04:10                4773
ev.setup.php                                       26-Sep-2022 04:10                1550
ev.sleep.php                                       26-Sep-2022 04:10                2323
ev.stop.php                                        26-Sep-2022 04:10                2795
ev.supportedbackends.php                           26-Sep-2022 04:10                6917
ev.suspend.php                                     26-Sep-2022 04:10                3476
ev.time.php                                        26-Sep-2022 04:10                2595
ev.verify.php                                      26-Sep-2022 04:10                2218
ev.watcher-callbacks.php                           26-Sep-2022 04:10                4117
ev.watchers.php                                    26-Sep-2022 04:10                3458
evcheck.construct.php                              26-Sep-2022 04:10                3640
evcheck.createstopped.php                          26-Sep-2022 04:10                3512
evchild.construct.php                              26-Sep-2022 04:10                6424
evchild.createstopped.php                          26-Sep-2022 04:10                4952
evchild.set.php                                    26-Sep-2022 04:10                3060
evembed.construct.php                              26-Sep-2022 04:10                8479
evembed.createstopped.php                          26-Sep-2022 04:10                4682
evembed.set.php                                    26-Sep-2022 04:10                2445
evembed.sweep.php                                  26-Sep-2022 04:10                3052
event.add.php                                      26-Sep-2022 04:10               11070
event.addsignal.php                                26-Sep-2022 04:10                1632
event.addtimer.php                                 26-Sep-2022 04:10                1641
event.callbacks.php                                26-Sep-2022 04:10                5402
event.configuration.php                            26-Sep-2022 04:10                1287
event.construct.php                                26-Sep-2022 04:10                4750
event.constructing.signal.events.php               26-Sep-2022 04:10                6853
event.del.php                                      26-Sep-2022 04:10                2451
event.delsignal.php                                26-Sep-2022 04:10                1632
event.deltimer.php                                 26-Sep-2022 04:10                1629
event.examples.php                                 26-Sep-2022 04:10              198934
event.flags.php                                    26-Sep-2022 04:10                2319
event.free.php                                     26-Sep-2022 04:10                2933
event.getsupportedmethods.php                      26-Sep-2022 04:10                2592
event.installation.php                             26-Sep-2022 04:10                1788
event.pending.php                                  26-Sep-2022 04:10                2661
event.persistence.php                              26-Sep-2022 04:10                2752
event.requirements.php                             26-Sep-2022 04:10                1471
event.resources.php                                26-Sep-2022 04:10                1203
event.set.php                                      26-Sep-2022 04:10                4495
event.setpriority.php                              26-Sep-2022 04:10                2363
event.settimer.php                                 26-Sep-2022 04:10                4013
event.setup.php                                    26-Sep-2022 04:10                1588
event.signal.php                                   26-Sep-2022 04:10                4240
event.timer.php                                    26-Sep-2022 04:10                3569
eventbase.construct.php                            26-Sep-2022 04:10                2811
eventbase.dispatch.php                             26-Sep-2022 04:10                3270
eventbase.exit.php                                 26-Sep-2022 04:10                2971
eventbase.free.php                                 26-Sep-2022 04:10                3314
eventbase.getfeatures.php                          26-Sep-2022 04:10                6097
eventbase.getmethod.php                            26-Sep-2022 04:10                4695
eventbase.gettimeofdaycached.php                   26-Sep-2022 04:10                2674
eventbase.gotexit.php                              26-Sep-2022 04:10                3326
eventbase.gotstop.php                              26-Sep-2022 04:10                3284
eventbase.loop.php                                 26-Sep-2022 04:10                3486
eventbase.priorityinit.php                         26-Sep-2022 04:10                2872
eventbase.reinit.php                               26-Sep-2022 04:10                2265
eventbase.stop.php                                 26-Sep-2022 04:10                2776
eventbuffer.add.php                                26-Sep-2022 04:10                2859
eventbuffer.addbuffer.php                          26-Sep-2022 04:10                3285
eventbuffer.appendfrom.php                         26-Sep-2022 04:10                4897
eventbuffer.construct.php                          26-Sep-2022 04:10                2144
eventbuffer.copyout.php                            26-Sep-2022 04:10                3824
eventbuffer.drain.php                              26-Sep-2022 04:10                3375
eventbuffer.enablelocking.php                      26-Sep-2022 04:10                2948
eventbuffer.expand.php                             26-Sep-2022 04:10                2676
eventbuffer.freeze.php                             26-Sep-2022 04:10                2917
eventbuffer.lock.php                               26-Sep-2022 04:10                3035
eventbuffer.prepend.php                            26-Sep-2022 04:10                3364
eventbuffer.prependbuffer.php                      26-Sep-2022 04:10                3586
eventbuffer.pullup.php                             26-Sep-2022 04:10                4611
eventbuffer.read.php                               26-Sep-2022 04:10                4885
eventbuffer.readfrom.php                           26-Sep-2022 04:10                4358
eventbuffer.readline.php                           26-Sep-2022 04:10                4182
eventbuffer.search.php                             26-Sep-2022 04:10                8663
eventbuffer.searcheol.php                          26-Sep-2022 04:10                4606
eventbuffer.substr.php                             26-Sep-2022 04:10                3307
eventbuffer.unfreeze.php                           26-Sep-2022 04:10                2919
eventbuffer.unlock.php                             26-Sep-2022 04:10                2671
eventbuffer.write.php                              26-Sep-2022 04:10                3374
eventbufferevent.about.callbacks.php               26-Sep-2022 04:10                5612
eventbufferevent.close.php                         26-Sep-2022 04:10                2450
eventbufferevent.connect.php                       26-Sep-2022 04:10               27011
eventbufferevent.connecthost.php                   26-Sep-2022 04:10               18486
eventbufferevent.construct.php                     26-Sep-2022 04:10                6921
eventbufferevent.createpair.php                    26-Sep-2022 04:10                4048
eventbufferevent.disable.php                       26-Sep-2022 04:10                3152
eventbufferevent.enable.php                        26-Sep-2022 04:10                3416
eventbufferevent.free.php                          26-Sep-2022 04:10                2757
eventbufferevent.getdnserrorstring.php             26-Sep-2022 04:10                3060
eventbufferevent.getenabled.php                    26-Sep-2022 04:10                3026
eventbufferevent.getinput.php                      26-Sep-2022 04:10                5196
eventbufferevent.getoutput.php                     26-Sep-2022 04:10                8352
eventbufferevent.read.php                          26-Sep-2022 04:10                2975
eventbufferevent.readbuffer.php                    26-Sep-2022 04:10                3102
eventbufferevent.setcallbacks.php                  26-Sep-2022 04:10                4613
eventbufferevent.setpriority.php                   26-Sep-2022 04:10                2750
eventbufferevent.settimeouts.php                   26-Sep-2022 04:10                2916
eventbufferevent.setwatermark.php                  26-Sep-2022 04:10                3826
eventbufferevent.sslerror.php                      26-Sep-2022 04:10                6336
eventbufferevent.sslfilter.php                     26-Sep-2022 04:10               41065
eventbufferevent.sslgetcipherinfo.php              26-Sep-2022 04:10                2821
eventbufferevent.sslgetciphername.php              26-Sep-2022 04:10                2707
eventbufferevent.sslgetcipherversion.php           26-Sep-2022 04:10                2736
eventbufferevent.sslgetprotocol.php                26-Sep-2022 04:10                2665
eventbufferevent.sslrenegotiate.php                26-Sep-2022 04:10                2797
eventbufferevent.sslsocket.php                     26-Sep-2022 04:10                5540
eventbufferevent.write.php                         26-Sep-2022 04:10                3038
eventbufferevent.writebuffer.php                   26-Sep-2022 04:10                3220
eventconfig.avoidmethod.php                        26-Sep-2022 04:10                4277
eventconfig.construct.php                          26-Sep-2022 04:10                4518
eventconfig.requirefeatures.php                    26-Sep-2022 04:10                6098
eventconfig.setflags.php                           26-Sep-2022 04:10                3185
eventconfig.setmaxdispatchinterval.php             26-Sep-2022 04:10                4268
eventdnsbase.addnameserverip.php                   26-Sep-2022 04:10                2770
eventdnsbase.addsearch.php                         26-Sep-2022 04:10                2475
eventdnsbase.clearsearch.php                       26-Sep-2022 04:10                2793
eventdnsbase.construct.php                         26-Sep-2022 04:10                3224
eventdnsbase.countnameservers.php                  26-Sep-2022 04:10                2474
eventdnsbase.loadhosts.php                         26-Sep-2022 04:10                2643
eventdnsbase.parseresolvconf.php                   26-Sep-2022 04:10                4061
eventdnsbase.setoption.php                         26-Sep-2022 04:10                3161
eventdnsbase.setsearchndots.php                    26-Sep-2022 04:10                2707
eventhttp.accept.php                               26-Sep-2022 04:10               13253
eventhttp.addserveralias.php                       26-Sep-2022 04:10                6472
eventhttp.bind.php                                 26-Sep-2022 04:10                7855
eventhttp.construct.php                            26-Sep-2022 04:10               19941
eventhttp.removeserveralias.php                    26-Sep-2022 04:10                3048
eventhttp.setallowedmethods.php                    26-Sep-2022 04:10                3316
eventhttp.setcallback.php                          26-Sep-2022 04:10               19761
eventhttp.setdefaultcallback.php                   26-Sep-2022 04:10                7838
eventhttp.setmaxbodysize.php                       26-Sep-2022 04:10                2846
eventhttp.setmaxheaderssize.php                    26-Sep-2022 04:10                2758
eventhttp.settimeout.php                           26-Sep-2022 04:10                2430
eventhttpconnection.construct.php                  26-Sep-2022 04:10                5224
eventhttpconnection.getbase.php                    26-Sep-2022 04:10                2555
eventhttpconnection.getpeer.php                    26-Sep-2022 04:10                2890
eventhttpconnection.makerequest.php                26-Sep-2022 04:10               12557
eventhttpconnection.setclosecallback.php           26-Sep-2022 04:10               11811
eventhttpconnection.setlocaladdress.php            26-Sep-2022 04:10                3143
eventhttpconnection.setlocalport.php               26-Sep-2022 04:10                3031
eventhttpconnection.setmaxbodysize.php             26-Sep-2022 04:10                3068
eventhttpconnection.setmaxheaderssize.php          26-Sep-2022 04:10                3089
eventhttpconnection.setretries.php                 26-Sep-2022 04:10                2660
eventhttpconnection.settimeout.php                 26-Sep-2022 04:10                2557
eventhttprequest.addheader.php                     26-Sep-2022 04:10                3660
eventhttprequest.cancel.php                        26-Sep-2022 04:10                2811
eventhttprequest.clearheaders.php                  26-Sep-2022 04:10                2778
eventhttprequest.closeconnection.php               26-Sep-2022 04:10                2366
eventhttprequest.construct.php                     26-Sep-2022 04:10               12716
eventhttprequest.findheader.php                    26-Sep-2022 04:10                3364
eventhttprequest.free.php                          26-Sep-2022 04:10                2274
eventhttprequest.getbufferevent.php                26-Sep-2022 04:10                3686
eventhttprequest.getcommand.php                    26-Sep-2022 04:10                2646
eventhttprequest.getconnection.php                 26-Sep-2022 04:10                4455
eventhttprequest.gethost.php                       26-Sep-2022 04:10                2818
eventhttprequest.getinputbuffer.php                26-Sep-2022 04:10                2765
eventhttprequest.getinputheaders.php               26-Sep-2022 04:10                2798
eventhttprequest.getoutputbuffer.php               26-Sep-2022 04:10                2824
eventhttprequest.getoutputheaders.php              26-Sep-2022 04:10                2782
eventhttprequest.getresponsecode.php               26-Sep-2022 04:10                3115
eventhttprequest.geturi.php                        26-Sep-2022 04:10                3026
eventhttprequest.removeheader.php                  26-Sep-2022 04:10                3375
eventhttprequest.senderror.php                     26-Sep-2022 04:10                5700
eventhttprequest.sendreply.php                     26-Sep-2022 04:10                3944
eventhttprequest.sendreplychunk.php                26-Sep-2022 04:10                3426
eventhttprequest.sendreplyend.php                  26-Sep-2022 04:10                3026
eventhttprequest.sendreplystart.php                26-Sep-2022 04:10                4199
eventlistener.construct.php                        26-Sep-2022 04:10               27668
eventlistener.disable.php                          26-Sep-2022 04:10                2655
eventlistener.enable.php                           26-Sep-2022 04:10                2641
eventlistener.getbase.php                          26-Sep-2022 04:10                2285
eventlistener.getsocketname.php                    26-Sep-2022 04:10                3183
eventlistener.setcallback.php                      26-Sep-2022 04:10                5717
eventlistener.seterrorcallback.php                 26-Sep-2022 04:10                4243
eventsslcontext.construct.php                      26-Sep-2022 04:10                5822
eventutil.construct.php                            26-Sep-2022 04:10                2327
eventutil.getlastsocketerrno.php                   26-Sep-2022 04:10                3237
eventutil.getlastsocketerror.php                   26-Sep-2022 04:10                3102
eventutil.getsocketfd.php                          26-Sep-2022 04:10                3139
eventutil.getsocketname.php                        26-Sep-2022 04:10                3631
eventutil.setsocketoption.php                      26-Sep-2022 04:10                5498
eventutil.sslrandpoll.php                          26-Sep-2022 04:10                2316
evfork.construct.php                               26-Sep-2022 04:10                3615
evfork.createstopped.php                           26-Sep-2022 04:10                3714
evidle.construct.php                               26-Sep-2022 04:10                3670
evidle.createstopped.php                           26-Sep-2022 04:10                4030
evio.construct.php                                 26-Sep-2022 04:10                4718
evio.createstopped.php                             26-Sep-2022 04:10                5096
evio.set.php                                       26-Sep-2022 04:10                2787
evloop.backend.php                                 26-Sep-2022 04:10                2659
evloop.check.php                                   26-Sep-2022 04:10                3116
evloop.child.php                                   26-Sep-2022 04:10                3478
evloop.construct.php                               26-Sep-2022 04:10                3910
evloop.defaultloop.php                             26-Sep-2022 04:10                4509
evloop.embed.php                                   26-Sep-2022 04:10                3581
evloop.fork.php                                    26-Sep-2022 04:10                3310
evloop.idle.php                                    26-Sep-2022 04:10                3330
evloop.invokepending.php                           26-Sep-2022 04:10                2181
evloop.io.php                                      26-Sep-2022 04:10                3749
evloop.loopfork.php                                26-Sep-2022 04:10                2481
evloop.now.php                                     26-Sep-2022 04:10                2765
evloop.nowupdate.php                               26-Sep-2022 04:10                3130
evloop.periodic.php                                26-Sep-2022 04:10                3788
evloop.prepare.php                                 26-Sep-2022 04:10                3336
evloop.resume.php                                  26-Sep-2022 04:10                2790
evloop.run.php                                     26-Sep-2022 04:10                4739
evloop.signal.php                                  26-Sep-2022 04:10                3580
evloop.stat.php                                    26-Sep-2022 04:10                3701
evloop.stop.php                                    26-Sep-2022 04:10                2922
evloop.suspend.php                                 26-Sep-2022 04:10                2782
evloop.timer.php                                   26-Sep-2022 04:10                3715
evloop.verify.php                                  26-Sep-2022 04:10                2557
evperiodic.again.php                               26-Sep-2022 04:10                2530
evperiodic.at.php                                  26-Sep-2022 04:10                2553
evperiodic.construct.php                           26-Sep-2022 04:10               10165
evperiodic.createstopped.php                       26-Sep-2022 04:10                5652
evperiodic.set.php                                 26-Sep-2022 04:10                3045
evprepare.construct.php                            26-Sep-2022 04:10                3673
evprepare.createstopped.php                        26-Sep-2022 04:10                4319
evsignal.construct.php                             26-Sep-2022 04:10                5794
evsignal.createstopped.php                         26-Sep-2022 04:10                4755
evsignal.set.php                                   26-Sep-2022 04:10                2401
evstat.attr.php                                    26-Sep-2022 04:10                8664
evstat.construct.php                               26-Sep-2022 04:10                7409
evstat.createstopped.php                           26-Sep-2022 04:10                5046
evstat.prev.php                                    26-Sep-2022 04:10                2911
evstat.set.php                                     26-Sep-2022 04:10                2720
evstat.stat.php                                    26-Sep-2022 04:10                2831
evtimer.again.php                                  26-Sep-2022 04:10                3025
evtimer.construct.php                              26-Sep-2022 04:10               13504
evtimer.createstopped.php                          26-Sep-2022 04:10                8506
evtimer.set.php                                    26-Sep-2022 04:10                2862
evwatcher.clear.php                                26-Sep-2022 04:10                2742
evwatcher.construct.php                            26-Sep-2022 04:10                2076
evwatcher.feed.php                                 26-Sep-2022 04:10                2512
evwatcher.getloop.php                              26-Sep-2022 04:10                2284
evwatcher.invoke.php                               26-Sep-2022 04:10                2519
evwatcher.keepalive.php                            26-Sep-2022 04:10                5121
evwatcher.setcallback.php                          26-Sep-2022 04:10                2532
evwatcher.start.php                                26-Sep-2022 04:10                2472
evwatcher.stop.php                                 26-Sep-2022 04:10                2441
example.xml-external-entity.php                    26-Sep-2022 04:11               26013
example.xml-map-tags.php                           26-Sep-2022 04:11                9139
example.xml-structure.php                          26-Sep-2022 04:11                7690
example.xmlwriter-namespace.php                    26-Sep-2022 04:11                5495
example.xmlwriter-oop.php                          26-Sep-2022 04:11                3402
example.xmlwriter-simple.php                       26-Sep-2022 04:11                8921
exception.clone.php                                26-Sep-2022 04:10                2399
exception.construct.php                            26-Sep-2022 04:10                4307
exception.getcode.php                              26-Sep-2022 04:10                4702
exception.getfile.php                              26-Sep-2022 04:10                3882
exception.getline.php                              26-Sep-2022 04:10                4163
exception.getmessage.php                           26-Sep-2022 04:10                3955
exception.getprevious.php                          26-Sep-2022 04:10                7571
exception.gettrace.php                             26-Sep-2022 04:10                4359
exception.gettraceasstring.php                     26-Sep-2022 04:10                4266
exception.tostring.php                             26-Sep-2022 04:10                4061
exec.configuration.php                             26-Sep-2022 04:10                1280
exec.constants.php                                 26-Sep-2022 04:10                1172
exec.installation.php                              26-Sep-2022 04:10                1252
exec.requirements.php                              26-Sep-2022 04:10                1208
exec.resources.php                                 26-Sep-2022 04:10                1347
exec.setup.php                                     26-Sep-2022 04:10                1620
exif.configuration.php                             26-Sep-2022 04:10                7475
exif.constants.php                                 26-Sep-2022 04:10                1715
exif.installation.php                              26-Sep-2022 04:10                1701
exif.requirements.php                              26-Sep-2022 04:10                1414
exif.resources.php                                 26-Sep-2022 04:10                1212
exif.setup.php                                     26-Sep-2022 04:10                1610
expect.configuration.php                           26-Sep-2022 04:10                5199
expect.constants.php                               26-Sep-2022 04:10                3301
expect.examples-usage.php                          26-Sep-2022 04:10               17190
expect.examples.php                                26-Sep-2022 04:10                1366
expect.installation.php                            26-Sep-2022 04:10                2464
expect.requirements.php                            26-Sep-2022 04:10                1340
expect.resources.php                               26-Sep-2022 04:10                1422
expect.setup.php                                   26-Sep-2022 04:10                1637
extensions.alphabetical.php                        26-Sep-2022 04:11               20663
extensions.membership.php                          26-Sep-2022 04:11               20360
extensions.php                                     26-Sep-2022 04:11                1689
extensions.state.php                               26-Sep-2022 04:11                2667
fann.configuration.php                             26-Sep-2022 04:10                1280
fann.constants.php                                 26-Sep-2022 04:10               18938
fann.examples-1.php                                26-Sep-2022 04:10                9148
fann.examples.php                                  26-Sep-2022 04:10                1322
fann.installation.php                              26-Sep-2022 04:10                5101
fann.requirements.php                              26-Sep-2022 04:10                1177
fann.resources.php                                 26-Sep-2022 04:10                1161
fann.setup.php                                     26-Sep-2022 04:10                1584
fannconnection.construct.php                       26-Sep-2022 04:10                2847
fannconnection.getfromneuron.php                   26-Sep-2022 04:10                2301
fannconnection.gettoneuron.php                     26-Sep-2022 04:10                2282
fannconnection.getweight.php                       26-Sep-2022 04:10                2248
fannconnection.setweight.php                       26-Sep-2022 04:10                2914
faq.build.php                                      26-Sep-2022 04:11               23916
faq.com.php                                        26-Sep-2022 04:11               11801
faq.databases.php                                  26-Sep-2022 04:11                7778
faq.general.php                                    26-Sep-2022 04:11                4921
faq.html.php                                       26-Sep-2022 04:11               20881
faq.installation.php                               26-Sep-2022 04:11               26548
faq.mailinglist.php                                26-Sep-2022 04:11               11416
faq.misc.php                                       26-Sep-2022 04:11                4778
faq.obtaining.php                                  26-Sep-2022 04:11               10672
faq.passwords.php                                  26-Sep-2022 04:11               10048
faq.php                                            26-Sep-2022 04:11                2037
faq.using.php                                      26-Sep-2022 04:11               24059
fdf.configuration.php                              26-Sep-2022 04:10                1273
fdf.constants.php                                  26-Sep-2022 04:10                6459
fdf.examples.php                                   26-Sep-2022 04:10                6709
fdf.installation.php                               26-Sep-2022 04:10                3573
fdf.requirements.php                               26-Sep-2022 04:10                1573
fdf.resources.php                                  26-Sep-2022 04:10                1751
fdf.setup.php                                      26-Sep-2022 04:10                1589
features.commandline.differences.php               26-Sep-2022 04:10               11638
features.commandline.ini.php                       26-Sep-2022 04:10                2240
features.commandline.interactive.php               26-Sep-2022 04:10                7907
features.commandline.introduction.php              26-Sep-2022 04:10                6207
features.commandline.io-streams.php                26-Sep-2022 04:10                5783
features.commandline.options.php                   26-Sep-2022 04:10               27528
features.commandline.php                           26-Sep-2022 04:10                2049
features.commandline.usage.php                     26-Sep-2022 04:10               14711
features.commandline.webserver.php                 26-Sep-2022 04:10               11971
features.connection-handling.php                   26-Sep-2022 04:10                5588
features.cookies.php                               26-Sep-2022 04:10                3062
features.dtrace.dtrace.php                         26-Sep-2022 04:10               14712
features.dtrace.introduction.php                   26-Sep-2022 04:10                3681
features.dtrace.php                                26-Sep-2022 04:10                1671
features.dtrace.systemtap.php                      26-Sep-2022 04:10                8186
features.file-upload.common-pitfalls.php           26-Sep-2022 04:10                5583
features.file-upload.errors.php                    26-Sep-2022 04:10                3712
features.file-upload.errors.seealso.php            26-Sep-2022 04:10                1347
features.file-upload.multiple.php                  26-Sep-2022 04:10                4708
features.file-upload.php                           26-Sep-2022 04:10                1888
features.file-upload.post-method.php               26-Sep-2022 04:10               16586
features.file-upload.put-method.php                26-Sep-2022 04:10                6138
features.gc.collecting-cycles.php                  26-Sep-2022 04:10                8278
features.gc.performance-considerations.php         26-Sep-2022 04:10               14458
features.gc.php                                    26-Sep-2022 04:10                1863
features.gc.refcounting-basics.php                 26-Sep-2022 04:10               21640
features.http-auth.php                             26-Sep-2022 04:10               25834
features.persistent-connections.php                26-Sep-2022 04:10                8669
features.php                                       26-Sep-2022 04:10                4257
features.remote-files.php                          26-Sep-2022 04:10                8628
features.sessions.php                              26-Sep-2022 04:10                1388
features.xforms.php                                26-Sep-2022 04:10                5405
ffi-ctype.getalignment.php                         26-Sep-2022 04:10                2281
ffi-ctype.getarrayelementtype.php                  26-Sep-2022 04:10                2425
ffi-ctype.getarraylength.php                       26-Sep-2022 04:10                2324
ffi-ctype.getattributes.php                        26-Sep-2022 04:10                2300
ffi-ctype.getenumkind.php                          26-Sep-2022 04:10                2276
ffi-ctype.getfuncabi.php                           26-Sep-2022 04:10                2284
ffi-ctype.getfuncparametercount.php                26-Sep-2022 04:10                2390
ffi-ctype.getfuncparametertype.php                 26-Sep-2022 04:10                2637
ffi-ctype.getfuncreturntype.php                    26-Sep-2022 04:10                2407
ffi-ctype.getkind.php                              26-Sep-2022 04:10                2238
ffi-ctype.getname.php                              26-Sep-2022 04:10                2242
ffi-ctype.getpointertype.php                       26-Sep-2022 04:10                2351
ffi-ctype.getsize.php                              26-Sep-2022 04:10                2256
ffi-ctype.getstructfieldnames.php                  26-Sep-2022 04:10                2366
ffi-ctype.getstructfieldoffset.php                 26-Sep-2022 04:10                2573
ffi-ctype.getstructfieldtype.php                   26-Sep-2022 04:10                2593
ffi.addr.php                                       26-Sep-2022 04:10                2754
ffi.alignof.php                                    26-Sep-2022 04:10                2826
ffi.arraytype.php                                  26-Sep-2022 04:10                4445
ffi.cast.php                                       26-Sep-2022 04:10                4891
ffi.cdef.php                                       26-Sep-2022 04:10                4137
ffi.configuration.php                              26-Sep-2022 04:10                4170
ffi.constants.php                                  26-Sep-2022 04:10                1110
ffi.examples-basic.php                             26-Sep-2022 04:10               17173
ffi.examples-callback.php                          26-Sep-2022 04:10                5050
ffi.examples-complete.php                          26-Sep-2022 04:10                5821
ffi.examples.php                                   26-Sep-2022 04:10                1469
ffi.free.php                                       26-Sep-2022 04:10                2371
ffi.installation.php                               26-Sep-2022 04:10                1434
ffi.isnull.php                                     26-Sep-2022 04:10                2355
ffi.load.php                                       26-Sep-2022 04:10                4149
ffi.memcmp.php                                     26-Sep-2022 04:10                3745
ffi.memcpy.php                                     26-Sep-2022 04:10                3113
ffi.memset.php                                     26-Sep-2022 04:10                2955
ffi.new.php                                        26-Sep-2022 04:10                5276
ffi.requirements.php                               26-Sep-2022 04:10                1275
ffi.resources.php                                  26-Sep-2022 04:10                1205
ffi.scope.php                                      26-Sep-2022 04:10                3061
ffi.setup.php                                      26-Sep-2022 04:10                1577
ffi.sizeof.php                                     26-Sep-2022 04:10                2667
ffi.string.php                                     26-Sep-2022 04:10                3650
ffi.type.php                                       26-Sep-2022 04:10                3519
ffi.typeof.php                                     26-Sep-2022 04:10                2818
fileinfo.configuration.php                         26-Sep-2022 04:10                1308
fileinfo.constants.php                             26-Sep-2022 04:10                4730
fileinfo.installation.php                          26-Sep-2022 04:10                2630
fileinfo.requirements.php                          26-Sep-2022 04:10                1292
fileinfo.resources.php                             26-Sep-2022 04:10                1378
fileinfo.setup.php                                 26-Sep-2022 04:10                1653
filesystem.configuration.php                       26-Sep-2022 04:10                7042
filesystem.constants.php                           26-Sep-2022 04:10                9126
filesystem.installation.php                        26-Sep-2022 04:10                1294
filesystem.requirements.php                        26-Sep-2022 04:10                1250
filesystem.resources.php                           26-Sep-2022 04:10                1414
filesystem.setup.php                               26-Sep-2022 04:10                1694
filesystemiterator.construct.php                   26-Sep-2022 04:10                5971
filesystemiterator.current.php                     26-Sep-2022 04:10                5298
filesystemiterator.getflags.php                    26-Sep-2022 04:10                3179
filesystemiterator.key.php                         26-Sep-2022 04:10                5323
filesystemiterator.next.php                        26-Sep-2022 04:10                4547
filesystemiterator.rewind.php                      26-Sep-2022 04:10                5157
filesystemiterator.setflags.php                    26-Sep-2022 04:10                6835
filter.configuration.php                           26-Sep-2022 04:10                5130
filter.constants.php                               26-Sep-2022 04:10               15105
filter.examples.php                                26-Sep-2022 04:10                1435
filter.examples.sanitization.php                   26-Sep-2022 04:10                6069
filter.examples.validation.php                     26-Sep-2022 04:10               10623
filter.filters.flags.php                           26-Sep-2022 04:10               11835
filter.filters.misc.php                            26-Sep-2022 04:10                1839
filter.filters.php                                 26-Sep-2022 04:10                1609
filter.filters.sanitize.php                        26-Sep-2022 04:10                8485
filter.filters.validate.php                        26-Sep-2022 04:10               11011
filter.installation.php                            26-Sep-2022 04:10                1369
filter.requirements.php                            26-Sep-2022 04:10                1222
filter.resources.php                               26-Sep-2022 04:10                1217
filter.setup.php                                   26-Sep-2022 04:10                1620
filteriterator.accept.php                          26-Sep-2022 04:10                5496
filteriterator.construct.php                       26-Sep-2022 04:10                3365
filteriterator.current.php                         26-Sep-2022 04:10                3095
filteriterator.getinneriterator.php                26-Sep-2022 04:10                2513
filteriterator.key.php                             26-Sep-2022 04:10                3021
filteriterator.next.php                            26-Sep-2022 04:10                2962
filteriterator.rewind.php                          26-Sep-2022 04:10                3147
filteriterator.valid.php                           26-Sep-2022 04:10                2467
filters.compression.php                            26-Sep-2022 04:11               16783
filters.convert.php                                26-Sep-2022 04:11               12175
filters.encryption.php                             26-Sep-2022 04:11               46335
filters.php                                        26-Sep-2022 04:11                3458
filters.string.php                                 26-Sep-2022 04:11               10822
finfo.buffer.php                                   26-Sep-2022 04:10                2311
finfo.construct.php                                26-Sep-2022 04:10                2193
finfo.file.php                                     26-Sep-2022 04:10                2303
finfo.set-flags.php                                26-Sep-2022 04:10                1945
fpm.observability.php                              26-Sep-2022 04:10                1396
fpm.setup.php                                      26-Sep-2022 04:10                1299
fpm.status.php                                     26-Sep-2022 04:10               10611
ftp.configuration.php                              26-Sep-2022 04:10                1273
ftp.constants.php                                  26-Sep-2022 04:10                3779
ftp.examples-basic.php                             26-Sep-2022 04:10                5483
ftp.examples.php                                   26-Sep-2022 04:10                1320
ftp.installation.php                               26-Sep-2022 04:10                1485
ftp.requirements.php                               26-Sep-2022 04:10                1201
ftp.resources.php                                  26-Sep-2022 04:10                1475
ftp.setup.php                                      26-Sep-2022 04:10                1588
funchand.configuration.php                         26-Sep-2022 04:10                1308
funchand.constants.php                             26-Sep-2022 04:10                1180
funchand.installation.php                          26-Sep-2022 04:10                1280
funchand.requirements.php                          26-Sep-2022 04:10                1236
funchand.resources.php                             26-Sep-2022 04:10                1240
funchand.setup.php                                 26-Sep-2022 04:10                1642
funcref.php                                        26-Sep-2022 04:11               14692
function.abs.php                                   26-Sep-2022 04:10                4651
function.acos.php                                  26-Sep-2022 04:10                3377
function.acosh.php                                 26-Sep-2022 04:10                3197
function.addcslashes.php                           26-Sep-2022 04:10                8437
function.addslashes.php                            26-Sep-2022 04:10                7757
function.apache-child-terminate.php                26-Sep-2022 04:10                4160
function.apache-get-modules.php                    26-Sep-2022 04:10                3121
function.apache-get-version.php                    26-Sep-2022 04:10                3533
function.apache-getenv.php                         26-Sep-2022 04:10                5045
function.apache-lookup-uri.php                     26-Sep-2022 04:10                5765
function.apache-note.php                           26-Sep-2022 04:10                6559
function.apache-request-headers.php                26-Sep-2022 04:10                5539
function.apache-response-headers.php               26-Sep-2022 04:10                4075
function.apache-setenv.php                         26-Sep-2022 04:10                5453
function.apcu-add.php                              26-Sep-2022 04:10                8224
function.apcu-cache-info.php                       26-Sep-2022 04:10                6479
function.apcu-cas.php                              26-Sep-2022 04:10                8898
function.apcu-clear-cache.php                      26-Sep-2022 04:10                2491
function.apcu-dec.php                              26-Sep-2022 04:10                8420
function.apcu-delete.php                           26-Sep-2022 04:10                5752
function.apcu-enabled.php                          26-Sep-2022 04:10                2202
function.apcu-entry.php                            26-Sep-2022 04:10                8791
function.apcu-exists.php                           26-Sep-2022 04:10                7017
function.apcu-fetch.php                            26-Sep-2022 04:10                5681
function.apcu-inc.php                              26-Sep-2022 04:10                7982
function.apcu-key-info.php                         26-Sep-2022 04:10                4752
function.apcu-sma-info.php                         26-Sep-2022 04:10                4285
function.apcu-store.php                            26-Sep-2022 04:10                7011
function.array-change-key-case.php                 26-Sep-2022 04:10                5477
function.array-chunk.php                           26-Sep-2022 04:10                6591
function.array-column.php                          26-Sep-2022 04:10               18611
function.array-combine.php                         26-Sep-2022 04:10                6754
function.array-count-values.php                    26-Sep-2022 04:10                5526
function.array-diff-assoc.php                      26-Sep-2022 04:10               11149
function.array-diff-key.php                        26-Sep-2022 04:10               13298
function.array-diff-uassoc.php                     26-Sep-2022 04:10               12779
function.array-diff-ukey.php                       26-Sep-2022 04:10               13037
function.array-diff.php                            26-Sep-2022 04:10                7171
function.array-fill-keys.php                       26-Sep-2022 04:10                5265
function.array-fill.php                            26-Sep-2022 04:10                7506
function.array-filter.php                          26-Sep-2022 04:10               16404
function.array-flip.php                            26-Sep-2022 04:10                7272
function.array-intersect-assoc.php                 26-Sep-2022 04:10                8914
function.array-intersect-key.php                   26-Sep-2022 04:10               10572
function.array-intersect-uassoc.php                26-Sep-2022 04:10                9299
function.array-intersect-ukey.php                  26-Sep-2022 04:10               12802
function.array-intersect.php                       26-Sep-2022 04:10                6731
function.array-is-list.php                         26-Sep-2022 04:10                7015
function.array-key-exists.php                      26-Sep-2022 04:10                8711
function.array-key-first.php                       26-Sep-2022 04:10                7256
function.array-key-last.php                        26-Sep-2022 04:10                3144
function.array-keys.php                            26-Sep-2022 04:10                8477
function.array-map.php                             26-Sep-2022 04:10               20770
function.array-merge-recursive.php                 26-Sep-2022 04:10                6525
function.array-merge.php                           26-Sep-2022 04:10               12528
function.array-multisort.php                       26-Sep-2022 04:10               24704
function.array-pad.php                             26-Sep-2022 04:10                7055
function.array-pop.php                             26-Sep-2022 04:10                6024
function.array-product.php                         26-Sep-2022 04:10                4831
function.array-push.php                            26-Sep-2022 04:10                6781
function.array-rand.php                            26-Sep-2022 04:10                6720
function.array-reduce.php                          26-Sep-2022 04:10               10615
function.array-replace-recursive.php               26-Sep-2022 04:10               11369
function.array-replace.php                         26-Sep-2022 04:10                6879
function.array-reverse.php                         26-Sep-2022 04:10                5993
function.array-search.php                          26-Sep-2022 04:10                9038
function.array-shift.php                           26-Sep-2022 04:10                5778
function.array-slice.php                           26-Sep-2022 04:10               10454
function.array-splice.php                          26-Sep-2022 04:10               16656
function.array-sum.php                             26-Sep-2022 04:10                4999
function.array-udiff-assoc.php                     26-Sep-2022 04:10               15493
function.array-udiff-uassoc.php                    26-Sep-2022 04:10               16988
function.array-udiff.php                           26-Sep-2022 04:10               30190
function.array-uintersect-assoc.php                26-Sep-2022 04:10                8622
function.array-uintersect-uassoc.php               26-Sep-2022 04:10                8905
function.array-uintersect.php                      26-Sep-2022 04:10                8155
function.array-unique.php                          26-Sep-2022 04:10               10033
function.array-unshift.php                         26-Sep-2022 04:10                6083
function.array-values.php                          26-Sep-2022 04:10                4525
function.array-walk-recursive.php                  26-Sep-2022 04:10                7513
function.array-walk.php                            26-Sep-2022 04:10               11678
function.array.php                                 26-Sep-2022 04:10               12042
function.arsort.php                                26-Sep-2022 04:10                6269
function.asin.php                                  26-Sep-2022 04:10                3367
function.asinh.php                                 26-Sep-2022 04:10                3189
function.asort.php                                 26-Sep-2022 04:10                6253
function.assert-options.php                        26-Sep-2022 04:10                8870
function.assert.php                                26-Sep-2022 04:10               25539
function.atan.php                                  26-Sep-2022 04:10                3384
function.atan2.php                                 26-Sep-2022 04:10                3270
function.atanh.php                                 26-Sep-2022 04:10                3222
function.autoload.php                              26-Sep-2022 04:10                3077
function.base-convert.php                          26-Sep-2022 04:10                5855
function.base64-decode.php                         26-Sep-2022 04:10                5234
function.base64-encode.php                         26-Sep-2022 04:10                4678
function.basename.php                              26-Sep-2022 04:10                7332
function.bcadd.php                                 26-Sep-2022 04:10                5163
function.bccomp.php                                26-Sep-2022 04:10                5045
function.bcdiv.php                                 26-Sep-2022 04:10                4639
function.bcmod.php                                 26-Sep-2022 04:10                4234
function.bcmul.php                                 26-Sep-2022 04:10                4856
function.bcpow.php                                 26-Sep-2022 04:10                6244
function.bcpowmod.php                              26-Sep-2022 04:10                6591
function.bcscale.php                               26-Sep-2022 04:10                4085
function.bcsqrt.php                                26-Sep-2022 04:10                4225
function.bcsub.php                                 26-Sep-2022 04:10                5163
function.bin2hex.php                               26-Sep-2022 04:10                3013
function.bind-textdomain-codeset.php               26-Sep-2022 04:10                3056
function.bindec.php                                26-Sep-2022 04:10               14967
function.bindtextdomain.php                        26-Sep-2022 04:10                5224
function.boolval.php                               26-Sep-2022 04:11               10682
function.bzclose.php                               26-Sep-2022 04:10                2864
function.bzcompress.php                            26-Sep-2022 04:10                5041
function.bzdecompress.php                          26-Sep-2022 04:10                5551
function.bzerrno.php                               26-Sep-2022 04:10                3073
function.bzerror.php                               26-Sep-2022 04:10                4330
function.bzerrstr.php                              26-Sep-2022 04:10                3080
function.bzflush.php                               26-Sep-2022 04:10                3146
function.bzopen.php                                26-Sep-2022 04:10                4843
function.bzread.php                                26-Sep-2022 04:10                6455
function.bzwrite.php                               26-Sep-2022 04:10                5427
function.cal-days-in-month.php                     26-Sep-2022 04:10                4534
function.cal-from-jd.php                           26-Sep-2022 04:10                6642
function.cal-info.php                              26-Sep-2022 04:10                5802
function.cal-to-jd.php                             26-Sep-2022 04:10                5458
function.call-user-func-array.php                  26-Sep-2022 04:10               14399
function.call-user-func.php                        26-Sep-2022 04:10               15874
function.ceil.php                                  26-Sep-2022 04:10                4424
function.chdir.php                                 26-Sep-2022 04:10                4595
function.checkdate.php                             26-Sep-2022 04:10                5277
function.checkdnsrr.php                            26-Sep-2022 04:10                5640
function.chgrp.php                                 26-Sep-2022 04:10                6476
function.chmod.php                                 26-Sep-2022 04:10                8896
function.chop.php                                  26-Sep-2022 04:10                2043
function.chown.php                                 26-Sep-2022 04:10                6555
function.chr.php                                   26-Sep-2022 04:10                4737
function.chroot.php                                26-Sep-2022 04:10                3903
function.chunk-split.php                           26-Sep-2022 04:10                5352
function.class-alias.php                           26-Sep-2022 04:10                7333
function.class-exists.php                          26-Sep-2022 04:10                7827
function.class-implements.php                      26-Sep-2022 04:10                7231
function.class-parents.php                         26-Sep-2022 04:10                6914
function.class-uses.php                            26-Sep-2022 04:10                6403
function.clearstatcache.php                        26-Sep-2022 04:10               11494
function.cli-get-process-title.php                 26-Sep-2022 04:10                4305
function.cli-set-process-title.php                 26-Sep-2022 04:10                5668
function.closedir.php                              26-Sep-2022 04:10                4618
function.closelog.php                              26-Sep-2022 04:10                2659
function.com-create-guid.php                       26-Sep-2022 04:11                2413
function.com-event-sink.php                        26-Sep-2022 04:11                9529
function.com-get-active-object.php                 26-Sep-2022 04:11                4977
function.com-load-typelib.php                      26-Sep-2022 04:11                4864
function.com-message-pump.php                      26-Sep-2022 04:11                3751
function.com-print-typeinfo.php                    26-Sep-2022 04:11                4435
function.commonmark-parse.php                      26-Sep-2022 04:10                3565
function.commonmark-render-html.php                26-Sep-2022 04:10                3992
function.commonmark-render-latex.php               26-Sep-2022 04:10                4268
function.commonmark-render-man.php                 26-Sep-2022 04:10                4250
function.commonmark-render-xml.php                 26-Sep-2022 04:10                3949
function.commonmark-render.php                     26-Sep-2022 04:10                4196
function.compact.php                               26-Sep-2022 04:10                6937
function.connection-aborted.php                    26-Sep-2022 04:10                2839
function.connection-status.php                     26-Sep-2022 04:10                2970
function.constant.php                              26-Sep-2022 04:10                6659
function.convert-cyr-string.php                    26-Sep-2022 04:10                4638
function.convert-uudecode.php                      26-Sep-2022 04:10                3870
function.convert-uuencode.php                      26-Sep-2022 04:10                4271
function.copy.php                                  26-Sep-2022 04:10                6451
function.cos.php                                   26-Sep-2022 04:10                3929
function.cosh.php                                  26-Sep-2022 04:10                3060
function.count-chars.php                           26-Sep-2022 04:10                6872
function.count.php                                 26-Sep-2022 04:10               11975
function.crc32.php                                 26-Sep-2022 04:10                7256
function.create-function.php                       26-Sep-2022 04:10               18429
function.crypt.php                                 26-Sep-2022 04:10               22453
function.ctype-alnum.php                           26-Sep-2022 04:10                6176
function.ctype-alpha.php                           26-Sep-2022 04:10                6535
function.ctype-cntrl.php                           26-Sep-2022 04:10                6184
function.ctype-digit.php                           26-Sep-2022 04:10                9678
function.ctype-graph.php                           26-Sep-2022 04:10                6952
function.ctype-lower.php                           26-Sep-2022 04:10                6285
function.ctype-print.php                           26-Sep-2022 04:10                7009
function.ctype-punct.php                           26-Sep-2022 04:10                6276
function.ctype-space.php                           26-Sep-2022 04:10                7128
function.ctype-upper.php                           26-Sep-2022 04:10                6329
function.ctype-xdigit.php                          26-Sep-2022 04:10                6074
function.cubrid-affected-rows.php                  26-Sep-2022 04:10                9410
function.cubrid-bind.php                           26-Sep-2022 04:10               21534
function.cubrid-client-encoding.php                26-Sep-2022 04:10                5298
function.cubrid-close-prepare.php                  26-Sep-2022 04:10                6735
function.cubrid-close-request.php                  26-Sep-2022 04:10                6731
function.cubrid-close.php                          26-Sep-2022 04:10                6614
function.cubrid-col-get.php                        26-Sep-2022 04:10                8588
function.cubrid-col-size.php                       26-Sep-2022 04:10                8730
function.cubrid-column-names.php                   26-Sep-2022 04:10                8795
function.cubrid-column-types.php                   26-Sep-2022 04:10                8776
function.cubrid-commit.php                         26-Sep-2022 04:10               16386
function.cubrid-connect-with-url.php               26-Sep-2022 04:10               16110
function.cubrid-connect.php                        26-Sep-2022 04:10               12433
function.cubrid-current-oid.php                    26-Sep-2022 04:10                5963
function.cubrid-data-seek.php                      26-Sep-2022 04:10                7286
function.cubrid-db-name.php                        26-Sep-2022 04:10                6509
function.cubrid-disconnect.php                     26-Sep-2022 04:10                7593
function.cubrid-drop.php                           26-Sep-2022 04:10               11650
function.cubrid-errno.php                          26-Sep-2022 04:10                7110
function.cubrid-error-code-facility.php            26-Sep-2022 04:10                6049
function.cubrid-error-code.php                     26-Sep-2022 04:10                6064
function.cubrid-error-msg.php                      26-Sep-2022 04:10                5467
function.cubrid-error.php                          26-Sep-2022 04:10                6673
function.cubrid-execute.php                        26-Sep-2022 04:10               14230
function.cubrid-fetch-array.php                    26-Sep-2022 04:10               10092
function.cubrid-fetch-assoc.php                    26-Sep-2022 04:10                9293
function.cubrid-fetch-field.php                    26-Sep-2022 04:10               14366
function.cubrid-fetch-lengths.php                  26-Sep-2022 04:10                4518
function.cubrid-fetch-object.php                   26-Sep-2022 04:10               12402
function.cubrid-fetch-row.php                      26-Sep-2022 04:10                9168
function.cubrid-fetch.php                          26-Sep-2022 04:10               10438
function.cubrid-field-flags.php                    26-Sep-2022 04:10                7753
function.cubrid-field-len.php                      26-Sep-2022 04:10                8310
function.cubrid-field-name.php                     26-Sep-2022 04:10                7165
function.cubrid-field-seek.php                     26-Sep-2022 04:10               10911
function.cubrid-field-table.php                    26-Sep-2022 04:10                7248
function.cubrid-field-type.php                     26-Sep-2022 04:10                7320
function.cubrid-free-result.php                    26-Sep-2022 04:10                5685
function.cubrid-get-autocommit.php                 26-Sep-2022 04:10                3738
function.cubrid-get-charset.php                    26-Sep-2022 04:10                5070
function.cubrid-get-class-name.php                 26-Sep-2022 04:10                6278
function.cubrid-get-client-info.php                26-Sep-2022 04:10                8318
function.cubrid-get-db-parameter.php               26-Sep-2022 04:10               14946
function.cubrid-get-query-timeout.php              26-Sep-2022 04:10                6701
function.cubrid-get-server-info.php                26-Sep-2022 04:10                8542
function.cubrid-get.php                            26-Sep-2022 04:10               10139
function.cubrid-insert-id.php                      26-Sep-2022 04:10                7142
function.cubrid-is-instance.php                    26-Sep-2022 04:10                7394
function.cubrid-list-dbs.php                       26-Sep-2022 04:10                4434
function.cubrid-load-from-glo.php                  26-Sep-2022 04:10                6966
function.cubrid-lob-close.php                      26-Sep-2022 04:10                7318
function.cubrid-lob-export.php                     26-Sep-2022 04:10                7920
function.cubrid-lob-get.php                        26-Sep-2022 04:10                7808
function.cubrid-lob-send.php                       26-Sep-2022 04:10                7092
function.cubrid-lob-size.php                       26-Sep-2022 04:10                5953
function.cubrid-lob2-bind.php                      26-Sep-2022 04:10                9937
function.cubrid-lob2-close.php                     26-Sep-2022 04:10                3264
function.cubrid-lob2-export.php                    26-Sep-2022 04:10                8865
function.cubrid-lob2-import.php                    26-Sep-2022 04:10                8761
function.cubrid-lob2-new.php                       26-Sep-2022 04:10                3775
function.cubrid-lob2-read.php                      26-Sep-2022 04:10               14441
function.cubrid-lob2-seek.php                      26-Sep-2022 04:10               11415
function.cubrid-lob2-seek64.php                    26-Sep-2022 04:10               13037
function.cubrid-lob2-size.php                      26-Sep-2022 04:10                4351
function.cubrid-lob2-size64.php                    26-Sep-2022 04:10                4546
function.cubrid-lob2-tell.php                      26-Sep-2022 04:10                4375
function.cubrid-lob2-tell64.php                    26-Sep-2022 04:10                4595
function.cubrid-lob2-write.php                     26-Sep-2022 04:10               14625
function.cubrid-lock-read.php                      26-Sep-2022 04:10                9273
function.cubrid-lock-write.php                     26-Sep-2022 04:10                9688
function.cubrid-move-cursor.php                    26-Sep-2022 04:10                9173
function.cubrid-new-glo.php                        26-Sep-2022 04:10                7089
function.cubrid-next-result.php                    26-Sep-2022 04:10               17310
function.cubrid-num-cols.php                       26-Sep-2022 04:10                5951
function.cubrid-num-fields.php                     26-Sep-2022 04:10                5633
function.cubrid-num-rows.php                       26-Sep-2022 04:10                7175
function.cubrid-pconnect-with-url.php              26-Sep-2022 04:10               15498
function.cubrid-pconnect.php                       26-Sep-2022 04:10               12289
function.cubrid-ping.php                           26-Sep-2022 04:10                6324
function.cubrid-prepare.php                        26-Sep-2022 04:10               10442
function.cubrid-put.php                            26-Sep-2022 04:10               11604
function.cubrid-query.php                          26-Sep-2022 04:10               15213
function.cubrid-real-escape-string.php             26-Sep-2022 04:10                8207
function.cubrid-result.php                         26-Sep-2022 04:10                7470
function.cubrid-rollback.php                       26-Sep-2022 04:10               15549
function.cubrid-save-to-glo.php                    26-Sep-2022 04:10                6870
function.cubrid-schema.php                         26-Sep-2022 04:10               20459
function.cubrid-send-glo.php                       26-Sep-2022 04:10                6277
function.cubrid-seq-drop.php                       26-Sep-2022 04:10                9779
function.cubrid-seq-insert.php                     26-Sep-2022 04:10               10251
function.cubrid-seq-put.php                        26-Sep-2022 04:10               10201
function.cubrid-set-add.php                        26-Sep-2022 04:10                9571
function.cubrid-set-autocommit.php                 26-Sep-2022 04:10                4170
function.cubrid-set-db-parameter.php               26-Sep-2022 04:10                8140
function.cubrid-set-drop.php                       26-Sep-2022 04:10                9549
function.cubrid-set-query-timeout.php              26-Sep-2022 04:10                3441
function.cubrid-unbuffered-query.php               26-Sep-2022 04:10                7223
function.cubrid-version.php                        26-Sep-2022 04:10                8971
function.curl-close.php                            26-Sep-2022 04:10                5302
function.curl-copy-handle.php                      26-Sep-2022 04:10                5187
function.curl-errno.php                            26-Sep-2022 04:10                5416
function.curl-error.php                            26-Sep-2022 04:10                5372
function.curl-escape.php                           26-Sep-2022 04:10                6809
function.curl-exec.php                             26-Sep-2022 04:10                6513
function.curl-getinfo.php                          26-Sep-2022 04:10               31449
function.curl-init.php                             26-Sep-2022 04:10                7105
function.curl-multi-add-handle.php                 26-Sep-2022 04:10                9364
function.curl-multi-close.php                      26-Sep-2022 04:10                8971
function.curl-multi-errno.php                      26-Sep-2022 04:10                2941
function.curl-multi-exec.php                       26-Sep-2022 04:10               10724
function.curl-multi-getcontent.php                 26-Sep-2022 04:10                3195
function.curl-multi-info-read.php                  26-Sep-2022 04:10               12042
function.curl-multi-init.php                       26-Sep-2022 04:10                9405
function.curl-multi-remove-handle.php              26-Sep-2022 04:10                4099
function.curl-multi-select.php                     26-Sep-2022 04:10                3496
function.curl-multi-setopt.php                     26-Sep-2022 04:10                5179
function.curl-multi-strerror.php                   26-Sep-2022 04:10                7025
function.curl-pause.php                            26-Sep-2022 04:10                2837
function.curl-reset.php                            26-Sep-2022 04:10                5917
function.curl-setopt-array.php                     26-Sep-2022 04:10                9295
function.curl-setopt.php                           26-Sep-2022 04:10              100463
function.curl-share-close.php                      26-Sep-2022 04:10                7371
function.curl-share-errno.php                      26-Sep-2022 04:10                2988
function.curl-share-init.php                       26-Sep-2022 04:10                7211
function.curl-share-setopt.php                     26-Sep-2022 04:10                9626
function.curl-share-strerror.php                   26-Sep-2022 04:10                3234
function.curl-strerror.php                         26-Sep-2022 04:10                6277
function.curl-unescape.php                         26-Sep-2022 04:10                7234
function.curl-version.php                          26-Sep-2022 04:10                6850
function.current.php                               26-Sep-2022 04:10               10445
function.date-add.php                              26-Sep-2022 04:10                1692
function.date-create-from-format.php               26-Sep-2022 04:10                1867
function.date-create-immutable-from-format.php     26-Sep-2022 04:10                1979
function.date-create-immutable.php                 26-Sep-2022 04:10                1871
function.date-create.php                           26-Sep-2022 04:10                1747
function.date-date-set.php                         26-Sep-2022 04:10                1751
function.date-default-timezone-get.php             26-Sep-2022 04:10                8515
function.date-default-timezone-set.php             26-Sep-2022 04:10                7039
function.date-diff.php                             26-Sep-2022 04:10                1711
function.date-format.php                           26-Sep-2022 04:10                1719
function.date-get-last-errors.php                  26-Sep-2022 04:10                1848
function.date-interval-create-from-date-string.php 26-Sep-2022 04:10                1995
function.date-interval-format.php                  26-Sep-2022 04:10                1846
function.date-isodate-set.php                      26-Sep-2022 04:10                1774
function.date-modify.php                           26-Sep-2022 04:10                1723
function.date-offset-get.php                       26-Sep-2022 04:10                1767
function.date-parse-from-format.php                26-Sep-2022 04:10                5883
function.date-parse.php                            26-Sep-2022 04:10                6193
function.date-sub.php                              26-Sep-2022 04:10                1674
function.date-sun-info.php                         26-Sep-2022 04:10                5830
function.date-sunrise.php                          26-Sep-2022 04:10                9505
function.date-sunset.php                           26-Sep-2022 04:10                9498
function.date-time-set.php                         26-Sep-2022 04:10                1737
function.date-timestamp-get.php                    26-Sep-2022 04:10                1796
function.date-timestamp-set.php                    26-Sep-2022 04:10                1804
function.date-timezone-get.php                     26-Sep-2022 04:10                1793
function.date-timezone-set.php                     26-Sep-2022 04:10                1765
function.date.php                                  26-Sep-2022 04:10               36975
function.db2-autocommit.php                        26-Sep-2022 04:10               10985
function.db2-bind-param.php                        26-Sep-2022 04:10               23078
function.db2-client-info.php                       26-Sep-2022 04:10               12357
function.db2-close.php                             26-Sep-2022 04:10                5568
function.db2-column-privileges.php                 26-Sep-2022 04:10                7980
function.db2-columns.php                           26-Sep-2022 04:10                9746
function.db2-commit.php                            26-Sep-2022 04:10                3635
function.db2-conn-error.php                        26-Sep-2022 04:10                6807
function.db2-conn-errormsg.php                     26-Sep-2022 04:10                6588
function.db2-connect.php                           26-Sep-2022 04:10               41442
function.db2-cursor-type.php                       26-Sep-2022 04:10                3190
function.db2-escape-string.php                     26-Sep-2022 04:10                8083
function.db2-exec.php                              26-Sep-2022 04:10               28963
function.db2-execute.php                           26-Sep-2022 04:10               27876
function.db2-fetch-array.php                       26-Sep-2022 04:10               11721
function.db2-fetch-assoc.php                       26-Sep-2022 04:10               11799
function.db2-fetch-both.php                        26-Sep-2022 04:10               12412
function.db2-fetch-object.php                      26-Sep-2022 04:10                9387
function.db2-fetch-row.php                         26-Sep-2022 04:10               16995
function.db2-field-display-size.php                26-Sep-2022 04:10                4880
function.db2-field-name.php                        26-Sep-2022 04:10                4761
function.db2-field-num.php                         26-Sep-2022 04:10                4784
function.db2-field-precision.php                   26-Sep-2022 04:10                4802
function.db2-field-scale.php                       26-Sep-2022 04:10                4769
function.db2-field-type.php                        26-Sep-2022 04:10                4771
function.db2-field-width.php                       26-Sep-2022 04:10                5012
function.db2-foreign-keys.php                      26-Sep-2022 04:10                8710
function.db2-free-result.php                       26-Sep-2022 04:10                3124
function.db2-free-stmt.php                         26-Sep-2022 04:10                3150
function.db2-get-option.php                        26-Sep-2022 04:10               25320
function.db2-last-insert-id.php                    26-Sep-2022 04:10                8543
function.db2-lob-read.php                          26-Sep-2022 04:10               17907
function.db2-next-result.php                       26-Sep-2022 04:10                9060
function.db2-num-fields.php                        26-Sep-2022 04:10                7106
function.db2-num-rows.php                          26-Sep-2022 04:10                4297
function.db2-pclose.php                            26-Sep-2022 04:10                5700
function.db2-pconnect.php                          26-Sep-2022 04:10               33396
function.db2-prepare.php                           26-Sep-2022 04:10               10636
function.db2-primary-keys.php                      26-Sep-2022 04:10                7262
function.db2-procedure-columns.php                 26-Sep-2022 04:10               11364
function.db2-procedures.php                        26-Sep-2022 04:10                7791
function.db2-result.php                            26-Sep-2022 04:10                8036
function.db2-rollback.php                          26-Sep-2022 04:10                9875
function.db2-server-info.php                       26-Sep-2022 04:10               24286
function.db2-set-option.php                        26-Sep-2022 04:10               70581
function.db2-special-columns.php                   26-Sep-2022 04:10                9787
function.db2-statistics.php                        26-Sep-2022 04:10               11923
function.db2-stmt-error.php                        26-Sep-2022 04:10                4373
function.db2-stmt-errormsg.php                     26-Sep-2022 04:10                4004
function.db2-table-privileges.php                  26-Sep-2022 04:10                7731
function.db2-tables.php                            26-Sep-2022 04:10                7761
function.dba-close.php                             26-Sep-2022 04:10                3171
function.dba-delete.php                            26-Sep-2022 04:10                3836
function.dba-exists.php                            26-Sep-2022 04:10                3857
function.dba-fetch.php                             26-Sep-2022 04:10                5990
function.dba-firstkey.php                          26-Sep-2022 04:10                3482
function.dba-handlers.php                          26-Sep-2022 04:10                5466
function.dba-insert.php                            26-Sep-2022 04:10                4408
function.dba-key-split.php                         26-Sep-2022 04:10                3640
function.dba-list.php                              26-Sep-2022 04:10                2006
function.dba-nextkey.php                           26-Sep-2022 04:10                3372
function.dba-open.php                              26-Sep-2022 04:10               10218
function.dba-optimize.php                          26-Sep-2022 04:10                2997
function.dba-popen.php                             26-Sep-2022 04:10                4684
function.dba-replace.php                           26-Sep-2022 04:10                4240
function.dba-sync.php                              26-Sep-2022 04:10                3022
function.dbase-add-record.php                      26-Sep-2022 04:10                6361
function.dbase-close.php                           26-Sep-2022 04:10                4576
function.dbase-create.php                          26-Sep-2022 04:10                6736
function.dbase-delete-record.php                   26-Sep-2022 04:10                4159
function.dbase-get-header-info.php                 26-Sep-2022 04:10                6501
function.dbase-get-record-with-names.php           26-Sep-2022 04:10                7607
function.dbase-get-record.php                      26-Sep-2022 04:10                4317
function.dbase-numfields.php                       26-Sep-2022 04:10                5307
function.dbase-numrecords.php                      26-Sep-2022 04:10                5504
function.dbase-open.php                            26-Sep-2022 04:10                5482
function.dbase-pack.php                            26-Sep-2022 04:10                5632
function.dbase-replace-record.php                  26-Sep-2022 04:10                7747
function.dcgettext.php                             26-Sep-2022 04:10                3251
function.dcngettext.php                            26-Sep-2022 04:10                3762
function.debug-backtrace.php                       26-Sep-2022 04:10               10742
function.debug-print-backtrace.php                 26-Sep-2022 04:10                7151
function.debug-zval-dump.php                       26-Sep-2022 04:11                9971
function.decbin.php                                26-Sep-2022 04:10                8700
function.dechex.php                                26-Sep-2022 04:10                7206
function.decoct.php                                26-Sep-2022 04:10                4788
function.define.php                                26-Sep-2022 04:10                8115
function.defined.php                               26-Sep-2022 04:10                5232
function.deflate-add.php                           26-Sep-2022 04:10                5078
function.deflate-init.php                          26-Sep-2022 04:10                7131
function.deg2rad.php                               26-Sep-2022 04:10                3969
function.delete.php                                26-Sep-2022 04:10                2370
function.dgettext.php                              26-Sep-2022 04:10                3040
function.die.php                                   26-Sep-2022 04:10                1537
function.dio-close.php                             26-Sep-2022 04:10                3946
function.dio-fcntl.php                             26-Sep-2022 04:10                9064
function.dio-open.php                              26-Sep-2022 04:10                7594
function.dio-read.php                              26-Sep-2022 04:10                3365
function.dio-seek.php                              26-Sep-2022 04:10                7299
function.dio-stat.php                              26-Sep-2022 04:10                4189
function.dio-tcsetattr.php                         26-Sep-2022 04:10                7046
function.dio-truncate.php                          26-Sep-2022 04:10                3470
function.dio-write.php                             26-Sep-2022 04:10                3629
function.dir.php                                   26-Sep-2022 04:10                6555
function.dirname.php                               26-Sep-2022 04:10                7649
function.disk-free-space.php                       26-Sep-2022 04:10                5422
function.disk-total-space.php                      26-Sep-2022 04:10                5108
function.diskfreespace.php                         26-Sep-2022 04:10                1745
function.dl.php                                    26-Sep-2022 04:10               11487
function.dngettext.php                             26-Sep-2022 04:10                3603
function.dns-check-record.php                      26-Sep-2022 04:10                1703
function.dns-get-mx.php                            26-Sep-2022 04:10                1669
function.dns-get-record.php                        26-Sep-2022 04:10               22318
function.dom-import-simplexml.php                  26-Sep-2022 04:11                6791
function.doubleval.php                             26-Sep-2022 04:11                1662
function.each.php                                  26-Sep-2022 04:10               11397
function.easter-date.php                           26-Sep-2022 04:10               11341
function.easter-days.php                           26-Sep-2022 04:10                6589
function.echo.php                                  26-Sep-2022 04:10               15610
function.eio-busy.php                              26-Sep-2022 04:10                4527
function.eio-cancel.php                            26-Sep-2022 04:10                7487
function.eio-chmod.php                             26-Sep-2022 04:10                5788
function.eio-chown.php                             26-Sep-2022 04:10                5939
function.eio-close.php                             26-Sep-2022 04:10                5357
function.eio-custom.php                            26-Sep-2022 04:10               10687
function.eio-dup2.php                              26-Sep-2022 04:10                5443
function.eio-event-loop.php                        26-Sep-2022 04:10                5972
function.eio-fallocate.php                         26-Sep-2022 04:10                6926
function.eio-fchmod.php                            26-Sep-2022 04:10                5850
function.eio-fchown.php                            26-Sep-2022 04:10                5741
function.eio-fdatasync.php                         26-Sep-2022 04:10                5300
function.eio-fstat.php                             26-Sep-2022 04:10               11987
function.eio-fstatvfs.php                          26-Sep-2022 04:10                5462
function.eio-fsync.php                             26-Sep-2022 04:10                5422
function.eio-ftruncate.php                         26-Sep-2022 04:10                5858
function.eio-futime.php                            26-Sep-2022 04:10                6176
function.eio-get-event-stream.php                  26-Sep-2022 04:10                8663
function.eio-get-last-error.php                    26-Sep-2022 04:10                3018
function.eio-grp-add.php                           26-Sep-2022 04:10               12550
function.eio-grp-cancel.php                        26-Sep-2022 04:10                3111
function.eio-grp-limit.php                         26-Sep-2022 04:10                2950
function.eio-grp.php                               26-Sep-2022 04:10               12523
function.eio-init.php                              26-Sep-2022 04:10                3169
function.eio-link.php                              26-Sep-2022 04:10               12853
function.eio-lstat.php                             26-Sep-2022 04:10                9828
function.eio-mkdir.php                             26-Sep-2022 04:10                9162
function.eio-mknod.php                             26-Sep-2022 04:10               11120
function.eio-nop.php                               26-Sep-2022 04:10                4989
function.eio-npending.php                          26-Sep-2022 04:10                3029
function.eio-nready.php                            26-Sep-2022 04:10                2747
function.eio-nreqs.php                             26-Sep-2022 04:10                5646
function.eio-nthreads.php                          26-Sep-2022 04:10                3552
function.eio-open.php                              26-Sep-2022 04:10               11860
function.eio-poll.php                              26-Sep-2022 04:10                5866
function.eio-read.php                              26-Sep-2022 04:10               13224
function.eio-readahead.php                         26-Sep-2022 04:10                5864
function.eio-readdir.php                           26-Sep-2022 04:10               17249
function.eio-readlink.php                          26-Sep-2022 04:10               12421
function.eio-realpath.php                          26-Sep-2022 04:10                5186
function.eio-rename.php                            26-Sep-2022 04:10                9277
function.eio-rmdir.php                             26-Sep-2022 04:10                8134
function.eio-seek.php                              26-Sep-2022 04:10                6530
function.eio-sendfile.php                          26-Sep-2022 04:10                6151
function.eio-set-max-idle.php                      26-Sep-2022 04:10                3142
function.eio-set-max-parallel.php                  26-Sep-2022 04:10                3197
function.eio-set-max-poll-reqs.php                 26-Sep-2022 04:10                2425
function.eio-set-max-poll-time.php                 26-Sep-2022 04:10                2499
function.eio-set-min-parallel.php                  26-Sep-2022 04:10                3178
function.eio-stat.php                              26-Sep-2022 04:10                9806
function.eio-statvfs.php                           26-Sep-2022 04:10                8161
function.eio-symlink.php                           26-Sep-2022 04:10               10889
function.eio-sync-file-range.php                   26-Sep-2022 04:10                6738
function.eio-sync.php                              26-Sep-2022 04:10                2752
function.eio-syncfs.php                            26-Sep-2022 04:10                4941
function.eio-truncate.php                          26-Sep-2022 04:10                5709
function.eio-unlink.php                            26-Sep-2022 04:10                4926
function.eio-utime.php                             26-Sep-2022 04:10                5749
function.eio-write.php                             26-Sep-2022 04:10                6487
function.empty.php                                 26-Sep-2022 04:11               11832
function.enchant-broker-describe.php               26-Sep-2022 04:10                4997
function.enchant-broker-dict-exists.php            26-Sep-2022 04:10                4890
function.enchant-broker-free-dict.php              26-Sep-2022 04:10                3248
function.enchant-broker-free.php                   26-Sep-2022 04:10                3006
function.enchant-broker-get-dict-path.php          26-Sep-2022 04:10                3533
function.enchant-broker-get-error.php              26-Sep-2022 04:10                2600
function.enchant-broker-init.php                   26-Sep-2022 04:10                2604
function.enchant-broker-list-dicts.php             26-Sep-2022 04:10                5954
function.enchant-broker-request-dict.php           26-Sep-2022 04:10                5753
function.enchant-broker-request-pwl-dict.php       26-Sep-2022 04:10                3966
function.enchant-broker-set-dict-path.php          26-Sep-2022 04:10                3834
function.enchant-broker-set-ordering.php           26-Sep-2022 04:10                3768
function.enchant-dict-add-to-personal.php          26-Sep-2022 04:10                5492
function.enchant-dict-add-to-session.php           26-Sep-2022 04:10                3316
function.enchant-dict-add.php                      26-Sep-2022 04:10                6209
function.enchant-dict-check.php                    26-Sep-2022 04:10                2923
function.enchant-dict-describe.php                 26-Sep-2022 04:10                5350
function.enchant-dict-get-error.php                26-Sep-2022 04:10                2615
function.enchant-dict-is-added.php                 26-Sep-2022 04:10                4246
function.enchant-dict-is-in-session.php            26-Sep-2022 04:10                3334
function.enchant-dict-quick-check.php              26-Sep-2022 04:10                7034
function.enchant-dict-store-replacement.php        26-Sep-2022 04:10                3413
function.enchant-dict-suggest.php                  26-Sep-2022 04:10                6713
function.end.php                                   26-Sep-2022 04:10                5168
function.enum-exists.php                           26-Sep-2022 04:10                5106
function.error-clear-last.php                      26-Sep-2022 04:10                4384
function.error-get-last.php                        26-Sep-2022 04:10                4577
function.error-log.php                             26-Sep-2022 04:10               10313
function.error-reporting.php                       26-Sep-2022 04:10                9908
function.escapeshellarg.php                        26-Sep-2022 04:10                5341
function.escapeshellcmd.php                        26-Sep-2022 04:10                6653
function.eval.php                                  26-Sep-2022 04:10                8676
function.exec.php                                  26-Sep-2022 04:10                7376
function.exif-imagetype.php                        26-Sep-2022 04:10                8352
function.exif-read-data.php                        26-Sep-2022 04:10               17226
function.exif-tagname.php                          26-Sep-2022 04:10                4638
function.exif-thumbnail.php                        26-Sep-2022 04:10                8044
function.exit.php                                  26-Sep-2022 04:10                9689
function.exp.php                                   26-Sep-2022 04:10                4231
function.expect-expectl.php                        26-Sep-2022 04:10               11609
function.expect-popen.php                          26-Sep-2022 04:10                4537
function.explode.php                               26-Sep-2022 04:10               14853
function.expm1.php                                 26-Sep-2022 04:10                3889
function.extension-loaded.php                      26-Sep-2022 04:10                5593
function.extract.php                               26-Sep-2022 04:10               13292
function.ezmlm-hash.php                            26-Sep-2022 04:10                4196
function.fann-cascadetrain-on-data.php             26-Sep-2022 04:10                6361
function.fann-cascadetrain-on-file.php             26-Sep-2022 04:10                5426
function.fann-clear-scaling-params.php             26-Sep-2022 04:10                2512
function.fann-copy.php                             26-Sep-2022 04:10                2802
function.fann-create-from-file.php                 26-Sep-2022 04:10                3157
function.fann-create-shortcut-array.php            26-Sep-2022 04:10                4306
function.fann-create-shortcut.php                  26-Sep-2022 04:10                5067
function.fann-create-sparse-array.php              26-Sep-2022 04:10                4775
function.fann-create-sparse.php                    26-Sep-2022 04:10                5434
function.fann-create-standard-array.php            26-Sep-2022 04:10                4428
function.fann-create-standard.php                  26-Sep-2022 04:10                5118
function.fann-create-train-from-callback.php       26-Sep-2022 04:10                9113
function.fann-create-train.php                     26-Sep-2022 04:10                4159
function.fann-descale-input.php                    26-Sep-2022 04:10                3650
function.fann-descale-output.php                   26-Sep-2022 04:10                3662
function.fann-descale-train.php                    26-Sep-2022 04:10                3575
function.fann-destroy-train.php                    26-Sep-2022 04:10                2480
function.fann-destroy.php                          26-Sep-2022 04:10                2490
function.fann-duplicate-train-data.php             26-Sep-2022 04:10                2686
function.fann-get-activation-function.php          26-Sep-2022 04:10                5232
function.fann-get-activation-steepness.php         26-Sep-2022 04:10                5651
function.fann-get-bias-array.php                   26-Sep-2022 04:10                2481
function.fann-get-bit-fail-limit.php               26-Sep-2022 04:10                3739
function.fann-get-bit-fail.php                     26-Sep-2022 04:10                4972
function.fann-get-cascade-activation-functions-..> 26-Sep-2022 04:10                3765
function.fann-get-cascade-activation-functions.php 26-Sep-2022 04:10                4249
function.fann-get-cascade-activation-steepnesse..> 26-Sep-2022 04:10                3809
function.fann-get-cascade-activation-steepnesse..> 26-Sep-2022 04:10                3989
function.fann-get-cascade-candidate-change-frac..> 26-Sep-2022 04:10                5188
function.fann-get-cascade-candidate-limit.php      26-Sep-2022 04:10                3489
function.fann-get-cascade-candidate-stagnation-..> 26-Sep-2022 04:10                4276
function.fann-get-cascade-max-cand-epochs.php      26-Sep-2022 04:10                3362
function.fann-get-cascade-max-out-epochs.php       26-Sep-2022 04:10                3294
function.fann-get-cascade-min-cand-epochs.php      26-Sep-2022 04:10                3336
function.fann-get-cascade-min-out-epochs.php       26-Sep-2022 04:10                3301
function.fann-get-cascade-num-candidate-groups.php 26-Sep-2022 04:10                3729
function.fann-get-cascade-num-candidates.php       26-Sep-2022 04:10                6004
function.fann-get-cascade-output-change-fractio..> 26-Sep-2022 04:10                5121
function.fann-get-cascade-output-stagnation-epo..> 26-Sep-2022 04:10                4213
function.fann-get-cascade-weight-multiplier.php    26-Sep-2022 04:10                3391
function.fann-get-connection-array.php             26-Sep-2022 04:10                2491
function.fann-get-connection-rate.php              26-Sep-2022 04:10                2558
function.fann-get-errno.php                        26-Sep-2022 04:10                3074
function.fann-get-errstr.php                       26-Sep-2022 04:10                3083
function.fann-get-layer-array.php                  26-Sep-2022 04:10                2583
function.fann-get-learning-momentum.php            26-Sep-2022 04:10                3683
function.fann-get-learning-rate.php                26-Sep-2022 04:10                3529
function.fann-get-mse.php                          26-Sep-2022 04:10                3018
function.fann-get-network-type.php                 26-Sep-2022 04:10                2515
function.fann-get-num-input.php                    26-Sep-2022 04:10                2453
function.fann-get-num-layers.php                   26-Sep-2022 04:10                2472
function.fann-get-num-output.php                   26-Sep-2022 04:10                2466
function.fann-get-quickprop-decay.php              26-Sep-2022 04:10                3285
function.fann-get-quickprop-mu.php                 26-Sep-2022 04:10                3143
function.fann-get-rprop-decrease-factor.php        26-Sep-2022 04:10                3255
function.fann-get-rprop-delta-max.php              26-Sep-2022 04:10                3330
function.fann-get-rprop-delta-min.php              26-Sep-2022 04:10                3101
function.fann-get-rprop-delta-zero.php             26-Sep-2022 04:10                3572
function.fann-get-rprop-increase-factor.php        26-Sep-2022 04:10                3249
function.fann-get-sarprop-step-error-shift.php     26-Sep-2022 04:10                3263
function.fann-get-sarprop-step-error-threshold-..> 26-Sep-2022 04:10                3359
function.fann-get-sarprop-temperature.php          26-Sep-2022 04:10                3102
function.fann-get-sarprop-weight-decay-shift.php   26-Sep-2022 04:10                3244
function.fann-get-total-connections.php            26-Sep-2022 04:10                2615
function.fann-get-total-neurons.php                26-Sep-2022 04:10                2690
function.fann-get-train-error-function.php         26-Sep-2022 04:10                3458
function.fann-get-train-stop-function.php          26-Sep-2022 04:10                3460
function.fann-get-training-algorithm.php           26-Sep-2022 04:10                3601
function.fann-init-weights.php                     26-Sep-2022 04:10                4240
function.fann-length-train-data.php                26-Sep-2022 04:10                2679
function.fann-merge-train-data.php                 26-Sep-2022 04:10                2923
function.fann-num-input-train-data.php             26-Sep-2022 04:10                3436
function.fann-num-output-train-data.php            26-Sep-2022 04:10                3431
function.fann-print-error.php                      26-Sep-2022 04:10                2859
function.fann-randomize-weights.php                26-Sep-2022 04:10                3666
function.fann-read-train-from-file.php             26-Sep-2022 04:10                5104
function.fann-reset-errno.php                      26-Sep-2022 04:10                3081
function.fann-reset-errstr.php                     26-Sep-2022 04:10                3065
function.fann-reset-mse.php                        26-Sep-2022 04:10                3329
function.fann-run.php                              26-Sep-2022 04:10                2715
function.fann-save-train.php                       26-Sep-2022 04:10                3319
function.fann-save.php                             26-Sep-2022 04:10                4142
function.fann-scale-input-train-data.php           26-Sep-2022 04:10                3956
function.fann-scale-input.php                      26-Sep-2022 04:10                3659
function.fann-scale-output-train-data.php          26-Sep-2022 04:10                3978
function.fann-scale-output.php                     26-Sep-2022 04:10                3659
function.fann-scale-train-data.php                 26-Sep-2022 04:10                3947
function.fann-scale-train.php                      26-Sep-2022 04:10                3594
function.fann-set-activation-function-hidden.php   26-Sep-2022 04:10                4402
function.fann-set-activation-function-layer.php    26-Sep-2022 04:10                4885
function.fann-set-activation-function-output.php   26-Sep-2022 04:10                4420
function.fann-set-activation-function.php          26-Sep-2022 04:10                6217
function.fann-set-activation-steepness-hidden.php  26-Sep-2022 04:10                4697
function.fann-set-activation-steepness-layer.php   26-Sep-2022 04:10                5109
function.fann-set-activation-steepness-output.php  26-Sep-2022 04:10                4666
function.fann-set-activation-steepness.php         26-Sep-2022 04:10                6015
function.fann-set-bit-fail-limit.php               26-Sep-2022 04:10                3308
function.fann-set-callback.php                     26-Sep-2022 04:10                5402
function.fann-set-cascade-activation-functions.php 26-Sep-2022 04:10                3950
function.fann-set-cascade-activation-steepnesse..> 26-Sep-2022 04:10                4168
function.fann-set-cascade-candidate-change-frac..> 26-Sep-2022 04:10                3627
function.fann-set-cascade-candidate-limit.php      26-Sep-2022 04:10                3415
function.fann-set-cascade-candidate-stagnation-..> 26-Sep-2022 04:10                3711
function.fann-set-cascade-max-cand-epochs.php      26-Sep-2022 04:10                3441
function.fann-set-cascade-max-out-epochs.php       26-Sep-2022 04:10                3388
function.fann-set-cascade-min-cand-epochs.php      26-Sep-2022 04:10                3409
function.fann-set-cascade-min-out-epochs.php       26-Sep-2022 04:10                3392
function.fann-set-cascade-num-candidate-groups.php 26-Sep-2022 04:10                3496
function.fann-set-cascade-output-change-fractio..> 26-Sep-2022 04:10                3580
function.fann-set-cascade-output-stagnation-epo..> 26-Sep-2022 04:10                3668
function.fann-set-cascade-weight-multiplier.php    26-Sep-2022 04:10                3385
function.fann-set-error-log.php                    26-Sep-2022 04:10                2805
function.fann-set-input-scaling-params.php         26-Sep-2022 04:10                4294
function.fann-set-learning-momentum.php            26-Sep-2022 04:10                3673
function.fann-set-learning-rate.php                26-Sep-2022 04:10                3607
function.fann-set-output-scaling-params.php        26-Sep-2022 04:10                4308
function.fann-set-quickprop-decay.php              26-Sep-2022 04:10                3371
function.fann-set-quickprop-mu.php                 26-Sep-2022 04:10                3158
function.fann-set-rprop-decrease-factor.php        26-Sep-2022 04:10                3427
function.fann-set-rprop-delta-max.php              26-Sep-2022 04:10                3548
function.fann-set-rprop-delta-min.php              26-Sep-2022 04:10                3326
function.fann-set-rprop-delta-zero.php             26-Sep-2022 04:10                3754
function.fann-set-rprop-increase-factor.php        26-Sep-2022 04:10                3433
function.fann-set-sarprop-step-error-shift.php     26-Sep-2022 04:10                3488
function.fann-set-sarprop-step-error-threshold-..> 26-Sep-2022 04:10                3635
function.fann-set-sarprop-temperature.php          26-Sep-2022 04:10                3339
function.fann-set-sarprop-weight-decay-shift.php   26-Sep-2022 04:10                3492
function.fann-set-scaling-params.php               26-Sep-2022 04:10                5310
function.fann-set-train-error-function.php         26-Sep-2022 04:10                3640
function.fann-set-train-stop-function.php          26-Sep-2022 04:10                3636
function.fann-set-training-algorithm.php           26-Sep-2022 04:10                3556
function.fann-set-weight-array.php                 26-Sep-2022 04:10                2985
function.fann-set-weight.php                       26-Sep-2022 04:10                3341
function.fann-shuffle-train-data.php               26-Sep-2022 04:10                2711
function.fann-subset-train-data.php                26-Sep-2022 04:10                4003
function.fann-test-data.php                        26-Sep-2022 04:10                4093
function.fann-test.php                             26-Sep-2022 04:10                4441
function.fann-train-epoch.php                      26-Sep-2022 04:10                4489
function.fann-train-on-data.php                    26-Sep-2022 04:10                6397
function.fann-train-on-file.php                    26-Sep-2022 04:10                6397
function.fann-train.php                            26-Sep-2022 04:10                4463
function.fastcgi-finish-request.php                26-Sep-2022 04:10                2427
function.fbird-add-user.php                        26-Sep-2022 04:10                2319
function.fbird-affected-rows.php                   26-Sep-2022 04:10                2331
function.fbird-backup.php                          26-Sep-2022 04:10                1728
function.fbird-blob-add.php                        26-Sep-2022 04:10                2674
function.fbird-blob-cancel.php                     26-Sep-2022 04:10                3483
function.fbird-blob-close.php                      26-Sep-2022 04:10                2705
function.fbird-blob-create.php                     26-Sep-2022 04:10                2705
function.fbird-blob-echo.php                       26-Sep-2022 04:10                2493
function.fbird-blob-get.php                        26-Sep-2022 04:10                2486
function.fbird-blob-import.php                     26-Sep-2022 04:10                2701
function.fbird-blob-info.php                       26-Sep-2022 04:10                1760
function.fbird-blob-open.php                       26-Sep-2022 04:10                2483
function.fbird-close.php                           26-Sep-2022 04:10                2254
function.fbird-commit-ret.php                      26-Sep-2022 04:10                1753
function.fbird-commit.php                          26-Sep-2022 04:10                1721
function.fbird-connect.php                         26-Sep-2022 04:10                2260
function.fbird-db-info.php                         26-Sep-2022 04:10                1734
function.fbird-delete-user.php                     26-Sep-2022 04:10                2328
function.fbird-drop-db.php                         26-Sep-2022 04:10                2276
function.fbird-errcode.php                         26-Sep-2022 04:10                2084
function.fbird-errmsg.php                          26-Sep-2022 04:10                2077
function.fbird-execute.php                         26-Sep-2022 04:10                2089
function.fbird-fetch-assoc.php                     26-Sep-2022 04:10                2344
function.fbird-fetch-object.php                    26-Sep-2022 04:10                2355
function.fbird-fetch-row.php                       26-Sep-2022 04:10                2332
function.fbird-field-info.php                      26-Sep-2022 04:10                2159
function.fbird-free-event-handler.php              26-Sep-2022 04:10                2263
function.fbird-free-query.php                      26-Sep-2022 04:10                1789
function.fbird-free-result.php                     26-Sep-2022 04:10                1774
function.fbird-gen-id.php                          26-Sep-2022 04:10                1731
function.fbird-maintain-db.php                     26-Sep-2022 04:10                1776
function.fbird-modify-user.php                     26-Sep-2022 04:10                2344
function.fbird-name-result.php                     26-Sep-2022 04:10                2327
function.fbird-num-fields.php                      26-Sep-2022 04:10                2148
function.fbird-num-params.php                      26-Sep-2022 04:10                2322
function.fbird-param-info.php                      26-Sep-2022 04:10                2327
function.fbird-pconnect.php                        26-Sep-2022 04:10                2277
function.fbird-prepare.php                         26-Sep-2022 04:10                1724
function.fbird-query.php                           26-Sep-2022 04:10                2623
function.fbird-restore.php                         26-Sep-2022 04:10                1731
function.fbird-rollback-ret.php                    26-Sep-2022 04:10                1783
function.fbird-rollback.php                        26-Sep-2022 04:10                1755
function.fbird-server-info.php                     26-Sep-2022 04:10                1786
function.fbird-service-attach.php                  26-Sep-2022 04:10                1825
function.fbird-service-detach.php                  26-Sep-2022 04:10                1837
function.fbird-set-event-handler.php               26-Sep-2022 04:10                2437
function.fbird-trans.php                           26-Sep-2022 04:10                1730
function.fbird-wait-event.php                      26-Sep-2022 04:10                2362
function.fclose.php                                26-Sep-2022 04:10                4256
function.fdatasync.php                             26-Sep-2022 04:10                5836
function.fdf-add-doc-javascript.php                26-Sep-2022 04:10                5201
function.fdf-add-template.php                      26-Sep-2022 04:10                2540
function.fdf-close.php                             26-Sep-2022 04:10                2992
function.fdf-create.php                            26-Sep-2022 04:10                5432
function.fdf-enum-values.php                       26-Sep-2022 04:10                2408
function.fdf-errno.php                             26-Sep-2022 04:10                2560
function.fdf-error.php                             26-Sep-2022 04:10                3145
function.fdf-get-ap.php                            26-Sep-2022 04:10                3878
function.fdf-get-attachment.php                    26-Sep-2022 04:10                6030
function.fdf-get-encoding.php                      26-Sep-2022 04:10                3315
function.fdf-get-file.php                          26-Sep-2022 04:10                3113
function.fdf-get-flags.php                         26-Sep-2022 04:10                2156
function.fdf-get-opt.php                           26-Sep-2022 04:10                2300
function.fdf-get-status.php                        26-Sep-2022 04:10                3120
function.fdf-get-value.php                         26-Sep-2022 04:10                4450
function.fdf-get-version.php                       26-Sep-2022 04:10                3539
function.fdf-header.php                            26-Sep-2022 04:10                2102
function.fdf-next-field-name.php                   26-Sep-2022 04:10                5384
function.fdf-open-string.php                       26-Sep-2022 04:10                4866
function.fdf-open.php                              26-Sep-2022 04:10                5953
function.fdf-remove-item.php                       26-Sep-2022 04:10                2174
function.fdf-save-string.php                       26-Sep-2022 04:10                5549
function.fdf-save.php                              26-Sep-2022 04:10                3872
function.fdf-set-ap.php                            26-Sep-2022 04:10                4033
function.fdf-set-encoding.php                      26-Sep-2022 04:10                3529
function.fdf-set-file.php                          26-Sep-2022 04:10                6855
function.fdf-set-flags.php                         26-Sep-2022 04:10                4051
function.fdf-set-javascript-action.php             26-Sep-2022 04:10                4234
function.fdf-set-on-import-javascript.php          26-Sep-2022 04:10                3006
function.fdf-set-opt.php                           26-Sep-2022 04:10                4266
function.fdf-set-status.php                        26-Sep-2022 04:10                3560
function.fdf-set-submit-form-action.php            26-Sep-2022 04:10                4517
function.fdf-set-target-frame.php                  26-Sep-2022 04:10                3559
function.fdf-set-value.php                         26-Sep-2022 04:10                5657
function.fdf-set-version.php                       26-Sep-2022 04:10                3832
function.fdiv.php                                  26-Sep-2022 04:10                5977
function.feof.php                                  26-Sep-2022 04:10                7854
function.fflush.php                                26-Sep-2022 04:10                5536
function.fgetc.php                                 26-Sep-2022 04:10                6388
function.fgetcsv.php                               26-Sep-2022 04:10               12220
function.fgets.php                                 26-Sep-2022 04:10                8812
function.fgetss.php                                26-Sep-2022 04:10                8869
function.file-exists.php                           26-Sep-2022 04:10                7032
function.file-get-contents.php                     26-Sep-2022 04:10               17509
function.file-put-contents.php                     26-Sep-2022 04:10               13581
function.file.php                                  26-Sep-2022 04:10               12506
function.fileatime.php                             26-Sep-2022 04:10                6919
function.filectime.php                             26-Sep-2022 04:10                7000
function.filegroup.php                             26-Sep-2022 04:10                5477
function.fileinode.php                             26-Sep-2022 04:10                5114
function.filemtime.php                             26-Sep-2022 04:10                6767
function.fileowner.php                             26-Sep-2022 04:10                5425
function.fileperms.php                             26-Sep-2022 04:10               17951
function.filesize.php                              26-Sep-2022 04:10                5547
function.filetype.php                              26-Sep-2022 04:10                6414
function.filter-has-var.php                        26-Sep-2022 04:10                2871
function.filter-id.php                             26-Sep-2022 04:10                2706
function.filter-input-array.php                    26-Sep-2022 04:10               14152
function.filter-input.php                          26-Sep-2022 04:10                7758
function.filter-list.php                           26-Sep-2022 04:10                3426
function.filter-var-array.php                      26-Sep-2022 04:10               14253
function.filter-var.php                            26-Sep-2022 04:10               13497
function.finfo-buffer.php                          26-Sep-2022 04:10                6541
function.finfo-close.php                           26-Sep-2022 04:10                2648
function.finfo-file.php                            26-Sep-2022 04:10                7204
function.finfo-open.php                            26-Sep-2022 04:10                9400
function.finfo-set-flags.php                       26-Sep-2022 04:10                3662
function.floatval.php                              26-Sep-2022 04:11                6172
function.flock.php                                 26-Sep-2022 04:10               13563
function.floor.php                                 26-Sep-2022 04:10                4603
function.flush.php                                 26-Sep-2022 04:10                4909
function.fmod.php                                  26-Sep-2022 04:10                4326
function.fnmatch.php                               26-Sep-2022 04:10                8188
function.fopen.php                                 26-Sep-2022 04:10               23345
function.forward-static-call-array.php             26-Sep-2022 04:10               10188
function.forward-static-call.php                   26-Sep-2022 04:10                9932
function.fpassthru.php                             26-Sep-2022 04:10                7575
function.fpm-get-status.php                        26-Sep-2022 04:10                2518
function.fprintf.php                               26-Sep-2022 04:10                9269
function.fputcsv.php                               26-Sep-2022 04:10                8957
function.fputs.php                                 26-Sep-2022 04:10                1633
function.fread.php                                 26-Sep-2022 04:10               15068
function.frenchtojd.php                            26-Sep-2022 04:10                3911
function.fscanf.php                                26-Sep-2022 04:10                8132
function.fseek.php                                 26-Sep-2022 04:10                7694
function.fsockopen.php                             26-Sep-2022 04:10               16240
function.fstat.php                                 26-Sep-2022 04:10                5821
function.fsync.php                                 26-Sep-2022 04:10                5598
function.ftell.php                                 26-Sep-2022 04:10                6059
function.ftok.php                                  26-Sep-2022 04:10                3603
function.ftp-alloc.php                             26-Sep-2022 04:10                7605
function.ftp-append.php                            26-Sep-2022 04:10                4145
function.ftp-cdup.php                              26-Sep-2022 04:10                6011
function.ftp-chdir.php                             26-Sep-2022 04:10                6974
function.ftp-chmod.php                             26-Sep-2022 04:10                6443
function.ftp-close.php                             26-Sep-2022 04:10                5294
function.ftp-connect.php                           26-Sep-2022 04:10                5625
function.ftp-delete.php                            26-Sep-2022 04:10                5565
function.ftp-exec.php                              26-Sep-2022 04:10                6149
function.ftp-fget.php                              26-Sep-2022 04:10                9066
function.ftp-fput.php                              26-Sep-2022 04:10                8370
function.ftp-get-option.php                        26-Sep-2022 04:10                5217
function.ftp-get.php                               26-Sep-2022 04:10                8264
function.ftp-login.php                             26-Sep-2022 04:10                6182
function.ftp-mdtm.php                              26-Sep-2022 04:10                6751
function.ftp-mkdir.php                             26-Sep-2022 04:10                5848
function.ftp-mlsd.php                              26-Sep-2022 04:10                9052
function.ftp-nb-continue.php                       26-Sep-2022 04:10                4781
function.ftp-nb-fget.php                           26-Sep-2022 04:10                9445
function.ftp-nb-fput.php                           26-Sep-2022 04:10                9164
function.ftp-nb-get.php                            26-Sep-2022 04:10               13566
function.ftp-nb-put.php                            26-Sep-2022 04:10               10763
function.ftp-nlist.php                             26-Sep-2022 04:10                5918
function.ftp-pasv.php                              26-Sep-2022 04:10                6609
function.ftp-put.php                               26-Sep-2022 04:10                7912
function.ftp-pwd.php                               26-Sep-2022 04:10                5301
function.ftp-quit.php                              26-Sep-2022 04:10                1631
function.ftp-raw.php                               26-Sep-2022 04:10                4658
function.ftp-rawlist.php                           26-Sep-2022 04:10                7213
function.ftp-rename.php                            26-Sep-2022 04:10                6349
function.ftp-rmdir.php                             26-Sep-2022 04:10                5916
function.ftp-set-option.php                        26-Sep-2022 04:10                5978
function.ftp-site.php                              26-Sep-2022 04:10                6167
function.ftp-size.php                              26-Sep-2022 04:10                6333
function.ftp-ssl-connect.php                       26-Sep-2022 04:10                7834
function.ftp-systype.php                           26-Sep-2022 04:10                4759
function.ftruncate.php                             26-Sep-2022 04:10                6353
function.func-get-arg.php                          26-Sep-2022 04:10               14565
function.func-get-args.php                         26-Sep-2022 04:10               12050
function.func-num-args.php                         26-Sep-2022 04:10                5296
function.function-exists.php                       26-Sep-2022 04:10                6056
function.fwrite.php                                26-Sep-2022 04:10               15189
function.gc-collect-cycles.php                     26-Sep-2022 04:10                2506
function.gc-disable.php                            26-Sep-2022 04:10                2539
function.gc-enable.php                             26-Sep-2022 04:10                2511
function.gc-enabled.php                            26-Sep-2022 04:10                3253
function.gc-mem-caches.php                         26-Sep-2022 04:10                2405
function.gc-status.php                             26-Sep-2022 04:10                5931
function.gd-info.php                               26-Sep-2022 04:10                8858
function.geoip-asnum-by-name.php                   26-Sep-2022 04:10                4087
function.geoip-continent-code-by-name.php          26-Sep-2022 04:10                5822
function.geoip-country-code-by-name.php            26-Sep-2022 04:10                5524
function.geoip-country-code3-by-name.php           26-Sep-2022 04:10                5054
function.geoip-country-name-by-name.php            26-Sep-2022 04:10                4964
function.geoip-database-info.php                   26-Sep-2022 04:10                4184
function.geoip-db-avail.php                        26-Sep-2022 04:10                4287
function.geoip-db-filename.php                     26-Sep-2022 04:10                4066
function.geoip-db-get-all-info.php                 26-Sep-2022 04:10                6630
function.geoip-domain-by-name.php                  26-Sep-2022 04:10                4406
function.geoip-id-by-name.php                      26-Sep-2022 04:10                5887
function.geoip-isp-by-name.php                     26-Sep-2022 04:10                4413
function.geoip-netspeedcell-by-name.php            26-Sep-2022 04:10                5214
function.geoip-org-by-name.php                     26-Sep-2022 04:10                4398
function.geoip-record-by-name.php                  26-Sep-2022 04:10                7610
function.geoip-region-by-name.php                  26-Sep-2022 04:10                5031
function.geoip-region-name-by-code.php             26-Sep-2022 04:10                7324
function.geoip-setup-custom-directory.php          26-Sep-2022 04:10                4185
function.geoip-time-zone-by-country-and-region.php 26-Sep-2022 04:10                7468
function.get-browser.php                           26-Sep-2022 04:10                7556
function.get-called-class.php                      26-Sep-2022 04:10                4844
function.get-cfg-var.php                           26-Sep-2022 04:10                4307
function.get-class-methods.php                     26-Sep-2022 04:10                6813
function.get-class-vars.php                        26-Sep-2022 04:10               11640
function.get-class.php                             26-Sep-2022 04:10                9304
function.get-current-user.php                      26-Sep-2022 04:10                4177
function.get-debug-type.php                        26-Sep-2022 04:11                9677
function.get-declared-classes.php                  26-Sep-2022 04:10                4356
function.get-declared-interfaces.php               26-Sep-2022 04:10                4047
function.get-declared-traits.php                   26-Sep-2022 04:10                2884
function.get-defined-constants.php                 26-Sep-2022 04:10                8621
function.get-defined-functions.php                 26-Sep-2022 04:10                6754
function.get-defined-vars.php                      26-Sep-2022 04:11                6327
function.get-extension-funcs.php                   26-Sep-2022 04:10                5431
function.get-headers.php                           26-Sep-2022 04:10                8646
function.get-html-translation-table.php            26-Sep-2022 04:10               13260
function.get-include-path.php                      26-Sep-2022 04:10                4075
function.get-included-files.php                    26-Sep-2022 04:10                5908
function.get-loaded-extensions.php                 26-Sep-2022 04:10                5501
function.get-magic-quotes-gpc.php                  26-Sep-2022 04:10                3955
function.get-magic-quotes-runtime.php              26-Sep-2022 04:10                4939
function.get-mangled-object-vars.php               26-Sep-2022 04:10                8239
function.get-meta-tags.php                         26-Sep-2022 04:10                8020
function.get-object-vars.php                       26-Sep-2022 04:10                6738
function.get-parent-class.php                      26-Sep-2022 04:10                7873
function.get-required-files.php                    26-Sep-2022 04:10                1803
function.get-resource-id.php                       26-Sep-2022 04:11                4575
function.get-resource-type.php                     26-Sep-2022 04:11                5278
function.get-resources.php                         26-Sep-2022 04:10                7587
function.getallheaders.php                         26-Sep-2022 04:10                4520
function.getcwd.php                                26-Sep-2022 04:10                4393
function.getdate.php                               26-Sep-2022 04:10                8699
function.getenv.php                                26-Sep-2022 04:10                4838
function.gethostbyaddr.php                         26-Sep-2022 04:10                4304
function.gethostbyname.php                         26-Sep-2022 04:10                4604
function.gethostbynamel.php                        26-Sep-2022 04:10                4976
function.gethostname.php                           26-Sep-2022 04:10                4108
function.getimagesize.php                          26-Sep-2022 04:10               17486
function.getimagesizefromstring.php                26-Sep-2022 04:10                5490
function.getlastmod.php                            26-Sep-2022 04:10                5078
function.getmxrr.php                               26-Sep-2022 04:10                6389
function.getmygid.php                              26-Sep-2022 04:10                3100
function.getmyinode.php                            26-Sep-2022 04:10                3117
function.getmypid.php                              26-Sep-2022 04:10                3503
function.getmyuid.php                              26-Sep-2022 04:10                3084
function.getopt.php                                26-Sep-2022 04:10               13148
function.getprotobyname.php                        26-Sep-2022 04:10                4586
function.getprotobynumber.php                      26-Sep-2022 04:10                3089
function.getrandmax.php                            26-Sep-2022 04:10                2816
function.getrusage.php                             26-Sep-2022 04:10               12105
function.getservbyname.php                         26-Sep-2022 04:10                6408
function.getservbyport.php                         26-Sep-2022 04:10                3492
function.gettext.php                               26-Sep-2022 04:10                5959
function.gettimeofday.php                          26-Sep-2022 04:10                5123
function.gettype.php                               26-Sep-2022 04:11                8700
function.glob.php                                  26-Sep-2022 04:10                9091
function.gmdate.php                                26-Sep-2022 04:10                7858
function.gmmktime.php                              26-Sep-2022 04:10               10146
function.gmp-abs.php                               26-Sep-2022 04:10                4433
function.gmp-add.php                               26-Sep-2022 04:10                4515
function.gmp-and.php                               26-Sep-2022 04:10                5186
function.gmp-binomial.php                          26-Sep-2022 04:10                3783
function.gmp-clrbit.php                            26-Sep-2022 04:10                5761
function.gmp-cmp.php                               26-Sep-2022 04:10                5572
function.gmp-com.php                               26-Sep-2022 04:10                3893
function.gmp-div-q.php                             26-Sep-2022 04:10               10135
function.gmp-div-qr.php                            26-Sep-2022 04:10                6619
function.gmp-div-r.php                             26-Sep-2022 04:10                5994
function.gmp-div.php                               26-Sep-2022 04:10                1650
function.gmp-divexact.php                          26-Sep-2022 04:10                5937
function.gmp-export.php                            26-Sep-2022 04:10                4269
function.gmp-fact.php                              26-Sep-2022 04:10                4937
function.gmp-gcd.php                               26-Sep-2022 04:10                5106
function.gmp-gcdext.php                            26-Sep-2022 04:10                9633
function.gmp-hamdist.php                           26-Sep-2022 04:10                6438
function.gmp-import.php                            26-Sep-2022 04:10                4812
function.gmp-init.php                              26-Sep-2022 04:10                5903
function.gmp-intval.php                            26-Sep-2022 04:10                5187
function.gmp-invert.php                            26-Sep-2022 04:10                5258
function.gmp-jacobi.php                            26-Sep-2022 04:10                5690
function.gmp-kronecker.php                         26-Sep-2022 04:10                3882
function.gmp-lcm.php                               26-Sep-2022 04:10                3811
function.gmp-legendre.php                          26-Sep-2022 04:10                5706
function.gmp-mod.php                               26-Sep-2022 04:10                4910
function.gmp-mul.php                               26-Sep-2022 04:10                5018
function.gmp-neg.php                               26-Sep-2022 04:10                4382
function.gmp-nextprime.php                         26-Sep-2022 04:10                5213
function.gmp-or.php                                26-Sep-2022 04:10                5488
function.gmp-perfect-power.php                     26-Sep-2022 04:10                3165
function.gmp-perfect-square.php                    26-Sep-2022 04:10                5535
function.gmp-popcount.php                          26-Sep-2022 04:10                4814
function.gmp-pow.php                               26-Sep-2022 04:10                5768
function.gmp-powm.php                              26-Sep-2022 04:10                5737
function.gmp-prob-prime.php                        26-Sep-2022 04:10                5805
function.gmp-random-bits.php                       26-Sep-2022 04:10                4876
function.gmp-random-range.php                      26-Sep-2022 04:10                5497
function.gmp-random-seed.php                       26-Sep-2022 04:10                6844
function.gmp-random.php                            26-Sep-2022 04:10                5170
function.gmp-root.php                              26-Sep-2022 04:10                3111
function.gmp-rootrem.php                           26-Sep-2022 04:10                3201
function.gmp-scan0.php                             26-Sep-2022 04:10                5596
function.gmp-scan1.php                             26-Sep-2022 04:10                5625
function.gmp-setbit.php                            26-Sep-2022 04:10               12149
function.gmp-sign.php                              26-Sep-2022 04:10                4924
function.gmp-sqrt.php                              26-Sep-2022 04:10                4982
function.gmp-sqrtrem.php                           26-Sep-2022 04:10                6399
function.gmp-strval.php                            26-Sep-2022 04:10                5372
function.gmp-sub.php                               26-Sep-2022 04:10                5065
function.gmp-testbit.php                           26-Sep-2022 04:10                5633
function.gmp-xor.php                               26-Sep-2022 04:10                5498
function.gmstrftime.php                            26-Sep-2022 04:10                6691
function.gnupg-adddecryptkey.php                   26-Sep-2022 04:10                5106
function.gnupg-addencryptkey.php                   26-Sep-2022 04:10                4695
function.gnupg-addsignkey.php                      26-Sep-2022 04:10                5111
function.gnupg-cleardecryptkeys.php                26-Sep-2022 04:10                4303
function.gnupg-clearencryptkeys.php                26-Sep-2022 04:10                4304
function.gnupg-clearsignkeys.php                   26-Sep-2022 04:10                4247
function.gnupg-decrypt.php                         26-Sep-2022 04:10                5945
function.gnupg-decryptverify.php                   26-Sep-2022 04:10                6995
function.gnupg-deletekey.php                       26-Sep-2022 04:10                4889
function.gnupg-encrypt.php                         26-Sep-2022 04:10                5833
function.gnupg-encryptsign.php                     26-Sep-2022 04:10                6741
function.gnupg-export.php                          26-Sep-2022 04:10                4973
function.gnupg-getengineinfo.php                   26-Sep-2022 04:10                5462
function.gnupg-geterror.php                        26-Sep-2022 04:10                4187
function.gnupg-geterrorinfo.php                    26-Sep-2022 04:10                5605
function.gnupg-getprotocol.php                     26-Sep-2022 04:10                4309
function.gnupg-gettrustlist.php                    26-Sep-2022 04:10                4991
function.gnupg-import.php                          26-Sep-2022 04:10                5276
function.gnupg-init.php                            26-Sep-2022 04:10                3222
function.gnupg-keyinfo.php                         26-Sep-2022 04:10                5160
function.gnupg-listsignatures.php                  26-Sep-2022 04:10                5220
function.gnupg-setarmor.php                        26-Sep-2022 04:10                5632
function.gnupg-seterrormode.php                    26-Sep-2022 04:10                5492
function.gnupg-setsignmode.php                     26-Sep-2022 04:10                5386
function.gnupg-sign.php                            26-Sep-2022 04:10                6055
function.gnupg-verify.php                          26-Sep-2022 04:10                8146
function.grapheme-extract.php                      26-Sep-2022 04:10                7867
function.grapheme-stripos.php                      26-Sep-2022 04:10                7850
function.grapheme-stristr.php                      26-Sep-2022 04:10                7915
function.grapheme-strlen.php                       26-Sep-2022 04:10                5545
function.grapheme-strpos.php                       26-Sep-2022 04:10                7431
function.grapheme-strripos.php                     26-Sep-2022 04:10                7855
function.grapheme-strrpos.php                      26-Sep-2022 04:10                7428
function.grapheme-strstr.php                       26-Sep-2022 04:10                7512
function.grapheme-substr.php                       26-Sep-2022 04:10                7655
function.gregoriantojd.php                         26-Sep-2022 04:10                5566
function.gzclose.php                               26-Sep-2022 04:10                4144
function.gzcompress.php                            26-Sep-2022 04:10                5847
function.gzdecode.php                              26-Sep-2022 04:10                3270
function.gzdeflate.php                             26-Sep-2022 04:10                5443
function.gzencode.php                              26-Sep-2022 04:10                8092
function.gzeof.php                                 26-Sep-2022 04:10                4034
function.gzfile.php                                26-Sep-2022 04:10                4670
function.gzgetc.php                                26-Sep-2022 04:10                4658
function.gzgets.php                                26-Sep-2022 04:10                5382
function.gzgetss.php                               26-Sep-2022 04:10                6051
function.gzinflate.php                             26-Sep-2022 04:10                5215
function.gzopen.php                                26-Sep-2022 04:10                5568
function.gzpassthru.php                            26-Sep-2022 04:10                4763
function.gzputs.php                                26-Sep-2022 04:10                1617
function.gzread.php                                26-Sep-2022 04:10                6071
function.gzrewind.php                              26-Sep-2022 04:10                3156
function.gzseek.php                                26-Sep-2022 04:10                6157
function.gztell.php                                26-Sep-2022 04:10                3299
function.gzuncompress.php                          26-Sep-2022 04:10                5164
function.gzwrite.php                               26-Sep-2022 04:10                5877
function.halt-compiler.php                         26-Sep-2022 04:10                5139
function.hash-algos.php                            26-Sep-2022 04:10                5078
function.hash-copy.php                             26-Sep-2022 04:10                4814
function.hash-equals.php                           26-Sep-2022 04:10                6596
function.hash-file.php                             26-Sep-2022 04:10                6334
function.hash-final.php                            26-Sep-2022 04:10                5607
function.hash-hkdf.php                             26-Sep-2022 04:10                8917
function.hash-hmac-algos.php                       26-Sep-2022 04:10                5283
function.hash-hmac-file.php                        26-Sep-2022 04:10                6517
function.hash-hmac.php                             26-Sep-2022 04:10                6270
function.hash-init.php                             26-Sep-2022 04:10                7813
function.hash-pbkdf2.php                           26-Sep-2022 04:10               10536
function.hash-update-file.php                      26-Sep-2022 04:10                4761
function.hash-update-stream.php                    26-Sep-2022 04:10                6523
function.hash-update.php                           26-Sep-2022 04:10                3727
function.hash.php                                  26-Sep-2022 04:10               11085
function.header-register-callback.php              26-Sep-2022 04:10                6984
function.header-remove.php                         26-Sep-2022 04:10                6074
function.header.php                                26-Sep-2022 04:10               19071
function.headers-list.php                          26-Sep-2022 04:10                6125
function.headers-sent.php                          26-Sep-2022 04:10                8135
function.hebrev.php                                26-Sep-2022 04:10                3231
function.hebrevc.php                               26-Sep-2022 04:10                3337
function.hex2bin.php                               26-Sep-2022 04:10                5562
function.hexdec.php                                26-Sep-2022 04:10                5704
function.highlight-file.php                        26-Sep-2022 04:10                5319
function.highlight-string.php                      26-Sep-2022 04:10                6072
function.hrtime.php                                26-Sep-2022 04:10                4692
function.html-entity-decode.php                    26-Sep-2022 04:10               14408
function.htmlentities.php                          26-Sep-2022 04:10               17728
function.htmlspecialchars-decode.php               26-Sep-2022 04:10                8398
function.htmlspecialchars.php                      26-Sep-2022 04:10               21568
function.http-build-query.php                      26-Sep-2022 04:10               21819
function.http-response-code.php                    26-Sep-2022 04:10                7182
function.hypot.php                                 26-Sep-2022 04:10                2902
function.ibase-add-user.php                        26-Sep-2022 04:10                3705
function.ibase-affected-rows.php                   26-Sep-2022 04:10                3388
function.ibase-backup.php                          26-Sep-2022 04:10                2775
function.ibase-blob-add.php                        26-Sep-2022 04:10                3918
function.ibase-blob-cancel.php                     26-Sep-2022 04:10                3550
function.ibase-blob-close.php                      26-Sep-2022 04:10                3860
function.ibase-blob-create.php                     26-Sep-2022 04:10                3810
function.ibase-blob-echo.php                       26-Sep-2022 04:10                3915
function.ibase-blob-get.php                        26-Sep-2022 04:10                6528
function.ibase-blob-import.php                     26-Sep-2022 04:10                8399
function.ibase-blob-info.php                       26-Sep-2022 04:10                3247
function.ibase-blob-open.php                       26-Sep-2022 04:10                3934
function.ibase-close.php                           26-Sep-2022 04:10                3601
function.ibase-commit-ret.php                      26-Sep-2022 04:10                2994
function.ibase-commit.php                          26-Sep-2022 04:10                2814
function.ibase-connect.php                         26-Sep-2022 04:10               10365
function.ibase-db-info.php                         26-Sep-2022 04:10                2430
function.ibase-delete-user.php                     26-Sep-2022 04:10                3005
function.ibase-drop-db.php                         26-Sep-2022 04:10                3491
function.ibase-errcode.php                         26-Sep-2022 04:10                2407
function.ibase-errmsg.php                          26-Sep-2022 04:10                2393
function.ibase-execute.php                         26-Sep-2022 04:10                7487
function.ibase-fetch-assoc.php                     26-Sep-2022 04:10                4535
function.ibase-fetch-object.php                    26-Sep-2022 04:10                6666
function.ibase-fetch-row.php                       26-Sep-2022 04:10                4383
function.ibase-field-info.php                      26-Sep-2022 04:10                7134
function.ibase-free-event-handler.php              26-Sep-2022 04:10                3301
function.ibase-free-query.php                      26-Sep-2022 04:10                2610
function.ibase-free-result.php                     26-Sep-2022 04:10                2716
function.ibase-gen-id.php                          26-Sep-2022 04:10                2678
function.ibase-maintain-db.php                     26-Sep-2022 04:10                2777
function.ibase-modify-user.php                     26-Sep-2022 04:10                3733
function.ibase-name-result.php                     26-Sep-2022 04:10                5774
function.ibase-num-fields.php                      26-Sep-2022 04:10                6698
function.ibase-num-params.php                      26-Sep-2022 04:10                3421
function.ibase-param-info.php                      26-Sep-2022 04:10                3607
function.ibase-pconnect.php                        26-Sep-2022 04:10                7692
function.ibase-prepare.php                         26-Sep-2022 04:10                3489
function.ibase-query.php                           26-Sep-2022 04:10                7871
function.ibase-restore.php                         26-Sep-2022 04:10                2771
function.ibase-rollback-ret.php                    26-Sep-2022 04:10                2998
function.ibase-rollback.php                        26-Sep-2022 04:10                2815
function.ibase-server-info.php                     26-Sep-2022 04:10                2127
function.ibase-service-attach.php                  26-Sep-2022 04:10                2248
function.ibase-service-detach.php                  26-Sep-2022 04:10                2342
function.ibase-set-event-handler.php               26-Sep-2022 04:10                8327
function.ibase-trans.php                           26-Sep-2022 04:10                5653
function.ibase-wait-event.php                      26-Sep-2022 04:10                4529
function.iconv-get-encoding.php                    26-Sep-2022 04:10                5572
function.iconv-mime-decode-headers.php             26-Sep-2022 04:10                9820
function.iconv-mime-decode.php                     26-Sep-2022 04:10                7719
function.iconv-mime-encode.php                     26-Sep-2022 04:10               11894
function.iconv-set-encoding.php                    26-Sep-2022 04:10                4903
function.iconv-strlen.php                          26-Sep-2022 04:10                4060
function.iconv-strpos.php                          26-Sep-2022 04:10                6768
function.iconv-strrpos.php                         26-Sep-2022 04:10                5796
function.iconv-substr.php                          26-Sep-2022 04:10                7553
function.iconv.php                                 26-Sep-2022 04:10                6911
function.idate.php                                 26-Sep-2022 04:10               10267
function.idn-to-ascii.php                          26-Sep-2022 04:10                6355
function.idn-to-utf8.php                           26-Sep-2022 04:10                6352
function.igbinary-serialize.php                    26-Sep-2022 04:10                9640
function.igbinary-unserialize.php                  26-Sep-2022 04:10                9127
function.ignore-user-abort.php                     26-Sep-2022 04:10                7293
function.image-type-to-extension.php               26-Sep-2022 04:10                5004
function.image-type-to-mime-type.php               26-Sep-2022 04:10                7727
function.image2wbmp.php                            26-Sep-2022 04:10                5878
function.imageaffine.php                           26-Sep-2022 04:10                3385
function.imageaffinematrixconcat.php               26-Sep-2022 04:10                2949
function.imageaffinematrixget.php                  26-Sep-2022 04:10                3139
function.imagealphablending.php                    26-Sep-2022 04:10                6817
function.imageantialias.php                        26-Sep-2022 04:10               10267
function.imagearc.php                              26-Sep-2022 04:10               13173
function.imageavif.php                             26-Sep-2022 04:10                5590
function.imagebmp.php                              26-Sep-2022 04:10                7539
function.imagechar.php                             26-Sep-2022 04:10                8640
function.imagecharup.php                           26-Sep-2022 04:10                8490
function.imagecolorallocate.php                    26-Sep-2022 04:10                9663
function.imagecolorallocatealpha.php               26-Sep-2022 04:10               16279
function.imagecolorat.php                          26-Sep-2022 04:10                8881
function.imagecolorclosest.php                     26-Sep-2022 04:10               11979
function.imagecolorclosestalpha.php                26-Sep-2022 04:10               13038
function.imagecolorclosesthwb.php                  26-Sep-2022 04:10                6231
function.imagecolordeallocate.php                  26-Sep-2022 04:10                5033
function.imagecolorexact.php                       26-Sep-2022 04:10                7761
function.imagecolorexactalpha.php                  26-Sep-2022 04:10                8641
function.imagecolormatch.php                       26-Sep-2022 04:10                8014
function.imagecolorresolve.php                     26-Sep-2022 04:10                6951
function.imagecolorresolvealpha.php                26-Sep-2022 04:10                7598
function.imagecolorset.php                         26-Sep-2022 04:10                8302
function.imagecolorsforindex.php                   26-Sep-2022 04:10                6278
function.imagecolorstotal.php                      26-Sep-2022 04:10                5266
function.imagecolortransparent.php                 26-Sep-2022 04:10                8087
function.imageconvolution.php                      26-Sep-2022 04:10               11412
function.imagecopy.php                             26-Sep-2022 04:10                7984
function.imagecopymerge.php                        26-Sep-2022 04:10                8561
function.imagecopymergegray.php                    26-Sep-2022 04:10                9072
function.imagecopyresampled.php                    26-Sep-2022 04:10               18202
function.imagecopyresized.php                      26-Sep-2022 04:10               12809
function.imagecreate.php                           26-Sep-2022 04:10                7692
function.imagecreatefromavif.php                   26-Sep-2022 04:10                2786
function.imagecreatefrombmp.php                    26-Sep-2022 04:10                5594
function.imagecreatefromgd.php                     26-Sep-2022 04:10                5256
function.imagecreatefromgd2.php                    26-Sep-2022 04:10                5444
function.imagecreatefromgd2part.php                26-Sep-2022 04:10                8021
function.imagecreatefromgif.php                    26-Sep-2022 04:10                9987
function.imagecreatefromjpeg.php                   26-Sep-2022 04:10                9325
function.imagecreatefrompng.php                    26-Sep-2022 04:10                9268
function.imagecreatefromstring.php                 26-Sep-2022 04:10                7158
function.imagecreatefromtga.php                    26-Sep-2022 04:10                3424
function.imagecreatefromwbmp.php                   26-Sep-2022 04:10                8978
function.imagecreatefromwebp.php                   26-Sep-2022 04:10                5010
function.imagecreatefromxbm.php                    26-Sep-2022 04:10                4860
function.imagecreatefromxpm.php                    26-Sep-2022 04:10                6333
function.imagecreatetruecolor.php                  26-Sep-2022 04:10                7040
function.imagecrop.php                             26-Sep-2022 04:10                3054
function.imagecropauto.php                         26-Sep-2022 04:10                3849
function.imagedashedline.php                       26-Sep-2022 04:10               12838
function.imagedestroy.php                          26-Sep-2022 04:10                3996
function.imageellipse.php                          26-Sep-2022 04:10                9498
function.imagefill.php                             26-Sep-2022 04:10                6757
function.imagefilledarc.php                        26-Sep-2022 04:10               17954
function.imagefilledellipse.php                    26-Sep-2022 04:10                8975
function.imagefilledpolygon.php                    26-Sep-2022 04:10               10393
function.imagefilledrectangle.php                  26-Sep-2022 04:10                7452
function.imagefilltoborder.php                     26-Sep-2022 04:10               10091
function.imagefilter.php                           26-Sep-2022 04:10               30541
function.imageflip.php                             26-Sep-2022 04:10                8841
function.imagefontheight.php                       26-Sep-2022 04:10                5626
function.imagefontwidth.php                        26-Sep-2022 04:10                5606
function.imageftbbox.php                           26-Sep-2022 04:10               13074
function.imagefttext.php                           26-Sep-2022 04:10               14586
function.imagegammacorrect.php                     26-Sep-2022 04:10                5073
function.imagegd.php                               26-Sep-2022 04:10                9191
function.imagegd2.php                              26-Sep-2022 04:10               10754
function.imagegetclip.php                          26-Sep-2022 04:10                5916
function.imagegetinterpolation.php                 26-Sep-2022 04:10                3560
function.imagegif.php                              26-Sep-2022 04:10               17033
function.imagegrabscreen.php                       26-Sep-2022 04:10                3983
function.imagegrabwindow.php                       26-Sep-2022 04:10                8972
function.imageinterlace.php                        26-Sep-2022 04:10                5080
function.imageistruecolor.php                      26-Sep-2022 04:10                7055
function.imagejpeg.php                             26-Sep-2022 04:10               15459
function.imagelayereffect.php                      26-Sep-2022 04:10               10857
function.imageline.php                             26-Sep-2022 04:10               15653
function.imageloadfont.php                         26-Sep-2022 04:10                8880
function.imageopenpolygon.php                      26-Sep-2022 04:10               10246
function.imagepalettecopy.php                      26-Sep-2022 04:10                7006
function.imagepalettetotruecolor.php               26-Sep-2022 04:10                9673
function.imagepng.php                              26-Sep-2022 04:10                7733
function.imagepolygon.php                          26-Sep-2022 04:10                8507
function.imagerectangle.php                        26-Sep-2022 04:10                9796
function.imageresolution.php                       26-Sep-2022 04:10                7188
function.imagerotate.php                           26-Sep-2022 04:10                8810
function.imagesavealpha.php                        26-Sep-2022 04:10                6323
function.imagescale.php                            26-Sep-2022 04:10                4931
function.imagesetbrush.php                         26-Sep-2022 04:10                8665
function.imagesetclip.php                          26-Sep-2022 04:10                4778
function.imagesetinterpolation.php                 26-Sep-2022 04:10                9448
function.imagesetpixel.php                         26-Sep-2022 04:10               10942
function.imagesetstyle.php                         26-Sep-2022 04:10               12532
function.imagesetthickness.php                     26-Sep-2022 04:10                7786
function.imagesettile.php                          26-Sep-2022 04:10                7716
function.imagestring.php                           26-Sep-2022 04:10                8732
function.imagestringup.php                         26-Sep-2022 04:10                7811
function.imagesx.php                               26-Sep-2022 04:10                4483
function.imagesy.php                               26-Sep-2022 04:10                4511
function.imagetruecolortopalette.php               26-Sep-2022 04:10                6061
function.imagettfbbox.php                          26-Sep-2022 04:10               19398
function.imagettftext.php                          26-Sep-2022 04:10               17274
function.imagetypes.php                            26-Sep-2022 04:10                3196
function.imagewbmp.php                             26-Sep-2022 04:10               14728
function.imagewebp.php                             26-Sep-2022 04:10                6915
function.imagexbm.php                              26-Sep-2022 04:10               10122
function.imap-8bit.php                             26-Sep-2022 04:10                2889
function.imap-alerts.php                           26-Sep-2022 04:10                2872
function.imap-append.php                           26-Sep-2022 04:10                9070
function.imap-base64.php                           26-Sep-2022 04:10                3242
function.imap-binary.php                           26-Sep-2022 04:10                2823
function.imap-body.php                             26-Sep-2022 04:10                4393
function.imap-bodystruct.php                       26-Sep-2022 04:10                3638
function.imap-check.php                            26-Sep-2022 04:10                5104
function.imap-clearflag-full.php                   26-Sep-2022 04:10                4821
function.imap-close.php                            26-Sep-2022 04:10                3411
function.imap-create.php                           26-Sep-2022 04:10                1723
function.imap-createmailbox.php                    26-Sep-2022 04:10               14988
function.imap-delete.php                           26-Sep-2022 04:10                8840
function.imap-deletemailbox.php                    26-Sep-2022 04:10                3794
function.imap-errors.php                           26-Sep-2022 04:10                3147
function.imap-expunge.php                          26-Sep-2022 04:10                2763
function.imap-fetch-overview.php                   26-Sep-2022 04:10               10392
function.imap-fetchbody.php                        26-Sep-2022 04:10                5012
function.imap-fetchheader.php                      26-Sep-2022 04:10                4656
function.imap-fetchmime.php                        26-Sep-2022 04:10                5202
function.imap-fetchstructure.php                   26-Sep-2022 04:10                8607
function.imap-fetchtext.php                        26-Sep-2022 04:10                1704
function.imap-gc.php                               26-Sep-2022 04:10                4186
function.imap-get-quota.php                        26-Sep-2022 04:10               11996
function.imap-get-quotaroot.php                    26-Sep-2022 04:10                8824
function.imap-getacl.php                           26-Sep-2022 04:10                4554
function.imap-getmailboxes.php                     26-Sep-2022 04:10               10491
function.imap-getsubscribed.php                    26-Sep-2022 04:10                5634
function.imap-header.php                           26-Sep-2022 04:10                1711
function.imap-headerinfo.php                       26-Sep-2022 04:10               10836
function.imap-headers.php                          26-Sep-2022 04:10                2511
function.imap-last-error.php                       26-Sep-2022 04:10                2798
function.imap-list.php                             26-Sep-2022 04:10                7648
function.imap-listmailbox.php                      26-Sep-2022 04:10                1707
function.imap-listscan.php                         26-Sep-2022 04:10                5614
function.imap-listsubscribed.php                   26-Sep-2022 04:10                1728
function.imap-lsub.php                             26-Sep-2022 04:10                4644
function.imap-mail-compose.php                     26-Sep-2022 04:10               10184
function.imap-mail-copy.php                        26-Sep-2022 04:10                4701
function.imap-mail-move.php                        26-Sep-2022 04:10                5074
function.imap-mail.php                             26-Sep-2022 04:10                5715
function.imap-mailboxmsginfo.php                   26-Sep-2022 04:10                9520
function.imap-mime-header-decode.php               26-Sep-2022 04:10                6284
function.imap-msgno.php                            26-Sep-2022 04:10                3343
function.imap-mutf7-to-utf8.php                    26-Sep-2022 04:10                3142
function.imap-num-msg.php                          26-Sep-2022 04:10                3077
function.imap-num-recent.php                       26-Sep-2022 04:10                3107
function.imap-open.php                             26-Sep-2022 04:10               22153
function.imap-ping.php                             26-Sep-2022 04:10                4186
function.imap-qprint.php                           26-Sep-2022 04:10                2868
function.imap-rename.php                           26-Sep-2022 04:10                1727
function.imap-renamemailbox.php                    26-Sep-2022 04:10                4109
function.imap-reopen.php                           26-Sep-2022 04:10                7814
function.imap-rfc822-parse-adrlist.php             26-Sep-2022 04:10                8238
function.imap-rfc822-parse-headers.php             26-Sep-2022 04:10                3593
function.imap-rfc822-write-address.php             26-Sep-2022 04:10                4727
function.imap-savebody.php                         26-Sep-2022 04:10                5300
function.imap-scan.php                             26-Sep-2022 04:10                1691
function.imap-scanmailbox.php                      26-Sep-2022 04:10                1719
function.imap-search.php                           26-Sep-2022 04:10               12970
function.imap-set-quota.php                        26-Sep-2022 04:10                5988
function.imap-setacl.php                           26-Sep-2022 04:10                4181
function.imap-setflag-full.php                     26-Sep-2022 04:10                7176
function.imap-sort.php                             26-Sep-2022 04:10                6097
function.imap-status.php                           26-Sep-2022 04:10                9654
function.imap-subscribe.php                        26-Sep-2022 04:10                3245
function.imap-thread.php                           26-Sep-2022 04:10                7131
function.imap-timeout.php                          26-Sep-2022 04:10                4409
function.imap-uid.php                              26-Sep-2022 04:10                3671
function.imap-undelete.php                         26-Sep-2022 04:10                3868
function.imap-unsubscribe.php                      26-Sep-2022 04:10                3332
function.imap-utf7-decode.php                      26-Sep-2022 04:10                3692
function.imap-utf7-encode.php                      26-Sep-2022 04:10                3334
function.imap-utf8-to-mutf7.php                    26-Sep-2022 04:10                3145
function.imap-utf8.php                             26-Sep-2022 04:10                3055
function.implode.php                               26-Sep-2022 04:10                7643
function.in-array.php                              26-Sep-2022 04:10               11388
function.include-once.php                          26-Sep-2022 04:10                2293
function.include.php                               26-Sep-2022 04:10               22238
function.inet-ntop.php                             26-Sep-2022 04:10                6936
function.inet-pton.php                             26-Sep-2022 04:10                5336
function.inflate-add.php                           26-Sep-2022 04:10                5394
function.inflate-get-read-len.php                  26-Sep-2022 04:10                3294
function.inflate-get-status.php                    26-Sep-2022 04:10                3172
function.inflate-init.php                          26-Sep-2022 04:10                5978
function.ini-alter.php                             26-Sep-2022 04:10                1659
function.ini-get-all.php                           26-Sep-2022 04:10               10023
function.ini-get.php                               26-Sep-2022 04:10               11903
function.ini-restore.php                           26-Sep-2022 04:10                6548
function.ini-set.php                               26-Sep-2022 04:10                5590
function.inotify-add-watch.php                     26-Sep-2022 04:10                4048
function.inotify-init.php                          26-Sep-2022 04:10                9461
function.inotify-queue-len.php                     26-Sep-2022 04:10                3750
function.inotify-read.php                          26-Sep-2022 04:10                4475
function.inotify-rm-watch.php                      26-Sep-2022 04:10                3417
function.intdiv.php                                26-Sep-2022 04:10                6753
function.interface-exists.php                      26-Sep-2022 04:10                5147
function.intl-error-name.php                       26-Sep-2022 04:10                5159
function.intl-get-error-code.php                   26-Sep-2022 04:10                4602
function.intl-get-error-message.php                26-Sep-2022 04:10                4560
function.intl-is-failure.php                       26-Sep-2022 04:10                5595
function.intval.php                                26-Sep-2022 04:11               13882
function.ip2long.php                               26-Sep-2022 04:10               10272
function.iptcembed.php                             26-Sep-2022 04:10               12916
function.iptcparse.php                             26-Sep-2022 04:10                4470
function.is-a.php                                  26-Sep-2022 04:10                7819
function.is-array.php                              26-Sep-2022 04:11                5635
function.is-bool.php                               26-Sep-2022 04:11                5683
function.is-callable.php                           26-Sep-2022 04:11               10731
function.is-countable.php                          26-Sep-2022 04:11                6324
function.is-dir.php                                26-Sep-2022 04:10                6490
function.is-double.php                             26-Sep-2022 04:11                1662
function.is-executable.php                         26-Sep-2022 04:10                5527
function.is-file.php                               26-Sep-2022 04:10                5768
function.is-finite.php                             26-Sep-2022 04:10                3094
function.is-float.php                              26-Sep-2022 04:11                5259
function.is-infinite.php                           26-Sep-2022 04:10                3192
function.is-int.php                                26-Sep-2022 04:11                6810
function.is-integer.php                            26-Sep-2022 04:11                1655
function.is-iterable.php                           26-Sep-2022 04:11                5798
function.is-link.php                               26-Sep-2022 04:10                5618
function.is-long.php                               26-Sep-2022 04:11                1636
function.is-nan.php                                26-Sep-2022 04:10                4492
function.is-null.php                               26-Sep-2022 04:11                5856
function.is-numeric.php                            26-Sep-2022 04:11                8568
function.is-object.php                             26-Sep-2022 04:11                7397
function.is-readable.php                           26-Sep-2022 04:10                6308
function.is-real.php                               26-Sep-2022 04:11                1648
function.is-resource.php                           26-Sep-2022 04:11                4475
function.is-scalar.php                             26-Sep-2022 04:11                7850
function.is-soap-fault.php                         26-Sep-2022 04:11                8173
function.is-string.php                             26-Sep-2022 04:11                6744
function.is-subclass-of.php                        26-Sep-2022 04:10               14350
function.is-tainted.php                            26-Sep-2022 04:10                2259
function.is-uploaded-file.php                      26-Sep-2022 04:10                6943
function.is-writable.php                           26-Sep-2022 04:10                5996
function.is-writeable.php                          26-Sep-2022 04:10                1712
function.isset.php                                 26-Sep-2022 04:11               17754
function.iterator-apply.php                        26-Sep-2022 04:10                6148
function.iterator-count.php                        26-Sep-2022 04:10                7843
function.iterator-to-array.php                     26-Sep-2022 04:10                7269
function.jddayofweek.php                           26-Sep-2022 04:10                3607
function.jdmonthname.php                           26-Sep-2022 04:10                4208
function.jdtofrench.php                            26-Sep-2022 04:10                3072
function.jdtogregorian.php                         26-Sep-2022 04:10                3088
function.jdtojewish.php                            26-Sep-2022 04:10                5447
function.jdtojulian.php                            26-Sep-2022 04:10                3097
function.jdtounix.php                              26-Sep-2022 04:10                3072
function.jewishtojd.php                            26-Sep-2022 04:10                3799
function.join.php                                  26-Sep-2022 04:10                1604
function.jpeg2wbmp.php                             26-Sep-2022 04:10                5957
function.json-decode.php                           26-Sep-2022 04:10               19699
function.json-encode.php                           26-Sep-2022 04:10               30025
function.json-last-error-msg.php                   26-Sep-2022 04:10                2722
function.json-last-error.php                       26-Sep-2022 04:10               13190
function.juliantojd.php                            26-Sep-2022 04:10                4350
function.key-exists.php                            26-Sep-2022 04:10                1689
function.key.php                                   26-Sep-2022 04:10                7168
function.krsort.php                                26-Sep-2022 04:10                5864
function.ksort.php                                 26-Sep-2022 04:10                5638
function.lcfirst.php                               26-Sep-2022 04:10                5653
function.lcg-value.php                             26-Sep-2022 04:10                3292
function.lchgrp.php                                26-Sep-2022 04:10                5871
function.lchown.php                                26-Sep-2022 04:10                5729
function.ldap-8859-to-t61.php                      26-Sep-2022 04:10                3057
function.ldap-add-ext.php                          26-Sep-2022 04:10                5308
function.ldap-add.php                              26-Sep-2022 04:10                8781
function.ldap-bind-ext.php                         26-Sep-2022 04:10                5358
function.ldap-bind.php                             26-Sep-2022 04:10                8872
function.ldap-close.php                            26-Sep-2022 04:10                1669
function.ldap-compare.php                          26-Sep-2022 04:10                9532
function.ldap-connect.php                          26-Sep-2022 04:10                7600
function.ldap-control-paged-result-response.php    26-Sep-2022 04:10                4429
function.ldap-control-paged-result.php             26-Sep-2022 04:10               14698
function.ldap-count-entries.php                    26-Sep-2022 04:10                4431
function.ldap-count-references.php                 26-Sep-2022 04:10                4515
function.ldap-delete-ext.php                       26-Sep-2022 04:10                4900
function.ldap-delete.php                           26-Sep-2022 04:10                3199
function.ldap-dn2ufn.php                           26-Sep-2022 04:10                2447
function.ldap-err2str.php                          26-Sep-2022 04:10                4767
function.ldap-errno.php                            26-Sep-2022 04:10                7206
function.ldap-error.php                            26-Sep-2022 04:10                3828
function.ldap-escape.php                           26-Sep-2022 04:10                3305
function.ldap-exop-passwd.php                      26-Sep-2022 04:10               10604
function.ldap-exop-refresh.php                     26-Sep-2022 04:10                4830
function.ldap-exop-whoami.php                      26-Sep-2022 04:10                3714
function.ldap-exop.php                             26-Sep-2022 04:10               12421
function.ldap-explode-dn.php                       26-Sep-2022 04:10                3419
function.ldap-first-attribute.php                  26-Sep-2022 04:10                5313
function.ldap-first-entry.php                      26-Sep-2022 04:10                3877
function.ldap-first-reference.php                  26-Sep-2022 04:10                2109
function.ldap-free-result.php                      26-Sep-2022 04:10                2997
function.ldap-get-attributes.php                   26-Sep-2022 04:10                7486
function.ldap-get-dn.php                           26-Sep-2022 04:10                2776
function.ldap-get-entries.php                      26-Sep-2022 04:10                4590
function.ldap-get-option.php                       26-Sep-2022 04:10               10248
function.ldap-get-values-len.php                   26-Sep-2022 04:10                4044
function.ldap-get-values.php                       26-Sep-2022 04:10                7801
function.ldap-list.php                             26-Sep-2022 04:10               12110
function.ldap-mod-add.php                          26-Sep-2022 04:10                4230
function.ldap-mod-del.php                          26-Sep-2022 04:10                3984
function.ldap-mod-replace.php                      26-Sep-2022 04:10                4291
function.ldap-mod_add-ext.php                      26-Sep-2022 04:10                5316
function.ldap-mod_del-ext.php                      26-Sep-2022 04:10                5327
function.ldap-mod_replace-ext.php                  26-Sep-2022 04:10                5396
function.ldap-modify-batch.php                     26-Sep-2022 04:10               20647
function.ldap-modify.php                           26-Sep-2022 04:10                3848
function.ldap-next-attribute.php                   26-Sep-2022 04:10                4789
function.ldap-next-entry.php                       26-Sep-2022 04:10                4132
function.ldap-next-reference.php                   26-Sep-2022 04:10                2097
function.ldap-parse-exop.php                       26-Sep-2022 04:10                5420
function.ldap-parse-reference.php                  26-Sep-2022 04:10                2241
function.ldap-parse-result.php                     26-Sep-2022 04:10                7352
function.ldap-read.php                             26-Sep-2022 04:10                8901
function.ldap-rename-ext.php                       26-Sep-2022 04:10                5542
function.ldap-rename.php                           26-Sep-2022 04:10                4917
function.ldap-sasl-bind.php                        26-Sep-2022 04:10                4804
function.ldap-search.php                           26-Sep-2022 04:10               13879
function.ldap-set-option.php                       26-Sep-2022 04:10               14308
function.ldap-set-rebind-proc.php                  26-Sep-2022 04:10                2228
function.ldap-sort.php                             26-Sep-2022 04:10                6870
function.ldap-start-tls.php                        26-Sep-2022 04:10                1914
function.ldap-t61-to-8859.php                      26-Sep-2022 04:10                1990
function.ldap-unbind.php                           26-Sep-2022 04:10                2896
function.levenshtein.php                           26-Sep-2022 04:10               13155
function.libxml-clear-errors.php                   26-Sep-2022 04:11                2685
function.libxml-disable-entity-loader.php          26-Sep-2022 04:11                3530
function.libxml-get-errors.php                     26-Sep-2022 04:11               11766
function.libxml-get-last-error.php                 26-Sep-2022 04:11                2878
function.libxml-set-external-entity-loader.php     26-Sep-2022 04:11                8136
function.libxml-set-streams-context.php            26-Sep-2022 04:11                5253
function.libxml-use-internal-errors.php            26-Sep-2022 04:11                6011
function.link.php                                  26-Sep-2022 04:10                5895
function.linkinfo.php                              26-Sep-2022 04:10                4856
function.list.php                                  26-Sep-2022 04:10               18504
function.localeconv.php                            26-Sep-2022 04:10                9392
function.localtime.php                             26-Sep-2022 04:10                8987
function.log.php                                   26-Sep-2022 04:10                3698
function.log10.php                                 26-Sep-2022 04:10                2604
function.log1p.php                                 26-Sep-2022 04:10                4003
function.long2ip.php                               26-Sep-2022 04:10                3045
function.lstat.php                                 26-Sep-2022 04:10                6215
function.ltrim.php                                 26-Sep-2022 04:10                9702
function.lzf-compress.php                          26-Sep-2022 04:10                2812
function.lzf-decompress.php                        26-Sep-2022 04:10                2907
function.lzf-optimized-for.php                     26-Sep-2022 04:10                1997
function.mail.php                                  26-Sep-2022 04:10               25409
function.mailparse-determine-best-xfer-encoding..> 26-Sep-2022 04:10                4243
function.mailparse-msg-create.php                  26-Sep-2022 04:10                3364
function.mailparse-msg-extract-part-file.php       26-Sep-2022 04:10                5200
function.mailparse-msg-extract-part.php            26-Sep-2022 04:10                4070
function.mailparse-msg-extract-whole-part-file.php 26-Sep-2022 04:10                4056
function.mailparse-msg-free.php                    26-Sep-2022 04:10                3451
function.mailparse-msg-get-part-data.php           26-Sep-2022 04:10                2487
function.mailparse-msg-get-part.php                26-Sep-2022 04:10                2708
function.mailparse-msg-get-structure.php           26-Sep-2022 04:10                2502
function.mailparse-msg-parse-file.php              26-Sep-2022 04:10                4154
function.mailparse-msg-parse.php                   26-Sep-2022 04:10                3017
function.mailparse-rfc822-parse-addresses.php      26-Sep-2022 04:10                5593
function.mailparse-stream-encode.php               26-Sep-2022 04:10                5794
function.mailparse-uudecode-all.php                26-Sep-2022 04:10                7036
function.max.php                                   26-Sep-2022 04:10               13557
function.mb-check-encoding.php                     26-Sep-2022 04:10                3243
function.mb-chr.php                                26-Sep-2022 04:10                6888
function.mb-convert-case.php                       26-Sep-2022 04:10               10279
function.mb-convert-encoding.php                   26-Sep-2022 04:10                7233
function.mb-convert-kana.php                       26-Sep-2022 04:10                8757
function.mb-convert-variables.php                  26-Sep-2022 04:10                6535
function.mb-decode-mimeheader.php                  26-Sep-2022 04:10                3073
function.mb-decode-numericentity.php               26-Sep-2022 04:10               35660
function.mb-detect-encoding.php                    26-Sep-2022 04:10                7167
function.mb-detect-order.php                       26-Sep-2022 04:10                8672
function.mb-encode-mimeheader.php                  26-Sep-2022 04:10                8364
function.mb-encode-numericentity.php               26-Sep-2022 04:10               13368
function.mb-encoding-aliases.php                   26-Sep-2022 04:10                5804
function.mb-ereg-match.php                         26-Sep-2022 04:10                4311
function.mb-ereg-replace-callback.php              26-Sep-2022 04:10               13007
function.mb-ereg-replace.php                       26-Sep-2022 04:10                6811
function.mb-ereg-search-getpos.php                 26-Sep-2022 04:10                4032
function.mb-ereg-search-getregs.php                26-Sep-2022 04:10                4255
function.mb-ereg-search-init.php                   26-Sep-2022 04:10                4890
function.mb-ereg-search-pos.php                    26-Sep-2022 04:10                4721
function.mb-ereg-search-regs.php                   26-Sep-2022 04:10                4502
function.mb-ereg-search-setpos.php                 26-Sep-2022 04:10                3963
function.mb-ereg-search.php                        26-Sep-2022 04:10                4503
function.mb-ereg.php                               26-Sep-2022 04:10                4713
function.mb-eregi-replace.php                      26-Sep-2022 04:10                6026
function.mb-eregi.php                              26-Sep-2022 04:10                4754
function.mb-get-info.php                           26-Sep-2022 04:10                4790
function.mb-http-input.php                         26-Sep-2022 04:10                3994
function.mb-http-output.php                        26-Sep-2022 04:10                4358
function.mb-internal-encoding.php                  26-Sep-2022 04:10                5816
function.mb-language.php                           26-Sep-2022 04:10                3883
function.mb-list-encodings.php                     26-Sep-2022 04:10                4711
function.mb-ord.php                                26-Sep-2022 04:10                6534
function.mb-output-handler.php                     26-Sep-2022 04:10                6701
function.mb-parse-str.php                          26-Sep-2022 04:10                3984
function.mb-preferred-mime-name.php                26-Sep-2022 04:10                4210
function.mb-regex-encoding.php                     26-Sep-2022 04:10                4406
function.mb-regex-set-options.php                  26-Sep-2022 04:10                6415
function.mb-scrub.php                              26-Sep-2022 04:10                3197
function.mb-send-mail.php                          26-Sep-2022 04:10                8479
function.mb-split.php                              26-Sep-2022 04:10                4403
function.mb-str-split.php                          26-Sep-2022 04:10                4968
function.mb-strcut.php                             26-Sep-2022 04:10                6551
function.mb-strimwidth.php                         26-Sep-2022 04:10                5988
function.mb-stripos.php                            26-Sep-2022 04:10                5339
function.mb-stristr.php                            26-Sep-2022 04:10                5595
function.mb-strlen.php                             26-Sep-2022 04:10                4873
function.mb-strpos.php                             26-Sep-2022 04:10                5047
function.mb-strrchr.php                            26-Sep-2022 04:10                5389
function.mb-strrichr.php                           26-Sep-2022 04:10                5467
function.mb-strripos.php                           26-Sep-2022 04:10                5429
function.mb-strrpos.php                            26-Sep-2022 04:10                6451
function.mb-strstr.php                             26-Sep-2022 04:10                5384
function.mb-strtolower.php                         26-Sep-2022 04:10                7244
function.mb-strtoupper.php                         26-Sep-2022 04:10                7258
function.mb-strwidth.php                           26-Sep-2022 04:10                4353
function.mb-substitute-character.php               26-Sep-2022 04:10                6102
function.mb-substr-count.php                       26-Sep-2022 04:10                5193
function.mb-substr.php                             26-Sep-2022 04:10                6272
function.mcrypt-create-iv.php                      26-Sep-2022 04:10                7760
function.mcrypt-decrypt.php                        26-Sep-2022 04:10                6438
function.mcrypt-enc-get-algorithms-name.php        26-Sep-2022 04:10                5253
function.mcrypt-enc-get-block-size.php             26-Sep-2022 04:10                2899
function.mcrypt-enc-get-iv-size.php                26-Sep-2022 04:10                3008
function.mcrypt-enc-get-key-size.php               26-Sep-2022 04:10                2907
function.mcrypt-enc-get-modes-name.php             26-Sep-2022 04:10                5167
function.mcrypt-enc-get-supported-key-sizes.php    26-Sep-2022 04:10                4977
function.mcrypt-enc-is-block-algorithm-mode.php    26-Sep-2022 04:10                3261
function.mcrypt-enc-is-block-algorithm.php         26-Sep-2022 04:10                3070
function.mcrypt-enc-is-block-mode.php              26-Sep-2022 04:10                3062
function.mcrypt-enc-self-test.php                  26-Sep-2022 04:10                2998
function.mcrypt-encrypt.php                        26-Sep-2022 04:10               16974
function.mcrypt-generic-deinit.php                 26-Sep-2022 04:10                3878
function.mcrypt-generic-init.php                   26-Sep-2022 04:10                5035
function.mcrypt-generic.php                        26-Sep-2022 04:10                5976
function.mcrypt-get-block-size.php                 26-Sep-2022 04:10                6302
function.mcrypt-get-cipher-name.php                26-Sep-2022 04:10                4758
function.mcrypt-get-iv-size.php                    26-Sep-2022 04:10                6543
function.mcrypt-get-key-size.php                   26-Sep-2022 04:10                6462
function.mcrypt-list-algorithms.php                26-Sep-2022 04:10                4751
function.mcrypt-list-modes.php                     26-Sep-2022 04:10                4762
function.mcrypt-module-close.php                   26-Sep-2022 04:10                3262
function.mcrypt-module-get-algo-block-size.php     26-Sep-2022 04:10                3394
function.mcrypt-module-get-algo-key-size.php       26-Sep-2022 04:10                3469
function.mcrypt-module-get-supported-key-sizes.php 26-Sep-2022 04:10                4603
function.mcrypt-module-is-block-algorithm-mode.php 26-Sep-2022 04:10                4035
function.mcrypt-module-is-block-algorithm.php      26-Sep-2022 04:10                3713
function.mcrypt-module-is-block-mode.php           26-Sep-2022 04:10                4012
function.mcrypt-module-open.php                    26-Sep-2022 04:10               15023
function.mcrypt-module-self-test.php               26-Sep-2022 04:10                4854
function.md5-file.php                              26-Sep-2022 04:10                5681
function.md5.php                                   26-Sep-2022 04:10                6049
function.mdecrypt-generic.php                      26-Sep-2022 04:10               11807
function.memcache-debug.php                        26-Sep-2022 04:10                3267
function.memory-get-peak-usage.php                 26-Sep-2022 04:10                4054
function.memory-get-usage.php                      26-Sep-2022 04:10                6302
function.metaphone.php                             26-Sep-2022 04:10                6140
function.method-exists.php                         26-Sep-2022 04:10                6370
function.mhash-count.php                           26-Sep-2022 04:10                3743
function.mhash-get-block-size.php                  26-Sep-2022 04:10                3480
function.mhash-get-hash-name.php                   26-Sep-2022 04:10                3436
function.mhash-keygen-s2k.php                      26-Sep-2022 04:10                4604
function.mhash.php                                 26-Sep-2022 04:10                3415
function.microtime.php                             26-Sep-2022 04:10               10305
function.mime-content-type.php                     26-Sep-2022 04:10                4654
function.min.php                                   26-Sep-2022 04:10               13788
function.mkdir.php                                 26-Sep-2022 04:10                7899
function.mktime.php                                26-Sep-2022 04:10               21993
function.money-format.php                          26-Sep-2022 04:10               19126
function.mongodb.bson-fromjson.php                 26-Sep-2022 04:10                5850
function.mongodb.bson-fromphp.php                  26-Sep-2022 04:10                5839
function.mongodb.bson-tocanonicalextendedjson.php  26-Sep-2022 04:10               16246
function.mongodb.bson-tojson.php                   26-Sep-2022 04:10               17736
function.mongodb.bson-tophp.php                    26-Sep-2022 04:10                8760
function.mongodb.bson-torelaxedextendedjson.php    26-Sep-2022 04:10               15945
function.mongodb.driver.monitoring.addsubscribe..> 26-Sep-2022 04:10                5141
function.mongodb.driver.monitoring.removesubscr..> 26-Sep-2022 04:10                4998
function.move-uploaded-file.php                    26-Sep-2022 04:10                8903
function.mqseries-back.php                         26-Sep-2022 04:10                6463
function.mqseries-begin.php                        26-Sep-2022 04:10                7937
function.mqseries-close.php                        26-Sep-2022 04:10                6547
function.mqseries-cmit.php                         26-Sep-2022 04:10                6410
function.mqseries-conn.php                         26-Sep-2022 04:10                5935
function.mqseries-connx.php                        26-Sep-2022 04:10               14368
function.mqseries-disc.php                         26-Sep-2022 04:10                5663
function.mqseries-get.php                          26-Sep-2022 04:10               13149
function.mqseries-inq.php                          26-Sep-2022 04:10                9188
function.mqseries-open.php                         26-Sep-2022 04:10                7659
function.mqseries-put.php                          26-Sep-2022 04:10               14126
function.mqseries-put1.php                         26-Sep-2022 04:10                5920
function.mqseries-set.php                          26-Sep-2022 04:10                5657
function.mqseries-strerror.php                     26-Sep-2022 04:10                4308
function.msg-get-queue.php                         26-Sep-2022 04:10                4616
function.msg-queue-exists.php                      26-Sep-2022 04:10                3325
function.msg-receive.php                           26-Sep-2022 04:10                9713
function.msg-remove-queue.php                      26-Sep-2022 04:10                3790
function.msg-send.php                              26-Sep-2022 04:10                6938
function.msg-set-queue.php                         26-Sep-2022 04:10                4464
function.msg-stat-queue.php                        26-Sep-2022 04:10                5711
function.mt-getrandmax.php                         26-Sep-2022 04:10                5301
function.mt-rand.php                               26-Sep-2022 04:10                9194
function.mt-srand.php                              26-Sep-2022 04:10                6330
function.mysql-affected-rows.php                   26-Sep-2022 04:10               12545
function.mysql-client-encoding.php                 26-Sep-2022 04:10                6191
function.mysql-close.php                           26-Sep-2022 04:10                7319
function.mysql-connect.php                         26-Sep-2022 04:10               18215
function.mysql-create-db.php                       26-Sep-2022 04:10                8545
function.mysql-data-seek.php                       26-Sep-2022 04:10               12459
function.mysql-db-name.php                         26-Sep-2022 04:10                8532
function.mysql-db-query.php                        26-Sep-2022 04:10               10370
function.mysql-drop-db.php                         26-Sep-2022 04:10                7833
function.mysql-errno.php                           26-Sep-2022 04:10                8346
function.mysql-error.php                           26-Sep-2022 04:10                8312
function.mysql-escape-string.php                   26-Sep-2022 04:10                7638
function.mysql-fetch-array.php                     26-Sep-2022 04:10               15762
function.mysql-fetch-assoc.php                     26-Sep-2022 04:10               12420
function.mysql-fetch-field.php                     26-Sep-2022 04:10               13838
function.mysql-fetch-lengths.php                   26-Sep-2022 04:10                7576
function.mysql-fetch-object.php                    26-Sep-2022 04:10               11769
function.mysql-fetch-row.php                       26-Sep-2022 04:10                7731
function.mysql-field-flags.php                     26-Sep-2022 04:10                8441
function.mysql-field-len.php                       26-Sep-2022 04:10                6990
function.mysql-field-name.php                      26-Sep-2022 04:10                9179
function.mysql-field-seek.php                      26-Sep-2022 04:10                4823
function.mysql-field-table.php                     26-Sep-2022 04:10                7825
function.mysql-field-type.php                      26-Sep-2022 04:10               12118
function.mysql-free-result.php                     26-Sep-2022 04:10                7881
function.mysql-get-client-info.php                 26-Sep-2022 04:10                4886
function.mysql-get-host-info.php                   26-Sep-2022 04:10                6732
function.mysql-get-proto-info.php                  26-Sep-2022 04:10                6459
function.mysql-get-server-info.php                 26-Sep-2022 04:10                6826
function.mysql-info.php                            26-Sep-2022 04:10                6176
function.mysql-insert-id.php                       26-Sep-2022 04:10                8299
function.mysql-list-dbs.php                        26-Sep-2022 04:10                8840
function.mysql-list-fields.php                     26-Sep-2022 04:10                8910
function.mysql-list-processes.php                  26-Sep-2022 04:10                7409
function.mysql-list-tables.php                     26-Sep-2022 04:10                9636
function.mysql-num-fields.php                      26-Sep-2022 04:10                6602
function.mysql-num-rows.php                        26-Sep-2022 04:10                8094
function.mysql-pconnect.php                        26-Sep-2022 04:10                8857
function.mysql-ping.php                            26-Sep-2022 04:10                8200
function.mysql-query.php                           26-Sep-2022 04:10               14906
function.mysql-real-escape-string.php              26-Sep-2022 04:10               16785
function.mysql-result.php                          26-Sep-2022 04:10               10106
function.mysql-select-db.php                       26-Sep-2022 04:10                7766
function.mysql-set-charset.php                     26-Sep-2022 04:10                5740
function.mysql-stat.php                            26-Sep-2022 04:10                9191
function.mysql-tablename.php                       26-Sep-2022 04:10                8675
function.mysql-thread-id.php                       26-Sep-2022 04:10                6471
function.mysql-unbuffered-query.php                26-Sep-2022 04:10                6993
function.mysql-xdevapi-expression.php              26-Sep-2022 04:10                4805
function.mysql-xdevapi-getsession.php              26-Sep-2022 04:10               13202
function.mysqli-connect.php                        26-Sep-2022 04:10                5470
function.mysqli-escape-string.php                  26-Sep-2022 04:10                1806
function.mysqli-execute.php                        26-Sep-2022 04:10                2474
function.mysqli-get-client-stats.php               26-Sep-2022 04:10                8260
function.mysqli-get-links-stats.php                26-Sep-2022 04:10                3239
function.mysqli-report.php                         26-Sep-2022 04:10                1712
function.mysqli-set-opt.php                        26-Sep-2022 04:10                1809
function.natcasesort.php                           26-Sep-2022 04:10                7092
function.natsort.php                               26-Sep-2022 04:10               10906
function.net-get-interfaces.php                    26-Sep-2022 04:10                4487
function.next.php                                  26-Sep-2022 04:10                7771
function.ngettext.php                              26-Sep-2022 04:10                5524
function.nl-langinfo.php                           26-Sep-2022 04:10               14055
function.nl2br.php                                 26-Sep-2022 04:10                7419
function.number-format.php                         26-Sep-2022 04:10                9491
function.oauth-get-sbs.php                         26-Sep-2022 04:11                2917
function.oauth-urlencode.php                       26-Sep-2022 04:11                2474
function.ob-clean.php                              26-Sep-2022 04:10                3364
function.ob-end-clean.php                          26-Sep-2022 04:10                5177
function.ob-end-flush.php                          26-Sep-2022 04:10                6051
function.ob-flush.php                              26-Sep-2022 04:10                3606
function.ob-get-clean.php                          26-Sep-2022 04:10                5048
function.ob-get-contents.php                       26-Sep-2022 04:10                4482
function.ob-get-flush.php                          26-Sep-2022 04:10                5635
function.ob-get-length.php                         26-Sep-2022 04:10                4482
function.ob-get-level.php                          26-Sep-2022 04:10                2738
function.ob-get-status.php                         26-Sep-2022 04:10                7116
function.ob-gzhandler.php                          26-Sep-2022 04:10                5827
function.ob-iconv-handler.php                      26-Sep-2022 04:10                5173
function.ob-implicit-flush.php                     26-Sep-2022 04:10                3737
function.ob-list-handlers.php                      26-Sep-2022 04:10                5875
function.ob-start.php                              26-Sep-2022 04:10               20184
function.ob-tidyhandler.php                        26-Sep-2022 04:10                4284
function.oci-bind-array-by-name.php                26-Sep-2022 04:10               14024
function.oci-bind-by-name.php                      26-Sep-2022 04:10               86508
function.oci-cancel.php                            26-Sep-2022 04:10                2487
function.oci-client-version.php                    26-Sep-2022 04:10                4059
function.oci-close.php                             26-Sep-2022 04:10               21139
function.oci-commit.php                            26-Sep-2022 04:10               11674
function.oci-connect.php                           26-Sep-2022 04:10               37999
function.oci-define-by-name.php                    26-Sep-2022 04:10               26256
function.oci-error.php                             26-Sep-2022 04:10               11424
function.oci-execute.php                           26-Sep-2022 04:10               22429
function.oci-fetch-all.php                         26-Sep-2022 04:10               27668
function.oci-fetch-array.php                       26-Sep-2022 04:10               72482
function.oci-fetch-assoc.php                       26-Sep-2022 04:10                8910
function.oci-fetch-object.php                      26-Sep-2022 04:10               20022
function.oci-fetch-row.php                         26-Sep-2022 04:10                8862
function.oci-fetch.php                             26-Sep-2022 04:10               14468
function.oci-field-is-null.php                     26-Sep-2022 04:10                8643
function.oci-field-name.php                        26-Sep-2022 04:10               11090
function.oci-field-precision.php                   26-Sep-2022 04:10                9741
function.oci-field-scale.php                       26-Sep-2022 04:10                9691
function.oci-field-size.php                        26-Sep-2022 04:10               11776
function.oci-field-type-raw.php                    26-Sep-2022 04:10                8849
function.oci-field-type.php                        26-Sep-2022 04:10               12057
function.oci-free-descriptor.php                   26-Sep-2022 04:10                3406
function.oci-free-statement.php                    26-Sep-2022 04:10                2777
function.oci-get-implicit-resultset.php            26-Sep-2022 04:10               32625
function.oci-internal-debug.php                    26-Sep-2022 04:10                3578
function.oci-lob-copy.php                          26-Sep-2022 04:10                4346
function.oci-lob-is-equal.php                      26-Sep-2022 04:10                2779
function.oci-new-collection.php                    26-Sep-2022 04:10                5281
function.oci-new-connect.php                       26-Sep-2022 04:10               16144
function.oci-new-cursor.php                        26-Sep-2022 04:10                5130
function.oci-new-descriptor.php                    26-Sep-2022 04:10               21487
function.oci-num-fields.php                        26-Sep-2022 04:10                7845
function.oci-num-rows.php                          26-Sep-2022 04:10                8501
function.oci-parse.php                             26-Sep-2022 04:10               13314
function.oci-password-change.php                   26-Sep-2022 04:10               14471
function.oci-pconnect.php                          26-Sep-2022 04:10               14621
function.oci-register-taf-callback.php             26-Sep-2022 04:10                5480
function.oci-result.php                            26-Sep-2022 04:10                9701
function.oci-rollback.php                          26-Sep-2022 04:10               15343
function.oci-server-version.php                    26-Sep-2022 04:10                5228
function.oci-set-action.php                        26-Sep-2022 04:10                8512
function.oci-set-call-timout.php                   26-Sep-2022 04:10                5969
function.oci-set-client-identifier.php             26-Sep-2022 04:10                8329
function.oci-set-client-info.php                   26-Sep-2022 04:10                8445
function.oci-set-db-operation.php                  26-Sep-2022 04:10                7976
function.oci-set-edition.php                       26-Sep-2022 04:10               10054
function.oci-set-module-name.php                   26-Sep-2022 04:10                8569
function.oci-set-prefetch-lob.php                  26-Sep-2022 04:10                9503
function.oci-set-prefetch.php                      26-Sep-2022 04:10               23540
function.oci-statement-type.php                    26-Sep-2022 04:10                7065
function.oci-unregister-taf-callback.php           26-Sep-2022 04:10                3529
function.ocibindbyname.php                         26-Sep-2022 04:10                1965
function.ocicancel.php                             26-Sep-2022 04:10                1907
function.ocicloselob.php                           26-Sep-2022 04:10                1904
function.ocicollappend.php                         26-Sep-2022 04:10                1969
function.ocicollassign.php                         26-Sep-2022 04:10                1974
function.ocicollassignelem.php                     26-Sep-2022 04:10                2019
function.ocicollgetelem.php                        26-Sep-2022 04:10                1986
function.ocicollmax.php                            26-Sep-2022 04:10                1938
function.ocicollsize.php                           26-Sep-2022 04:10                1941
function.ocicolltrim.php                           26-Sep-2022 04:10                1951
function.ocicolumnisnull.php                       26-Sep-2022 04:10                1977
function.ocicolumnname.php                         26-Sep-2022 04:10                1969
function.ocicolumnprecision.php                    26-Sep-2022 04:10                2012
function.ocicolumnscale.php                        26-Sep-2022 04:10                1976
function.ocicolumnsize.php                         26-Sep-2022 04:10                1957
function.ocicolumntype.php                         26-Sep-2022 04:10                1961
function.ocicolumntyperaw.php                      26-Sep-2022 04:10                1984
function.ocicommit.php                             26-Sep-2022 04:10                1921
function.ocidefinebyname.php                       26-Sep-2022 04:10                1967
function.ocierror.php                              26-Sep-2022 04:10                1898
function.ociexecute.php                            26-Sep-2022 04:10                1902
function.ocifetch.php                              26-Sep-2022 04:10                1892
function.ocifetchinto.php                          26-Sep-2022 04:10                2638
function.ocifetchstatement.php                     26-Sep-2022 04:10                1984
function.ocifreecollection.php                     26-Sep-2022 04:10                2001
function.ocifreecursor.php                         26-Sep-2022 04:10                1975
function.ocifreedesc.php                           26-Sep-2022 04:10                1917
function.ocifreestatement.php                      26-Sep-2022 04:10                1995
function.ociinternaldebug.php                      26-Sep-2022 04:10                2008
function.ociloadlob.php                            26-Sep-2022 04:10                1902
function.ocilogoff.php                             26-Sep-2022 04:10                1891
function.ocilogon.php                              26-Sep-2022 04:10                1906
function.ocinewcollection.php                      26-Sep-2022 04:10                1992
function.ocinewcursor.php                          26-Sep-2022 04:10                1960
function.ocinewdescriptor.php                      26-Sep-2022 04:10                1982
function.ocinlogon.php                             26-Sep-2022 04:10                1931
function.ocinumcols.php                            26-Sep-2022 04:10                1917
function.ociparse.php                              26-Sep-2022 04:10                1886
function.ociplogon.php                             26-Sep-2022 04:10                1901
function.ociresult.php                             26-Sep-2022 04:10                1899
function.ocirollback.php                           26-Sep-2022 04:10                1921
function.ocirowcount.php                           26-Sep-2022 04:10                1924
function.ocisavelob.php                            26-Sep-2022 04:10                1902
function.ocisavelobfile.php                        26-Sep-2022 04:10                1940
function.ociserverversion.php                      26-Sep-2022 04:10                1996
function.ocisetprefetch.php                        26-Sep-2022 04:10                1982
function.ocistatementtype.php                      26-Sep-2022 04:10                2002
function.ociwritelobtofile.php                     26-Sep-2022 04:10                1981
function.ociwritetemporarylob.php                  26-Sep-2022 04:10                2004
function.octdec.php                                26-Sep-2022 04:10                4972
function.odbc-autocommit.php                       26-Sep-2022 04:10                4293
function.odbc-binmode.php                          26-Sep-2022 04:10                6256
function.odbc-close-all.php                        26-Sep-2022 04:10                2567
function.odbc-close.php                            26-Sep-2022 04:10                2836
function.odbc-columnprivileges.php                 26-Sep-2022 04:10                5186
function.odbc-columns.php                          26-Sep-2022 04:10                5748
function.odbc-commit.php                           26-Sep-2022 04:10                2539
function.odbc-connect.php                          26-Sep-2022 04:10                8767
function.odbc-cursor.php                           26-Sep-2022 04:10                2357
function.odbc-data-source.php                      26-Sep-2022 04:10                3239
function.odbc-do.php                               26-Sep-2022 04:10                1648
function.odbc-error.php                            26-Sep-2022 04:10                3512
function.odbc-errormsg.php                         26-Sep-2022 04:10                3550
function.odbc-exec.php                             26-Sep-2022 04:10                3717
function.odbc-execute.php                          26-Sep-2022 04:10                7032
function.odbc-fetch-array.php                      26-Sep-2022 04:10                4058
function.odbc-fetch-into.php                       26-Sep-2022 04:10                4806
function.odbc-fetch-object.php                     26-Sep-2022 04:10                4059
function.odbc-fetch-row.php                        26-Sep-2022 04:10                4055
function.odbc-field-len.php                        26-Sep-2022 04:10                3216
function.odbc-field-name.php                       26-Sep-2022 04:10                2812
function.odbc-field-num.php                        26-Sep-2022 04:10                2832
function.odbc-field-precision.php                  26-Sep-2022 04:10                2208
function.odbc-field-scale.php                      26-Sep-2022 04:10                2835
function.odbc-field-type.php                       26-Sep-2022 04:10                2801
function.odbc-foreignkeys.php                      26-Sep-2022 04:10                6817
function.odbc-free-result.php                      26-Sep-2022 04:10                3264
function.odbc-gettypeinfo.php                      26-Sep-2022 04:10                4359
function.odbc-longreadlen.php                      26-Sep-2022 04:10                3299
function.odbc-next-result.php                      26-Sep-2022 04:10                9071
function.odbc-num-fields.php                       26-Sep-2022 04:10                2524
function.odbc-num-rows.php                         26-Sep-2022 04:10                3203
function.odbc-pconnect.php                         26-Sep-2022 04:10                4348
function.odbc-prepare.php                          26-Sep-2022 04:10                6337
function.odbc-primarykeys.php                      26-Sep-2022 04:10                4027
function.odbc-procedurecolumns.php                 26-Sep-2022 04:10                5950
function.odbc-procedures.php                       26-Sep-2022 04:10                4863
function.odbc-result-all.php                       26-Sep-2022 04:10                2927
function.odbc-result.php                           26-Sep-2022 04:10                5554
function.odbc-rollback.php                         26-Sep-2022 04:10                2556
function.odbc-setoption.php                        26-Sep-2022 04:10                7297
function.odbc-specialcolumns.php                   26-Sep-2022 04:10                5863
function.odbc-statistics.php                       26-Sep-2022 04:10                5230
function.odbc-tableprivileges.php                  26-Sep-2022 04:10                4581
function.odbc-tables.php                           26-Sep-2022 04:10                7540
function.opcache-compile-file.php                  26-Sep-2022 04:10                3598
function.opcache-get-configuration.php             26-Sep-2022 04:10                3012
function.opcache-get-status.php                    26-Sep-2022 04:10                3533
function.opcache-invalidate.php                    26-Sep-2022 04:10                3910
function.opcache-is-script-cached.php              26-Sep-2022 04:10                3164
function.opcache-reset.php                         26-Sep-2022 04:10                2814
function.openal-buffer-create.php                  26-Sep-2022 04:10                2591
function.openal-buffer-data.php                    26-Sep-2022 04:10                4418
function.openal-buffer-destroy.php                 26-Sep-2022 04:10                2981
function.openal-buffer-get.php                     26-Sep-2022 04:10                3444
function.openal-buffer-loadwav.php                 26-Sep-2022 04:10                3527
function.openal-context-create.php                 26-Sep-2022 04:10                3243
function.openal-context-current.php                26-Sep-2022 04:10                3048
function.openal-context-destroy.php                26-Sep-2022 04:10                3031
function.openal-context-process.php                26-Sep-2022 04:10                3459
function.openal-context-suspend.php                26-Sep-2022 04:10                3453
function.openal-device-close.php                   26-Sep-2022 04:10                2998
function.openal-device-open.php                    26-Sep-2022 04:10                3268
function.openal-listener-get.php                   26-Sep-2022 04:10                3173
function.openal-listener-set.php                   26-Sep-2022 04:10                3480
function.openal-source-create.php                  26-Sep-2022 04:10                2827
function.openal-source-destroy.php                 26-Sep-2022 04:10                2997
function.openal-source-get.php                     26-Sep-2022 04:10                4694
function.openal-source-pause.php                   26-Sep-2022 04:10                3358
function.openal-source-play.php                    26-Sep-2022 04:10                3351
function.openal-source-rewind.php                  26-Sep-2022 04:10                3367
function.openal-source-set.php                     26-Sep-2022 04:10                5249
function.openal-source-stop.php                    26-Sep-2022 04:10                3333
function.openal-stream.php                         26-Sep-2022 04:10                3847
function.opendir.php                               26-Sep-2022 04:10                8501
function.openlog.php                               26-Sep-2022 04:10                8390
function.openssl-cipher-iv-length.php              26-Sep-2022 04:10                4266
function.openssl-cms-decrypt.php                   26-Sep-2022 04:10                4475
function.openssl-cms-encrypt.php                   26-Sep-2022 04:10                5546
function.openssl-cms-read.php                      26-Sep-2022 04:10                2987
function.openssl-cms-sign.php                      26-Sep-2022 04:10                7147
function.openssl-cms-verify.php                    26-Sep-2022 04:10                6099
function.openssl-csr-export-to-file.php            26-Sep-2022 04:10                4466
function.openssl-csr-export.php                    26-Sep-2022 04:10                4380
function.openssl-csr-get-public-key.php            26-Sep-2022 04:10                2328
function.openssl-csr-get-subject.php               26-Sep-2022 04:10                2293
function.openssl-csr-new.php                       26-Sep-2022 04:10               16061
function.openssl-csr-sign.php                      26-Sep-2022 04:10               10457
function.openssl-decrypt.php                       26-Sep-2022 04:10                5641
function.openssl-dh-compute-key.php                26-Sep-2022 04:10                2938
function.openssl-digest.php                        26-Sep-2022 04:10                4234
function.openssl-encrypt.php                       26-Sep-2022 04:10                5847
function.openssl-error-string.php                  26-Sep-2022 04:10                3519
function.openssl-free-key.php                      26-Sep-2022 04:10                2587
function.openssl-get-cert-locations.php            26-Sep-2022 04:10                3989
function.openssl-get-cipher-methods.php            26-Sep-2022 04:10                8526
function.openssl-get-curve-names.php               26-Sep-2022 04:10                6992
function.openssl-get-md-methods.php                26-Sep-2022 04:10                6918
function.openssl-get-privatekey.php                26-Sep-2022 04:10                1876
function.openssl-get-publickey.php                 26-Sep-2022 04:10                1848
function.openssl-open.php                          26-Sep-2022 04:10                8043
function.openssl-pbkdf2.php                        26-Sep-2022 04:10                3686
function.openssl-pkcs12-export-to-file.php         26-Sep-2022 04:10                4337
function.openssl-pkcs12-export.php                 26-Sep-2022 04:10                4307
function.openssl-pkcs12-read.php                   26-Sep-2022 04:10                5534
function.openssl-pkcs7-decrypt.php                 26-Sep-2022 04:10                6263
function.openssl-pkcs7-encrypt.php                 26-Sep-2022 04:10                9468
function.openssl-pkcs7-read.php                    26-Sep-2022 04:10                6913
function.openssl-pkcs7-sign.php                    26-Sep-2022 04:10                9503
function.openssl-pkcs7-verify.php                  26-Sep-2022 04:10                6483
function.openssl-pkey-derive.php                   26-Sep-2022 04:10                7743
function.openssl-pkey-export-to-file.php           26-Sep-2022 04:10                4713
function.openssl-pkey-export.php                   26-Sep-2022 04:10                4579
function.openssl-pkey-free.php                     26-Sep-2022 04:10                2573
function.openssl-pkey-get-details.php              26-Sep-2022 04:10                6934
function.openssl-pkey-get-private.php              26-Sep-2022 04:10                3789
function.openssl-pkey-get-public.php               26-Sep-2022 04:10                3477
function.openssl-pkey-new.php                      26-Sep-2022 04:10                3536
function.openssl-private-decrypt.php               26-Sep-2022 04:10                5059
function.openssl-private-encrypt.php               26-Sep-2022 04:10                4887
function.openssl-public-decrypt.php                26-Sep-2022 04:10                4949
function.openssl-public-encrypt.php                26-Sep-2022 04:10                5176
function.openssl-random-pseudo-bytes.php           26-Sep-2022 04:10                8356
function.openssl-seal.php                          26-Sep-2022 04:10                9979
function.openssl-sign.php                          26-Sep-2022 04:10               11389
function.openssl-spki-export-challenge.php         26-Sep-2022 04:10                7437
function.openssl-spki-export.php                   26-Sep-2022 04:10                8271
function.openssl-spki-new.php                      26-Sep-2022 04:10                8978
function.openssl-spki-verify.php                   26-Sep-2022 04:10                7919
function.openssl-verify.php                        26-Sep-2022 04:10               12700
function.openssl-x509-check-private-key.php        26-Sep-2022 04:10                3277
function.openssl-x509-checkpurpose.php             26-Sep-2022 04:10                6059
function.openssl-x509-export-to-file.php           26-Sep-2022 04:10                3842
function.openssl-x509-export.php                   26-Sep-2022 04:10                3784
function.openssl-x509-fingerprint.php              26-Sep-2022 04:10                4861
function.openssl-x509-free.php                     26-Sep-2022 04:10                2569
function.openssl-x509-parse.php                    26-Sep-2022 04:10                3514
function.openssl-x509-read.php                     26-Sep-2022 04:10                2787
function.openssl-x509-verify.php                   26-Sep-2022 04:10               12673
function.ord.php                                   26-Sep-2022 04:10                7370
function.output-add-rewrite-var.php                26-Sep-2022 04:10                6789
function.output-reset-rewrite-vars.php             26-Sep-2022 04:10                6439
function.pack.php                                  26-Sep-2022 04:10               12195
function.parse-ini-file.php                        26-Sep-2022 04:10               15629
function.parse-ini-string.php                      26-Sep-2022 04:10                6568
function.parse-str.php                             26-Sep-2022 04:10                7867
function.parse-url.php                             26-Sep-2022 04:10               14672
function.passthru.php                              26-Sep-2022 04:10                5661
function.password-algos.php                        26-Sep-2022 04:10                3210
function.password-get-info.php                     26-Sep-2022 04:10                3459
function.password-hash.php                         26-Sep-2022 04:10               20285
function.password-needs-rehash.php                 26-Sep-2022 04:10                7187
function.password-verify.php                       26-Sep-2022 04:10                6372
function.pathinfo.php                              26-Sep-2022 04:10               12236
function.pclose.php                                26-Sep-2022 04:10                4850
function.pcntl-alarm.php                           26-Sep-2022 04:10                2789
function.pcntl-async-signals.php                   26-Sep-2022 04:10                3909
function.pcntl-errno.php                           26-Sep-2022 04:10                1736
function.pcntl-exec.php                            26-Sep-2022 04:10                3528
function.pcntl-fork.php                            26-Sep-2022 04:10                5247
function.pcntl-get-last-error.php                  26-Sep-2022 04:10                2736
function.pcntl-getpriority.php                     26-Sep-2022 04:10                5063
function.pcntl-rfork.php                           26-Sep-2022 04:10                7548
function.pcntl-setpriority.php                     26-Sep-2022 04:10                4960
function.pcntl-signal-dispatch.php                 26-Sep-2022 04:10                5643
function.pcntl-signal-get-handler.php              26-Sep-2022 04:10                6695
function.pcntl-signal.php                          26-Sep-2022 04:10               11889
function.pcntl-sigprocmask.php                     26-Sep-2022 04:10                5684
function.pcntl-sigtimedwait.php                    26-Sep-2022 04:10                4830
function.pcntl-sigwaitinfo.php                     26-Sep-2022 04:10                7249
function.pcntl-strerror.php                        26-Sep-2022 04:10                2886
function.pcntl-unshare.php                         26-Sep-2022 04:10                4245
function.pcntl-wait.php                            26-Sep-2022 04:10                7873
function.pcntl-waitpid.php                         26-Sep-2022 04:10                9200
function.pcntl-wexitstatus.php                     26-Sep-2022 04:10                3557
function.pcntl-wifexited.php                       26-Sep-2022 04:10                3304
function.pcntl-wifsignaled.php                     26-Sep-2022 04:10                3356
function.pcntl-wifstopped.php                      26-Sep-2022 04:10                3357
function.pcntl-wstopsig.php                        26-Sep-2022 04:10                3562
function.pcntl-wtermsig.php                        26-Sep-2022 04:10                3752
function.pfsockopen.php                            26-Sep-2022 04:10                3633
function.pg-affected-rows.php                      26-Sep-2022 04:10                6255
function.pg-cancel-query.php                       26-Sep-2022 04:10                7021
function.pg-client-encoding.php                    26-Sep-2022 04:10                5862
function.pg-close.php                              26-Sep-2022 04:10                5304
function.pg-connect-poll.php                       26-Sep-2022 04:10                2905
function.pg-connect.php                            26-Sep-2022 04:10               11430
function.pg-connection-busy.php                    26-Sep-2022 04:10                5154
function.pg-connection-reset.php                   26-Sep-2022 04:10                5152
function.pg-connection-status.php                  26-Sep-2022 04:10                4935
function.pg-consume-input.php                      26-Sep-2022 04:10                3398
function.pg-convert.php                            26-Sep-2022 04:10                7913
function.pg-copy-from.php                          26-Sep-2022 04:10                7259
function.pg-copy-to.php                            26-Sep-2022 04:10                6459
function.pg-dbname.php                             26-Sep-2022 04:10                4117
function.pg-delete.php                             26-Sep-2022 04:10                8353
function.pg-end-copy.php                           26-Sep-2022 04:10                6223
function.pg-escape-bytea.php                       26-Sep-2022 04:10                7834
function.pg-escape-identifier.php                  26-Sep-2022 04:10                7783
function.pg-escape-literal.php                     26-Sep-2022 04:10                8288
function.pg-escape-string.php                      26-Sep-2022 04:10                7743
function.pg-execute.php                            26-Sep-2022 04:10                9383
function.pg-fetch-all-columns.php                  26-Sep-2022 04:10                7037
function.pg-fetch-all.php                          26-Sep-2022 04:10                7411
function.pg-fetch-array.php                        26-Sep-2022 04:10               12256
function.pg-fetch-assoc.php                        26-Sep-2022 04:10                9068
function.pg-fetch-object.php                       26-Sep-2022 04:10               10701
function.pg-fetch-result.php                       26-Sep-2022 04:10                8656
function.pg-fetch-row.php                          26-Sep-2022 04:10                9195
function.pg-field-is-null.php                      26-Sep-2022 04:10                8347
function.pg-field-name.php                         26-Sep-2022 04:10                9338
function.pg-field-num.php                          26-Sep-2022 04:10                6567
function.pg-field-prtlen.php                       26-Sep-2022 04:10               10713
function.pg-field-size.php                         26-Sep-2022 04:10                9602
function.pg-field-table.php                        26-Sep-2022 04:10                8334
function.pg-field-type-oid.php                     26-Sep-2022 04:10                7485
function.pg-field-type.php                         26-Sep-2022 04:10                6699
function.pg-flush.php                              26-Sep-2022 04:10                3398
function.pg-free-result.php                        26-Sep-2022 04:10                7312
function.pg-get-notify.php                         26-Sep-2022 04:10                7049
function.pg-get-pid.php                            26-Sep-2022 04:10                4444
function.pg-get-result.php                         26-Sep-2022 04:10                8836
function.pg-host.php                               26-Sep-2022 04:10                5211
function.pg-insert.php                             26-Sep-2022 04:10                9369
function.pg-last-error.php                         26-Sep-2022 04:10                6324
function.pg-last-notice.php                        26-Sep-2022 04:10                7469
function.pg-last-oid.php                           26-Sep-2022 04:10                7492
function.pg-lo-close.php                           26-Sep-2022 04:10                7227
function.pg-lo-create.php                          26-Sep-2022 04:10                8743
function.pg-lo-export.php                          26-Sep-2022 04:10                8116
function.pg-lo-import.php                          26-Sep-2022 04:10                7423
function.pg-lo-open.php                            26-Sep-2022 04:10                8956
function.pg-lo-read-all.php                        26-Sep-2022 04:10                6473
function.pg-lo-read.php                            26-Sep-2022 04:10                7007
function.pg-lo-seek.php                            26-Sep-2022 04:10                7714
function.pg-lo-tell.php                            26-Sep-2022 04:10                7113
function.pg-lo-truncate.php                        26-Sep-2022 04:10                6604
function.pg-lo-unlink.php                          26-Sep-2022 04:10                7042
function.pg-lo-write.php                           26-Sep-2022 04:10                8091
function.pg-meta-data.php                          26-Sep-2022 04:10                7306
function.pg-num-fields.php                         26-Sep-2022 04:10                5949
function.pg-num-rows.php                           26-Sep-2022 04:10                5917
function.pg-options.php                            26-Sep-2022 04:10                4475
function.pg-parameter-status.php                   26-Sep-2022 04:10                8229
function.pg-pconnect.php                           26-Sep-2022 04:10                9127
function.pg-ping.php                               26-Sep-2022 04:10                4888
function.pg-port.php                               26-Sep-2022 04:10                4673
function.pg-prepare.php                            26-Sep-2022 04:10                9309
function.pg-put-line.php                           26-Sep-2022 04:10                8668
function.pg-query-params.php                       26-Sep-2022 04:10               10768
function.pg-query.php                              26-Sep-2022 04:10               11428
function.pg-result-error-field.php                 26-Sep-2022 04:10                8656
function.pg-result-error.php                       26-Sep-2022 04:10                8133
function.pg-result-seek.php                        26-Sep-2022 04:10                7293
function.pg-result-status.php                      26-Sep-2022 04:10                7813
function.pg-select.php                             26-Sep-2022 04:10                9589
function.pg-send-execute.php                       26-Sep-2022 04:10               10774
function.pg-send-prepare.php                       26-Sep-2022 04:10               10813
function.pg-send-query-params.php                  26-Sep-2022 04:10                8055
function.pg-send-query.php                         26-Sep-2022 04:10                9941
function.pg-set-client-encoding.php                26-Sep-2022 04:10                9026
function.pg-set-error-verbosity.php                26-Sep-2022 04:10                8479
function.pg-socket.php                             26-Sep-2022 04:10                2817
function.pg-trace.php                              26-Sep-2022 04:10                8110
function.pg-transaction-status.php                 26-Sep-2022 04:10                5789
function.pg-tty.php                                26-Sep-2022 04:10                5018
function.pg-unescape-bytea.php                     26-Sep-2022 04:10                6378
function.pg-untrace.php                            26-Sep-2022 04:10                5412
function.pg-update.php                             26-Sep-2022 04:10                9283
function.pg-version.php                            26-Sep-2022 04:10                5587
function.php-ini-loaded-file.php                   26-Sep-2022 04:10                4604
function.php-ini-scanned-files.php                 26-Sep-2022 04:10                6413
function.php-sapi-name.php                         26-Sep-2022 04:10                6144
function.php-strip-whitespace.php                  26-Sep-2022 04:10                5281
function.php-uname.php                             26-Sep-2022 04:10                9594
function.phpcredits.php                            26-Sep-2022 04:10                8127
function.phpdbg-break-file.php                     26-Sep-2022 04:10                3647
function.phpdbg-break-function.php                 26-Sep-2022 04:10                3437
function.phpdbg-break-method.php                   26-Sep-2022 04:10                3715
function.phpdbg-break-next.php                     26-Sep-2022 04:10                3132
function.phpdbg-clear.php                          26-Sep-2022 04:10                3423
function.phpdbg-color.php                          26-Sep-2022 04:10                3538
function.phpdbg-end-oplog.php                      26-Sep-2022 04:10                2464
function.phpdbg-exec.php                           26-Sep-2022 04:10                2787
function.phpdbg-get-executable.php                 26-Sep-2022 04:10                2463
function.phpdbg-prompt.php                         26-Sep-2022 04:10                2735
function.phpdbg-start-oplog.php                    26-Sep-2022 04:10                2254
function.phpinfo.php                               26-Sep-2022 04:10               10711
function.phpversion.php                            26-Sep-2022 04:10               10562
function.pi.php                                    26-Sep-2022 04:10                3079
function.png2wbmp.php                              26-Sep-2022 04:10                5931
function.popen.php                                 26-Sep-2022 04:10                7773
function.pos.php                                   26-Sep-2022 04:10                1584
function.posix-access.php                          26-Sep-2022 04:10                6301
function.posix-ctermid.php                         26-Sep-2022 04:10                4079
function.posix-errno.php                           26-Sep-2022 04:10                1752
function.posix-get-last-error.php                  26-Sep-2022 04:10                4072
function.posix-getcwd.php                          26-Sep-2022 04:10                3936
function.posix-getegid.php                         26-Sep-2022 04:10                5180
function.posix-geteuid.php                         26-Sep-2022 04:10                5130
function.posix-getgid.php                          26-Sep-2022 04:10                4613
function.posix-getgrgid.php                        26-Sep-2022 04:10                6199
function.posix-getgrnam.php                        26-Sep-2022 04:10                6024
function.posix-getgroups.php                       26-Sep-2022 04:10                3737
function.posix-getlogin.php                        26-Sep-2022 04:10                3252
function.posix-getpgid.php                         26-Sep-2022 04:10                4404
function.posix-getpgrp.php                         26-Sep-2022 04:10                2324
function.posix-getpid.php                          26-Sep-2022 04:10                3114
function.posix-getppid.php                         26-Sep-2022 04:10                2726
function.posix-getpwnam.php                        26-Sep-2022 04:10                6749
function.posix-getpwuid.php                        26-Sep-2022 04:10                6728
function.posix-getrlimit.php                       26-Sep-2022 04:10                6865
function.posix-getsid.php                          26-Sep-2022 04:10                4473
function.posix-getuid.php                          26-Sep-2022 04:10                3179
function.posix-initgroups.php                      26-Sep-2022 04:10                3093
function.posix-isatty.php                          26-Sep-2022 04:10                3441
function.posix-kill.php                            26-Sep-2022 04:10                3217
function.posix-mkfifo.php                          26-Sep-2022 04:10                3367
function.posix-mknod.php                           26-Sep-2022 04:10                7180
function.posix-setegid.php                         26-Sep-2022 04:10                5133
function.posix-seteuid.php                         26-Sep-2022 04:10                2969
function.posix-setgid.php                          26-Sep-2022 04:10                5363
function.posix-setpgid.php                         26-Sep-2022 04:10                3144
function.posix-setrlimit.php                       26-Sep-2022 04:10                4271
function.posix-setsid.php                          26-Sep-2022 04:10                2308
function.posix-setuid.php                          26-Sep-2022 04:10                5422
function.posix-strerror.php                        26-Sep-2022 04:10                4748
function.posix-times.php                           26-Sep-2022 04:10                4250
function.posix-ttyname.php                         26-Sep-2022 04:10                3092
function.posix-uname.php                           26-Sep-2022 04:10                4395
function.pow.php                                   26-Sep-2022 04:10                7053
function.preg-filter.php                           26-Sep-2022 04:10                9112
function.preg-grep.php                             26-Sep-2022 04:10                5565
function.preg-last-error-msg.php                   26-Sep-2022 04:10                4089
function.preg-last-error.php                       26-Sep-2022 04:10                4308
function.preg-match-all.php                        26-Sep-2022 04:10               26519
function.preg-match.php                            26-Sep-2022 04:10               21800
function.preg-quote.php                            26-Sep-2022 04:10                8806
function.preg-replace-callback-array.php           26-Sep-2022 04:10                9025
function.preg-replace-callback.php                 26-Sep-2022 04:10               17406
function.preg-replace.php                          26-Sep-2022 04:10               21783
function.preg-split.php                            26-Sep-2022 04:10               12666
function.prev.php                                  26-Sep-2022 04:10                7688
function.print-r.php                               26-Sep-2022 04:11                9044
function.print.php                                 26-Sep-2022 04:10                8077
function.printf.php                                26-Sep-2022 04:10                4419
function.proc-close.php                            26-Sep-2022 04:10                3503
function.proc-get-status.php                       26-Sep-2022 04:10                5889
function.proc-nice.php                             26-Sep-2022 04:10                3824
function.proc-open.php                             26-Sep-2022 04:10               16448
function.proc-terminate.php                        26-Sep-2022 04:10                5147
function.property-exists.php                       26-Sep-2022 04:10                9172
function.ps-add-bookmark.php                       26-Sep-2022 04:10                5073
function.ps-add-launchlink.php                     26-Sep-2022 04:10                5565
function.ps-add-locallink.php                      26-Sep-2022 04:10                6301
function.ps-add-note.php                           26-Sep-2022 04:10                6987
function.ps-add-pdflink.php                        26-Sep-2022 04:10                6614
function.ps-add-weblink.php                        26-Sep-2022 04:10                5634
function.ps-arc.php                                26-Sep-2022 04:10                5035
function.ps-arcn.php                               26-Sep-2022 04:10                5035
function.ps-begin-page.php                         26-Sep-2022 04:10                7171
function.ps-begin-pattern.php                      26-Sep-2022 04:10               13336
function.ps-begin-template.php                     26-Sep-2022 04:10               11540
function.ps-circle.php                             26-Sep-2022 04:10                4590
function.ps-clip.php                               26-Sep-2022 04:10                2955
function.ps-close-image.php                        26-Sep-2022 04:10                3787
function.ps-close.php                              26-Sep-2022 04:10                3654
function.ps-closepath-stroke.php                   26-Sep-2022 04:10                3029
function.ps-closepath.php                          26-Sep-2022 04:10                3227
function.ps-continue-text.php                      26-Sep-2022 04:10                4037
function.ps-curveto.php                            26-Sep-2022 04:10                4763
function.ps-delete.php                             26-Sep-2022 04:10                3539
function.ps-end-page.php                           26-Sep-2022 04:10                3257
function.ps-end-pattern.php                        26-Sep-2022 04:10                3156
function.ps-end-template.php                       26-Sep-2022 04:10                3158
function.ps-fill-stroke.php                        26-Sep-2022 04:10                3248
function.ps-fill.php                               26-Sep-2022 04:10                3185
function.ps-findfont.php                           26-Sep-2022 04:10                7271
function.ps-get-buffer.php                         26-Sep-2022 04:10                3268
function.ps-get-parameter.php                      26-Sep-2022 04:10                7902
function.ps-get-value.php                          26-Sep-2022 04:10                9520
function.ps-hyphenate.php                          26-Sep-2022 04:10                7390
function.ps-include-file.php                       26-Sep-2022 04:10                2981
function.ps-lineto.php                             26-Sep-2022 04:10                8290
function.ps-makespotcolor.php                      26-Sep-2022 04:10               10488
function.ps-moveto.php                             26-Sep-2022 04:10                3700
function.ps-new.php                                26-Sep-2022 04:10                2686
function.ps-open-file.php                          26-Sep-2022 04:10                3562
function.ps-open-image-file.php                    26-Sep-2022 04:10                4814
function.ps-open-image.php                         26-Sep-2022 04:10                6675
function.ps-open-memory-image.php                  26-Sep-2022 04:10                2767
function.ps-place-image.php                        26-Sep-2022 04:10                5056
function.ps-rect.php                               26-Sep-2022 04:10                4796
function.ps-restore.php                            26-Sep-2022 04:10                3378
function.ps-rotate.php                             26-Sep-2022 04:10               12557
function.ps-save.php                               26-Sep-2022 04:10                3075
function.ps-scale.php                              26-Sep-2022 04:10                3634
function.ps-set-border-color.php                   26-Sep-2022 04:10                4705
function.ps-set-border-dash.php                    26-Sep-2022 04:10                4355
function.ps-set-border-style.php                   26-Sep-2022 04:10                4400
function.ps-set-info.php                           26-Sep-2022 04:10                6130
function.ps-set-parameter.php                      26-Sep-2022 04:10                3799
function.ps-set-text-pos.php                       26-Sep-2022 04:10                9555
function.ps-set-value.php                          26-Sep-2022 04:10                4676
function.ps-setcolor.php                           26-Sep-2022 04:10                5553
function.ps-setdash.php                            26-Sep-2022 04:10                3488
function.ps-setflat.php                            26-Sep-2022 04:10                2981
function.ps-setfont.php                            26-Sep-2022 04:10                3971
function.ps-setgray.php                            26-Sep-2022 04:10                3198
function.ps-setlinecap.php                         26-Sep-2022 04:10                3842
function.ps-setlinejoin.php                        26-Sep-2022 04:10                3834
function.ps-setlinewidth.php                       26-Sep-2022 04:10                3718
function.ps-setmiterlimit.php                      26-Sep-2022 04:10                4204
function.ps-setoverprintmode.php                   26-Sep-2022 04:10                3014
function.ps-setpolydash.php                        26-Sep-2022 04:10                7917
function.ps-shading-pattern.php                    26-Sep-2022 04:10                4048
function.ps-shading.php                            26-Sep-2022 04:10                6587
function.ps-shfill.php                             26-Sep-2022 04:10                3894
function.ps-show-boxed.php                         26-Sep-2022 04:10               12273
function.ps-show-xy.php                            26-Sep-2022 04:10                4048
function.ps-show-xy2.php                           26-Sep-2022 04:10                2760
function.ps-show.php                               26-Sep-2022 04:10                5818
function.ps-show2.php                              26-Sep-2022 04:10                3080
function.ps-string-geometry.php                    26-Sep-2022 04:10                4803
function.ps-stringwidth.php                        26-Sep-2022 04:10                4250
function.ps-stroke.php                             26-Sep-2022 04:10                3408
function.ps-symbol-name.php                        26-Sep-2022 04:10                3826
function.ps-symbol-width.php                       26-Sep-2022 04:10                4327
function.ps-symbol.php                             26-Sep-2022 04:10                3644
function.ps-translate.php                          26-Sep-2022 04:10               14582
function.pspell-add-to-personal.php                26-Sep-2022 04:10                5478
function.pspell-add-to-session.php                 26-Sep-2022 04:10                3036
function.pspell-check.php                          26-Sep-2022 04:10                4135
function.pspell-clear-session.php                  26-Sep-2022 04:10                4939
function.pspell-config-create.php                  26-Sep-2022 04:10                7309
function.pspell-config-data-dir.php                26-Sep-2022 04:10                2491
function.pspell-config-dict-dir.php                26-Sep-2022 04:10                2481
function.pspell-config-ignore.php                  26-Sep-2022 04:10                4797
function.pspell-config-mode.php                    26-Sep-2022 04:10                5462
function.pspell-config-personal.php                26-Sep-2022 04:10                5603
function.pspell-config-repl.php                    26-Sep-2022 04:10                5962
function.pspell-config-runtogether.php             26-Sep-2022 04:10                5353
function.pspell-config-save-repl.php               26-Sep-2022 04:10                4241
function.pspell-new-config.php                     26-Sep-2022 04:10                5024
function.pspell-new-personal.php                   26-Sep-2022 04:10                9562
function.pspell-new.php                            26-Sep-2022 04:10                8120
function.pspell-save-wordlist.php                  26-Sep-2022 04:10                5300
function.pspell-store-replacement.php              26-Sep-2022 04:10                6914
function.pspell-suggest.php                        26-Sep-2022 04:10                4678
function.putenv.php                                26-Sep-2022 04:10                3887
function.quoted-printable-decode.php               26-Sep-2022 04:10                3500
function.quoted-printable-encode.php               26-Sep-2022 04:10                3454
function.quotemeta.php                             26-Sep-2022 04:10                4731
function.rad2deg.php                               26-Sep-2022 04:10                3537
function.radius-acct-open.php                      26-Sep-2022 04:10                3033
function.radius-add-server.php                     26-Sep-2022 04:10                7387
function.radius-auth-open.php                      26-Sep-2022 04:10                3045
function.radius-close.php                          26-Sep-2022 04:10                2161
function.radius-config.php                         26-Sep-2022 04:10                3811
function.radius-create-request.php                 26-Sep-2022 04:10                4991
function.radius-cvt-addr.php                       26-Sep-2022 04:10                6743
function.radius-cvt-int.php                        26-Sep-2022 04:10                5980
function.radius-cvt-string.php                     26-Sep-2022 04:10                6037
function.radius-demangle-mppe-key.php              26-Sep-2022 04:10                2990
function.radius-demangle.php                       26-Sep-2022 04:10                2721
function.radius-get-attr.php                       26-Sep-2022 04:10                6772
function.radius-get-tagged-attr-data.php           26-Sep-2022 04:10                6741
function.radius-get-tagged-attr-tag.php            26-Sep-2022 04:10                6796
function.radius-get-vendor-attr.php                26-Sep-2022 04:10                8835
function.radius-put-addr.php                       26-Sep-2022 04:10                5003
function.radius-put-attr.php                       26-Sep-2022 04:10                8431
function.radius-put-int.php                        26-Sep-2022 04:10                7100
function.radius-put-string.php                     26-Sep-2022 04:10                7488
function.radius-put-vendor-addr.php                26-Sep-2022 04:10                5019
function.radius-put-vendor-attr.php                26-Sep-2022 04:10                7276
function.radius-put-vendor-int.php                 26-Sep-2022 04:10                5698
function.radius-put-vendor-string.php              26-Sep-2022 04:10                6089
function.radius-request-authenticator.php          26-Sep-2022 04:10                2989
function.radius-salt-encrypt-attr.php              26-Sep-2022 04:10                3971
function.radius-send-request.php                   26-Sep-2022 04:10                3609
function.radius-server-secret.php                  26-Sep-2022 04:10                2505
function.radius-strerror.php                       26-Sep-2022 04:10                2214
function.rand.php                                  26-Sep-2022 04:10                8099
function.random-bytes.php                          26-Sep-2022 04:10                7100
function.random-int.php                            26-Sep-2022 04:10                7140
function.range.php                                 26-Sep-2022 04:10                7808
function.rar-wrapper-cache-stats.php               26-Sep-2022 04:10                2295
function.rawurldecode.php                          26-Sep-2022 04:10                4647
function.rawurlencode.php                          26-Sep-2022 04:10                7465
function.read-exif-data.php                        26-Sep-2022 04:10                1705
function.readdir.php                               26-Sep-2022 04:10               10222
function.readfile.php                              26-Sep-2022 04:10                9921
function.readgzfile.php                            26-Sep-2022 04:10                4297
function.readline-add-history.php                  26-Sep-2022 04:10                2574
function.readline-callback-handler-install.php     26-Sep-2022 04:10               10114
function.readline-callback-handler-remove.php      26-Sep-2022 04:10                3608
function.readline-callback-read-char.php           26-Sep-2022 04:10                3672
function.readline-clear-history.php                26-Sep-2022 04:10                2152
function.readline-completion-function.php          26-Sep-2022 04:10                2926
function.readline-info.php                         26-Sep-2022 04:10                3289
function.readline-list-history.php                 26-Sep-2022 04:10                2104
function.readline-on-new-line.php                  26-Sep-2022 04:10                2094
function.readline-read-history.php                 26-Sep-2022 04:10                2609
function.readline-redisplay.php                    26-Sep-2022 04:10                2014
function.readline-write-history.php                26-Sep-2022 04:10                2561
function.readline.php                              26-Sep-2022 04:10                4791
function.readlink.php                              26-Sep-2022 04:10                4623
function.realpath-cache-get.php                    26-Sep-2022 04:10                4082
function.realpath-cache-size.php                   26-Sep-2022 04:10                3535
function.realpath.php                              26-Sep-2022 04:10                8811
function.recode-file.php                           26-Sep-2022 04:10                5590
function.recode-string.php                         26-Sep-2022 04:10                4397
function.recode.php                                26-Sep-2022 04:10                1709
function.register-shutdown-function.php            26-Sep-2022 04:10                7787
function.register-tick-function.php                26-Sep-2022 04:10                6926
function.rename.php                                26-Sep-2022 04:10                6708
function.require-once.php                          26-Sep-2022 04:10                1780
function.require.php                               26-Sep-2022 04:10                1851
function.reset.php                                 26-Sep-2022 04:10                6550
function.restore-error-handler.php                 26-Sep-2022 04:10                5688
function.restore-exception-handler.php             26-Sep-2022 04:10                6859
function.restore-include-path.php                  26-Sep-2022 04:10                4897
function.return.php                                26-Sep-2022 04:10                3940
function.rewind.php                                26-Sep-2022 04:10                6347
function.rewinddir.php                             26-Sep-2022 04:10                2871
function.rmdir.php                                 26-Sep-2022 04:10                4890
function.round.php                                 26-Sep-2022 04:10               21748
function.rpmaddtag.php                             26-Sep-2022 04:10                3119
function.rpmdbinfo.php                             26-Sep-2022 04:10                4696
function.rpmdbsearch.php                           26-Sep-2022 04:10                5481
function.rpminfo.php                               26-Sep-2022 04:10                4880
function.rpmvercmp.php                             26-Sep-2022 04:10                2544
function.rrd-create.php                            26-Sep-2022 04:10                2779
function.rrd-error.php                             26-Sep-2022 04:10                2025
function.rrd-fetch.php                             26-Sep-2022 04:10                2855
function.rrd-first.php                             26-Sep-2022 04:10                2734
function.rrd-graph.php                             26-Sep-2022 04:10                3066
function.rrd-info.php                              26-Sep-2022 04:10                2358
function.rrd-last.php                              26-Sep-2022 04:10                2406
function.rrd-lastupdate.php                        26-Sep-2022 04:10                2524
function.rrd-restore.php                           26-Sep-2022 04:10                3047
function.rrd-tune.php                              26-Sep-2022 04:10                2846
function.rrd-update.php                            26-Sep-2022 04:10                2879
function.rrd-version.php                           26-Sep-2022 04:10                2139
function.rrd-xport.php                             26-Sep-2022 04:10                2606
function.rrdc-disconnect.php                       26-Sep-2022 04:10                2487
function.rsort.php                                 26-Sep-2022 04:10                6215
function.rtrim.php                                 26-Sep-2022 04:10                9704
function.runkit-constant-add.php                   26-Sep-2022 04:10                3861
function.runkit-constant-redefine.php              26-Sep-2022 04:10                3705
function.runkit-constant-remove.php                26-Sep-2022 04:10                3499
function.runkit-function-add.php                   26-Sep-2022 04:10                6118
function.runkit-function-copy.php                  26-Sep-2022 04:10                5406
function.runkit-function-redefine.php              26-Sep-2022 04:10                6261
function.runkit-function-remove.php                26-Sep-2022 04:10                4033
function.runkit-function-rename.php                26-Sep-2022 04:10                4274
function.runkit-import.php                         26-Sep-2022 04:10                5585
function.runkit-method-add.php                     26-Sep-2022 04:10                8407
function.runkit-method-copy.php                    26-Sep-2022 04:10                7225
function.runkit-method-redefine.php                26-Sep-2022 04:10                9121
function.runkit-method-remove.php                  26-Sep-2022 04:10                6592
function.runkit-method-rename.php                  26-Sep-2022 04:10                6617
function.runkit-superglobals.php                   26-Sep-2022 04:10                2403
function.runkit7-object-id.php                     26-Sep-2022 04:10                3610
function.runkit7-zval-inspect.php                  26-Sep-2022 04:10                5042
function.sapi-windows-cp-conv.php                  26-Sep-2022 04:10                4287
function.sapi-windows-cp-get.php                   26-Sep-2022 04:10                3318
function.sapi-windows-cp-is-utf8.php               26-Sep-2022 04:10                2653
function.sapi-windows-cp-set.php                   26-Sep-2022 04:10                2830
function.sapi-windows-generate-ctrl-event.php      26-Sep-2022 04:10                7662
function.sapi-windows-set-ctrl-handler.php         26-Sep-2022 04:10                7408
function.sapi-windows-vt100-support.php            26-Sep-2022 04:10                9894
function.scandir.php                               26-Sep-2022 04:10                8831
function.scoutapm-get-calls.php                    26-Sep-2022 04:10                4342
function.scoutapm-list-instrumented-functions.php  26-Sep-2022 04:10                3679
function.seaslog-get-author.php                    26-Sep-2022 04:10                2997
function.seaslog-get-version.php                   26-Sep-2022 04:10                2995
function.sem-acquire.php                           26-Sep-2022 04:10                4704
function.sem-get.php                               26-Sep-2022 04:10                5488
function.sem-release.php                           26-Sep-2022 04:10                3401
function.sem-remove.php                            26-Sep-2022 04:10                3390
function.serialize.php                             26-Sep-2022 04:11               10792
function.session-abort.php                         26-Sep-2022 04:10                3877
function.session-cache-expire.php                  26-Sep-2022 04:10                6916
function.session-cache-limiter.php                 26-Sep-2022 04:10                8262
function.session-commit.php                        26-Sep-2022 04:10                1796
function.session-create-id.php                     26-Sep-2022 04:10               11473
function.session-decode.php                        26-Sep-2022 04:10                3658
function.session-destroy.php                       26-Sep-2022 04:10                7202
function.session-encode.php                        26-Sep-2022 04:10                3527
function.session-gc.php                            26-Sep-2022 04:10                8365
function.session-get-cookie-params.php             26-Sep-2022 04:10                4981
function.session-id.php                            26-Sep-2022 04:10                5143
function.session-module-name.php                   26-Sep-2022 04:10                2629
function.session-name.php                          26-Sep-2022 04:10                5743
function.session-regenerate-id.php                 26-Sep-2022 04:10                6559
function.session-register-shutdown.php             26-Sep-2022 04:10                2656
function.session-reset.php                         26-Sep-2022 04:10                3321
function.session-save-path.php                     26-Sep-2022 04:10                3755
function.session-set-cookie-params.php             26-Sep-2022 04:10                7138
function.session-set-save-handler.php              26-Sep-2022 04:10               30935
function.session-start.php                         26-Sep-2022 04:10               15578
function.session-status.php                        26-Sep-2022 04:10                2891
function.session-unset.php                         26-Sep-2022 04:10                3214
function.session-write-close.php                   26-Sep-2022 04:10                3185
function.set-error-handler.php                     26-Sep-2022 04:10               27734
function.set-exception-handler.php                 26-Sep-2022 04:10                9001
function.set-file-buffer.php                       26-Sep-2022 04:10                1765
function.set-include-path.php                      26-Sep-2022 04:10                6299
function.set-time-limit.php                        26-Sep-2022 04:10                4611
function.setcookie.php                             26-Sep-2022 04:10               25832
function.setlocale.php                             26-Sep-2022 04:10               15711
function.setrawcookie.php                          26-Sep-2022 04:10                5630
function.settype.php                               26-Sep-2022 04:11                6339
function.sha1-file.php                             26-Sep-2022 04:10                6193
function.sha1.php                                  26-Sep-2022 04:10                5911
function.shell-exec.php                            26-Sep-2022 04:10                4588
function.shm-attach.php                            26-Sep-2022 04:10                8131
function.shm-detach.php                            26-Sep-2022 04:10                3679
function.shm-get-var.php                           26-Sep-2022 04:10                3647
function.shm-has-var.php                           26-Sep-2022 04:10                3444
function.shm-put-var.php                           26-Sep-2022 04:10                4573
function.shm-remove-var.php                        26-Sep-2022 04:10                3318
function.shm-remove.php                            26-Sep-2022 04:10                3092
function.shmop-close.php                           26-Sep-2022 04:10                4287
function.shmop-delete.php                          26-Sep-2022 04:10                3959
function.shmop-open.php                            26-Sep-2022 04:10                8431
function.shmop-read.php                            26-Sep-2022 04:10                5236
function.shmop-size.php                            26-Sep-2022 04:10                4150
function.shmop-write.php                           26-Sep-2022 04:10                5371
function.show-source.php                           26-Sep-2022 04:10                1710
function.shuffle.php                               26-Sep-2022 04:10                4949
function.similar-text.php                          26-Sep-2022 04:10                4043
function.simplexml-import-dom.php                  26-Sep-2022 04:11                6731
function.simplexml-load-file.php                   26-Sep-2022 04:11               10488
function.simplexml-load-string.php                 26-Sep-2022 04:11                9824
function.sin.php                                   26-Sep-2022 04:10                4669
function.sinh.php                                  26-Sep-2022 04:10                3129
function.sizeof.php                                26-Sep-2022 04:10                1601
function.sleep.php                                 26-Sep-2022 04:10                6574
function.snmp-get-quick-print.php                  26-Sep-2022 04:10                3532
function.snmp-get-valueretrieval.php               26-Sep-2022 04:10                4380
function.snmp-read-mib.php                         26-Sep-2022 04:10                4675
function.snmp-set-enum-print.php                   26-Sep-2022 04:10                4588
function.snmp-set-oid-numeric-print.php            26-Sep-2022 04:10                2301
function.snmp-set-oid-output-format.php            26-Sep-2022 04:10                6662
function.snmp-set-quick-print.php                  26-Sep-2022 04:10                6427
function.snmp-set-valueretrieval.php               26-Sep-2022 04:10                9145
function.snmp2-get.php                             26-Sep-2022 04:10                5462
function.snmp2-getnext.php                         26-Sep-2022 04:10                5845
function.snmp2-real-walk.php                       26-Sep-2022 04:10                6116
function.snmp2-set.php                             26-Sep-2022 04:10               10458
function.snmp2-walk.php                            26-Sep-2022 04:10                6623
function.snmp3-get.php                             26-Sep-2022 04:10                8316
function.snmp3-getnext.php                         26-Sep-2022 04:10                8659
function.snmp3-real-walk.php                       26-Sep-2022 04:10                9172
function.snmp3-set.php                             26-Sep-2022 04:10               13013
function.snmp3-walk.php                            26-Sep-2022 04:10                9592
function.snmpget.php                               26-Sep-2022 04:10                5456
function.snmpgetnext.php                           26-Sep-2022 04:10                5720
function.snmprealwalk.php                          26-Sep-2022 04:10                5991
function.snmpset.php                               26-Sep-2022 04:10               10489
function.snmpwalk.php                              26-Sep-2022 04:10                6649
function.snmpwalkoid.php                           26-Sep-2022 04:10                7329
function.socket-accept.php                         26-Sep-2022 04:10                5662
function.socket-addrinfo-bind.php                  26-Sep-2022 04:10                5128
function.socket-addrinfo-connect.php               26-Sep-2022 04:10                4914
function.socket-addrinfo-explain.php               26-Sep-2022 04:10                4317
function.socket-addrinfo-lookup.php                26-Sep-2022 04:10                5503
function.socket-bind.php                           26-Sep-2022 04:10               10348
function.socket-clear-error.php                    26-Sep-2022 04:10                3567
function.socket-close.php                          26-Sep-2022 04:10                3776
function.socket-cmsg-space.php                     26-Sep-2022 04:10                3465
function.socket-connect.php                        26-Sep-2022 04:10                5940
function.socket-create-listen.php                  26-Sep-2022 04:10                6115
function.socket-create-pair.php                    26-Sep-2022 04:10               20489
function.socket-create.php                         26-Sep-2022 04:10               11351
function.socket-export-stream.php                  26-Sep-2022 04:10                3295
function.socket-get-option.php                     26-Sep-2022 04:10               22719
function.socket-get-status.php                     26-Sep-2022 04:10                1781
function.socket-getopt.php                         26-Sep-2022 04:10                1769
function.socket-getpeername.php                    26-Sep-2022 04:10                6987
function.socket-getsockname.php                    26-Sep-2022 04:10                6283
function.socket-import-stream.php                  26-Sep-2022 04:10                4323
function.socket-last-error.php                     26-Sep-2022 04:10                6220
function.socket-listen.php                         26-Sep-2022 04:10                6435
function.socket-read.php                           26-Sep-2022 04:10                6866
function.socket-recv.php                           26-Sep-2022 04:10               15879
function.socket-recvfrom.php                       26-Sep-2022 04:10               12471
function.socket-recvmsg.php                        26-Sep-2022 04:10                3509
function.socket-select.php                         26-Sep-2022 04:10               15566
function.socket-send.php                           26-Sep-2022 04:10                5568
function.socket-sendmsg.php                        26-Sep-2022 04:10                3589
function.socket-sendto.php                         26-Sep-2022 04:10                8582
function.socket-set-block.php                      26-Sep-2022 04:10                5295
function.socket-set-blocking.php                   26-Sep-2022 04:10                1799
function.socket-set-nonblock.php                   26-Sep-2022 04:10                5697
function.socket-set-option.php                     26-Sep-2022 04:10               10977
function.socket-set-timeout.php                    26-Sep-2022 04:10                1768
function.socket-setopt.php                         26-Sep-2022 04:10                1763
function.socket-shutdown.php                       26-Sep-2022 04:10                4043
function.socket-strerror.php                       26-Sep-2022 04:10                7292
function.socket-write.php                          26-Sep-2022 04:10                6140
function.socket-wsaprotocol-info-export.php        26-Sep-2022 04:10                4779
function.socket-wsaprotocol-info-import.php        26-Sep-2022 04:10                4203
function.socket-wsaprotocol-info-release.php       26-Sep-2022 04:10                3401
function.sodium-add.php                            26-Sep-2022 04:10                3015
function.sodium-base642bin.php                     26-Sep-2022 04:10                4205
function.sodium-bin2base64.php                     26-Sep-2022 04:10                3851
function.sodium-bin2hex.php                        26-Sep-2022 04:10                2542
function.sodium-compare.php                        26-Sep-2022 04:10                3015
function.sodium-crypto-aead-aes256gcm-decrypt.php  26-Sep-2022 04:10                4242
function.sodium-crypto-aead-aes256gcm-encrypt.php  26-Sep-2022 04:10                4030
function.sodium-crypto-aead-aes256gcm-is-availa..> 26-Sep-2022 04:10                2637
function.sodium-crypto-aead-aes256gcm-keygen.php   26-Sep-2022 04:10                2729
function.sodium-crypto-aead-chacha20poly1305-de..> 26-Sep-2022 04:10                4158
function.sodium-crypto-aead-chacha20poly1305-en..> 26-Sep-2022 04:10                3903
function.sodium-crypto-aead-chacha20poly1305-ie..> 26-Sep-2022 04:10                4388
function.sodium-crypto-aead-chacha20poly1305-ie..> 26-Sep-2022 04:10                4069
function.sodium-crypto-aead-chacha20poly1305-ie..> 26-Sep-2022 04:10                2923
function.sodium-crypto-aead-chacha20poly1305-ke..> 26-Sep-2022 04:10                2858
function.sodium-crypto-aead-xchacha20poly1305-i..> 26-Sep-2022 04:10                4566
function.sodium-crypto-aead-xchacha20poly1305-i..> 26-Sep-2022 04:10                4287
function.sodium-crypto-aead-xchacha20poly1305-i..> 26-Sep-2022 04:10                2899
function.sodium-crypto-auth-keygen.php             26-Sep-2022 04:10                2550
function.sodium-crypto-auth-verify.php             26-Sep-2022 04:10                3517
function.sodium-crypto-auth.php                    26-Sep-2022 04:10                3142
function.sodium-crypto-box-keypair-from-secretk..> 26-Sep-2022 04:10                3221
function.sodium-crypto-box-keypair.php             26-Sep-2022 04:10                2831
function.sodium-crypto-box-open.php                26-Sep-2022 04:10                3649
function.sodium-crypto-box-publickey-from-secre..> 26-Sep-2022 04:10                3108
function.sodium-crypto-box-publickey.php           26-Sep-2022 04:10                2821
function.sodium-crypto-box-seal-open.php           26-Sep-2022 04:10                5894
function.sodium-crypto-box-seal.php                26-Sep-2022 04:10                7075
function.sodium-crypto-box-secretkey.php           26-Sep-2022 04:10                2788
function.sodium-crypto-box-seed-keypair.php        26-Sep-2022 04:10                2847
function.sodium-crypto-box.php                     26-Sep-2022 04:10                3955
function.sodium-crypto-core-ristretto255-add.php   26-Sep-2022 04:10                5951
function.sodium-crypto-core-ristretto255-from-h..> 26-Sep-2022 04:10                5382
function.sodium-crypto-core-ristretto255-is-val..> 26-Sep-2022 04:10                5456
function.sodium-crypto-core-ristretto255-random..> 26-Sep-2022 04:10                5570
function.sodium-crypto-core-ristretto255-scalar..> 26-Sep-2022 04:10                6219
function.sodium-crypto-core-ristretto255-scalar..> 26-Sep-2022 04:10                3468
function.sodium-crypto-core-ristretto255-scalar..> 26-Sep-2022 04:10                5332
function.sodium-crypto-core-ristretto255-scalar..> 26-Sep-2022 04:10                3671
function.sodium-crypto-core-ristretto255-scalar..> 26-Sep-2022 04:10                5316
function.sodium-crypto-core-ristretto255-scalar..> 26-Sep-2022 04:10                5730
function.sodium-crypto-core-ristretto255-scalar..> 26-Sep-2022 04:10                3412
function.sodium-crypto-core-ristretto255-scalar..> 26-Sep-2022 04:10                6210
function.sodium-crypto-core-ristretto255-sub.php   26-Sep-2022 04:10                5988
function.sodium-crypto-generichash-final.php       26-Sep-2022 04:10                6718
function.sodium-crypto-generichash-init.php        26-Sep-2022 04:10                6667
function.sodium-crypto-generichash-keygen.php      26-Sep-2022 04:10                2360
function.sodium-crypto-generichash-update.php      26-Sep-2022 04:10                6482
function.sodium-crypto-generichash.php             26-Sep-2022 04:10                3417
function.sodium-crypto-kdf-derive-from-key.php     26-Sep-2022 04:10                3650
function.sodium-crypto-kdf-keygen.php              26-Sep-2022 04:10                2462
function.sodium-crypto-kx-client-session-keys.php  26-Sep-2022 04:10                3176
function.sodium-crypto-kx-keypair.php              26-Sep-2022 04:10                4958
function.sodium-crypto-kx-publickey.php            26-Sep-2022 04:10                2640
function.sodium-crypto-kx-secretkey.php            26-Sep-2022 04:10                2651
function.sodium-crypto-kx-seed-keypair.php         26-Sep-2022 04:10                2613
function.sodium-crypto-kx-server-session-keys.php  26-Sep-2022 04:10                3242
function.sodium-crypto-pwhash-scryptsalsa208sha..> 26-Sep-2022 04:10                3163
function.sodium-crypto-pwhash-scryptsalsa208sha..> 26-Sep-2022 04:10                3313
function.sodium-crypto-pwhash-scryptsalsa208sha..> 26-Sep-2022 04:10                5558
function.sodium-crypto-pwhash-str-needs-rehash.php 26-Sep-2022 04:10                3660
function.sodium-crypto-pwhash-str-verify.php       26-Sep-2022 04:10                4539
function.sodium-crypto-pwhash-str.php              26-Sep-2022 04:10                7938
function.sodium-crypto-pwhash.php                  26-Sep-2022 04:10                9412
function.sodium-crypto-scalarmult-base.php         26-Sep-2022 04:10                2013
function.sodium-crypto-scalarmult-ristretto255-..> 26-Sep-2022 04:10                3381
function.sodium-crypto-scalarmult-ristretto255.php 26-Sep-2022 04:10                3674
function.sodium-crypto-scalarmult.php              26-Sep-2022 04:10                2863
function.sodium-crypto-secretbox-keygen.php        26-Sep-2022 04:10                6288
function.sodium-crypto-secretbox-open.php          26-Sep-2022 04:10                8587
function.sodium-crypto-secretbox.php               26-Sep-2022 04:10                8517
function.sodium-crypto-secretstream-xchacha20po..> 26-Sep-2022 04:10               11632
function.sodium-crypto-secretstream-xchacha20po..> 26-Sep-2022 04:10               10784
function.sodium-crypto-secretstream-xchacha20po..> 26-Sep-2022 04:10                2626
function.sodium-crypto-secretstream-xchacha20po..> 26-Sep-2022 04:10                5498
function.sodium-crypto-secretstream-xchacha20po..> 26-Sep-2022 04:10                5597
function.sodium-crypto-secretstream-xchacha20po..> 26-Sep-2022 04:10                2866
function.sodium-crypto-shorthash-keygen.php        26-Sep-2022 04:10                2634
function.sodium-crypto-shorthash.php               26-Sep-2022 04:10                2975
function.sodium-crypto-sign-detached.php           26-Sep-2022 04:10                2968
function.sodium-crypto-sign-ed25519-pk-to-curve..> 26-Sep-2022 04:10                2808
function.sodium-crypto-sign-ed25519-sk-to-curve..> 26-Sep-2022 04:10                2864
function.sodium-crypto-sign-keypair-from-secret..> 26-Sep-2022 04:10                3047
function.sodium-crypto-sign-keypair.php            26-Sep-2022 04:10                2348
function.sodium-crypto-sign-open.php               26-Sep-2022 04:10                3071
function.sodium-crypto-sign-publickey-from-secr..> 26-Sep-2022 04:10                2666
function.sodium-crypto-sign-publickey.php          26-Sep-2022 04:10                2676
function.sodium-crypto-sign-secretkey.php          26-Sep-2022 04:10                2652
function.sodium-crypto-sign-seed-keypair.php       26-Sep-2022 04:10                2885
function.sodium-crypto-sign-verify-detached.php    26-Sep-2022 04:10                3294
function.sodium-crypto-sign.php                    26-Sep-2022 04:10                3046
function.sodium-crypto-stream-keygen.php           26-Sep-2022 04:10                2531
function.sodium-crypto-stream-xchacha20-keygen.php 26-Sep-2022 04:10                2689
function.sodium-crypto-stream-xchacha20-xor-ic.php 26-Sep-2022 04:10                9447
function.sodium-crypto-stream-xchacha20-xor.php    26-Sep-2022 04:10                4455
function.sodium-crypto-stream-xchacha20.php        26-Sep-2022 04:10                3448
function.sodium-crypto-stream-xor.php              26-Sep-2022 04:10                3232
function.sodium-crypto-stream.php                  26-Sep-2022 04:10                3167
function.sodium-hex2bin.php                        26-Sep-2022 04:10                3094
function.sodium-increment.php                      26-Sep-2022 04:10                2406
function.sodium-memcmp.php                         26-Sep-2022 04:10                3202
function.sodium-memzero.php                        26-Sep-2022 04:10                2401
function.sodium-pad.php                            26-Sep-2022 04:10                2545
function.sodium-unpad.php                          26-Sep-2022 04:10                2500
function.solr-get-version.php                      26-Sep-2022 04:10                3853
function.sort.php                                  26-Sep-2022 04:10               12012
function.soundex.php                               26-Sep-2022 04:10                6760
function.spl-autoload-call.php                     26-Sep-2022 04:10                2574
function.spl-autoload-extensions.php               26-Sep-2022 04:10                3314
function.spl-autoload-functions.php                26-Sep-2022 04:10                2484
function.spl-autoload-register.php                 26-Sep-2022 04:10               10614
function.spl-autoload-unregister.php               26-Sep-2022 04:10                2973
function.spl-autoload.php                          26-Sep-2022 04:10                3812
function.spl-classes.php                           26-Sep-2022 04:10                3656
function.spl-object-hash.php                       26-Sep-2022 04:10                4022
function.spl-object-id.php                         26-Sep-2022 04:10                4025
function.sprintf.php                               26-Sep-2022 04:10               34330
function.sqlsrv-begin-transaction.php              26-Sep-2022 04:10               12138
function.sqlsrv-cancel.php                         26-Sep-2022 04:10               10762
function.sqlsrv-client-info.php                    26-Sep-2022 04:10                7010
function.sqlsrv-close.php                          26-Sep-2022 04:10                5607
function.sqlsrv-commit.php                         26-Sep-2022 04:10               11987
function.sqlsrv-configure.php                      26-Sep-2022 04:10                4554
function.sqlsrv-connect.php                        26-Sep-2022 04:10               13007
function.sqlsrv-errors.php                         26-Sep-2022 04:10               10842
function.sqlsrv-execute.php                        26-Sep-2022 04:10               11015
function.sqlsrv-fetch-array.php                    26-Sep-2022 04:10               15546
function.sqlsrv-fetch-object.php                   26-Sep-2022 04:10               12975
function.sqlsrv-fetch.php                          26-Sep-2022 04:10               11445
function.sqlsrv-field-metadata.php                 26-Sep-2022 04:10                9097
function.sqlsrv-free-stmt.php                      26-Sep-2022 04:10                7774
function.sqlsrv-get-config.php                     26-Sep-2022 04:10                3282
function.sqlsrv-get-field.php                      26-Sep-2022 04:10               10766
function.sqlsrv-has-rows.php                       26-Sep-2022 04:10                6464
function.sqlsrv-next-result.php                    26-Sep-2022 04:10                9633
function.sqlsrv-num-fields.php                     26-Sep-2022 04:10                8628
function.sqlsrv-num-rows.php                       26-Sep-2022 04:10                8099
function.sqlsrv-prepare.php                        26-Sep-2022 04:10               14952
function.sqlsrv-query.php                          26-Sep-2022 04:10               11690
function.sqlsrv-rollback.php                       26-Sep-2022 04:10               11398
function.sqlsrv-rows-affected.php                  26-Sep-2022 04:10                8216
function.sqlsrv-send-stream-data.php               26-Sep-2022 04:10                8969
function.sqlsrv-server-info.php                    26-Sep-2022 04:10                6360
function.sqrt.php                                  26-Sep-2022 04:10                3849
function.srand.php                                 26-Sep-2022 04:10                5439
function.sscanf.php                                26-Sep-2022 04:10               10707
function.ssdeep-fuzzy-compare.php                  26-Sep-2022 04:10                3030
function.ssdeep-fuzzy-hash-filename.php            26-Sep-2022 04:10                2806
function.ssdeep-fuzzy-hash.php                     26-Sep-2022 04:10                2648
function.ssh2-auth-agent.php                       26-Sep-2022 04:10                4555
function.ssh2-auth-hostbased-file.php              26-Sep-2022 04:10                7728
function.ssh2-auth-none.php                        26-Sep-2022 04:10                4812
function.ssh2-auth-password.php                    26-Sep-2022 04:10                4763
function.ssh2-auth-pubkey-file.php                 26-Sep-2022 04:10                7151
function.ssh2-connect.php                          26-Sep-2022 04:10               15855
function.ssh2-disconnect.php                       26-Sep-2022 04:10                2878
function.ssh2-exec.php                             26-Sep-2022 04:10                7055
function.ssh2-fetch-stream.php                     26-Sep-2022 04:10                5393
function.ssh2-fingerprint.php                      26-Sep-2022 04:10                5302
function.ssh2-forward-accept.php                   26-Sep-2022 04:10                2874
function.ssh2-forward-listen.php                   26-Sep-2022 04:10                4170
function.ssh2-methods-negotiated.php               26-Sep-2022 04:10                8142
function.ssh2-poll.php                             26-Sep-2022 04:10                3396
function.ssh2-publickey-add.php                    26-Sep-2022 04:10                8084
function.ssh2-publickey-init.php                   26-Sep-2022 04:10                4483
function.ssh2-publickey-list.php                   26-Sep-2022 04:10                8915
function.ssh2-publickey-remove.php                 26-Sep-2022 04:10                4447
function.ssh2-scp-recv.php                         26-Sep-2022 04:10                5269
function.ssh2-scp-send.php                         26-Sep-2022 04:10                5825
function.ssh2-send-eof.php                         26-Sep-2022 04:10                3230
function.ssh2-sftp-chmod.php                       26-Sep-2022 04:10                5749
function.ssh2-sftp-lstat.php                       26-Sep-2022 04:10                7318
function.ssh2-sftp-mkdir.php                       26-Sep-2022 04:10                6454
function.ssh2-sftp-readlink.php                    26-Sep-2022 04:10                5286
function.ssh2-sftp-realpath.php                    26-Sep-2022 04:10                5517
function.ssh2-sftp-rename.php                      26-Sep-2022 04:10                5295
function.ssh2-sftp-rmdir.php                       26-Sep-2022 04:10                5372
function.ssh2-sftp-stat.php                        26-Sep-2022 04:10                7216
function.ssh2-sftp-symlink.php                     26-Sep-2022 04:10                5511
function.ssh2-sftp-unlink.php                      26-Sep-2022 04:10                4812
function.ssh2-sftp.php                             26-Sep-2022 04:10                5117
function.ssh2-shell.php                            26-Sep-2022 04:10                7507
function.ssh2-tunnel.php                           26-Sep-2022 04:10                5204
function.stat.php                                  26-Sep-2022 04:10               13179
function.stats-absolute-deviation.php              26-Sep-2022 04:10                2646
function.stats-cdf-beta.php                        26-Sep-2022 04:10                4900
function.stats-cdf-binomial.php                    26-Sep-2022 04:10                4885
function.stats-cdf-cauchy.php                      26-Sep-2022 04:10                4920
function.stats-cdf-chisquare.php                   26-Sep-2022 04:10                4293
function.stats-cdf-exponential.php                 26-Sep-2022 04:10                4324
function.stats-cdf-f.php                           26-Sep-2022 04:10                4825
function.stats-cdf-gamma.php                       26-Sep-2022 04:10                4884
function.stats-cdf-laplace.php                     26-Sep-2022 04:10                4905
function.stats-cdf-logistic.php                    26-Sep-2022 04:10                4940
function.stats-cdf-negative-binomial.php           26-Sep-2022 04:10                5028
function.stats-cdf-noncentral-chisquare.php        26-Sep-2022 04:10                5130
function.stats-cdf-noncentral-f.php                26-Sep-2022 04:10                5650
function.stats-cdf-noncentral-t.php                26-Sep-2022 04:10                4990
function.stats-cdf-normal.php                      26-Sep-2022 04:10                4922
function.stats-cdf-poisson.php                     26-Sep-2022 04:10                4258
function.stats-cdf-t.php                           26-Sep-2022 04:10                4186
function.stats-cdf-uniform.php                     26-Sep-2022 04:10                4885
function.stats-cdf-weibull.php                     26-Sep-2022 04:10                4922
function.stats-covariance.php                      26-Sep-2022 04:10                2789
function.stats-dens-beta.php                       26-Sep-2022 04:10                3221
function.stats-dens-cauchy.php                     26-Sep-2022 04:10                3279
function.stats-dens-chisquare.php                  26-Sep-2022 04:10                3003
function.stats-dens-exponential.php                26-Sep-2022 04:10                2993
function.stats-dens-f.php                          26-Sep-2022 04:10                3219
function.stats-dens-gamma.php                      26-Sep-2022 04:10                3272
function.stats-dens-laplace.php                    26-Sep-2022 04:10                3306
function.stats-dens-logistic.php                   26-Sep-2022 04:10                3318
function.stats-dens-normal.php                     26-Sep-2022 04:10                3289
function.stats-dens-pmf-binomial.php               26-Sep-2022 04:10                3343
function.stats-dens-pmf-hypergeometric.php         26-Sep-2022 04:10                3941
function.stats-dens-pmf-negative-binomial.php      26-Sep-2022 04:10                3472
function.stats-dens-pmf-poisson.php                26-Sep-2022 04:10                2994
function.stats-dens-t.php                          26-Sep-2022 04:10                2907
function.stats-dens-uniform.php                    26-Sep-2022 04:10                3254
function.stats-dens-weibull.php                    26-Sep-2022 04:10                3286
function.stats-harmonic-mean.php                   26-Sep-2022 04:10                2633
function.stats-kurtosis.php                        26-Sep-2022 04:10                2550
function.stats-rand-gen-beta.php                   26-Sep-2022 04:10                2854
function.stats-rand-gen-chisquare.php              26-Sep-2022 04:10                2581
function.stats-rand-gen-exponential.php            26-Sep-2022 04:10                2579
function.stats-rand-gen-f.php                      26-Sep-2022 04:10                2908
function.stats-rand-gen-funiform.php               26-Sep-2022 04:10                2835
function.stats-rand-gen-gamma.php                  26-Sep-2022 04:10                2921
function.stats-rand-gen-ibinomial-negative.php     26-Sep-2022 04:10                3001
function.stats-rand-gen-ibinomial.php              26-Sep-2022 04:10                2925
function.stats-rand-gen-int.php                    26-Sep-2022 04:10                2203
function.stats-rand-gen-ipoisson.php               26-Sep-2022 04:10                2554
function.stats-rand-gen-iuniform.php               26-Sep-2022 04:10                2902
function.stats-rand-gen-noncentral-chisquare.php   26-Sep-2022 04:10                3043
function.stats-rand-gen-noncentral-f.php           26-Sep-2022 04:10                3342
function.stats-rand-gen-noncentral-t.php           26-Sep-2022 04:10                2956
function.stats-rand-gen-normal.php                 26-Sep-2022 04:10                2869
function.stats-rand-gen-t.php                      26-Sep-2022 04:10                2473
function.stats-rand-get-seeds.php                  26-Sep-2022 04:10                2246
function.stats-rand-phrase-to-seeds.php            26-Sep-2022 04:10                2560
function.stats-rand-ranf.php                       26-Sep-2022 04:10                2247
function.stats-rand-setall.php                     26-Sep-2022 04:10                2810
function.stats-skew.php                            26-Sep-2022 04:10                2516
function.stats-standard-deviation.php              26-Sep-2022 04:10                3414
function.stats-stat-binomial-coef.php              26-Sep-2022 04:10                2814
function.stats-stat-correlation.php                26-Sep-2022 04:10                2969
function.stats-stat-factorial.php                  26-Sep-2022 04:10                2441
function.stats-stat-independent-t.php              26-Sep-2022 04:10                3111
function.stats-stat-innerproduct.php               26-Sep-2022 04:10                2911
function.stats-stat-paired-t.php                   26-Sep-2022 04:10                2848
function.stats-stat-percentile.php                 26-Sep-2022 04:10                2766
function.stats-stat-powersum.php                   26-Sep-2022 04:10                2758
function.stats-variance.php                        26-Sep-2022 04:10                2970
function.stomp-connect-error.php                   26-Sep-2022 04:10                3623
function.stomp-version.php                         26-Sep-2022 04:10                3054
function.str-contains.php                          26-Sep-2022 04:10                8655
function.str-ends-with.php                         26-Sep-2022 04:10                8530
function.str-getcsv.php                            26-Sep-2022 04:10                4136
function.str-ireplace.php                          26-Sep-2022 04:10                8729
function.str-pad.php                               26-Sep-2022 04:10                7904
function.str-repeat.php                            26-Sep-2022 04:10                4611
function.str-replace.php                           26-Sep-2022 04:10               18119
function.str-rot13.php                             26-Sep-2022 04:10                3576
function.str-shuffle.php                           26-Sep-2022 04:10                4091
function.str-split.php                             26-Sep-2022 04:10                6990
function.str-starts-with.php                       26-Sep-2022 04:10                8560
function.str-word-count.php                        26-Sep-2022 04:10                9151
function.strcasecmp.php                            26-Sep-2022 04:10                5794
function.strchr.php                                26-Sep-2022 04:10                1618
function.strcmp.php                                26-Sep-2022 04:10                5695
function.strcoll.php                               26-Sep-2022 04:10                5809
function.strcspn.php                               26-Sep-2022 04:10               10781
function.stream-bucket-append.php                  26-Sep-2022 04:10                2166
function.stream-bucket-make-writeable.php          26-Sep-2022 04:10                2128
function.stream-bucket-new.php                     26-Sep-2022 04:10                2142
function.stream-bucket-prepend.php                 26-Sep-2022 04:10                6756
function.stream-context-create.php                 26-Sep-2022 04:10                7246
function.stream-context-get-default.php            26-Sep-2022 04:10                8845
function.stream-context-get-options.php            26-Sep-2022 04:10                4524
function.stream-context-get-params.php             26-Sep-2022 04:10                5525
function.stream-context-set-default.php            26-Sep-2022 04:10                6594
function.stream-context-set-option.php             26-Sep-2022 04:10                4464
function.stream-context-set-params.php             26-Sep-2022 04:10                4711
function.stream-copy-to-stream.php                 26-Sep-2022 04:10                7278
function.stream-filter-append.php                  26-Sep-2022 04:10               11830
function.stream-filter-prepend.php                 26-Sep-2022 04:10                8511
function.stream-filter-register.php                26-Sep-2022 04:10               20158
function.stream-filter-remove.php                  26-Sep-2022 04:10                6610
function.stream-get-contents.php                   26-Sep-2022 04:10                8241
function.stream-get-filters.php                    26-Sep-2022 04:10                3862
function.stream-get-line.php                       26-Sep-2022 04:10                4610
function.stream-get-meta-data.php                  26-Sep-2022 04:10               10198
function.stream-get-transports.php                 26-Sep-2022 04:10                3850
function.stream-get-wrappers.php                   26-Sep-2022 04:10                4764
function.stream-is-local.php                       26-Sep-2022 04:10                3947
function.stream-isatty.php                         26-Sep-2022 04:10                3765
function.stream-notification-callback.php          26-Sep-2022 04:10               25673
function.stream-register-wrapper.php               26-Sep-2022 04:10                1891
function.stream-resolve-include-path.php           26-Sep-2022 04:10                4026
function.stream-select.php                         26-Sep-2022 04:10               15827
function.stream-set-blocking.php                   26-Sep-2022 04:10                4692
function.stream-set-chunk-size.php                 26-Sep-2022 04:10                3244
function.stream-set-read-buffer.php                26-Sep-2022 04:10                3692
function.stream-set-timeout.php                    26-Sep-2022 04:10                9065
function.stream-set-write-buffer.php               26-Sep-2022 04:10                6326
function.stream-socket-accept.php                  26-Sep-2022 04:10                6710
function.stream-socket-client.php                  26-Sep-2022 04:10               16700
function.stream-socket-enable-crypto.php           26-Sep-2022 04:10               10196
function.stream-socket-get-name.php                26-Sep-2022 04:10                3451
function.stream-socket-pair.php                    26-Sep-2022 04:10                9622
function.stream-socket-recvfrom.php                26-Sep-2022 04:10               10715
function.stream-socket-sendto.php                  26-Sep-2022 04:10                7376
function.stream-socket-server.php                  26-Sep-2022 04:10               14813
function.stream-socket-shutdown.php                26-Sep-2022 04:10                6189
function.stream-supports-lock.php                  26-Sep-2022 04:10                3012
function.stream-wrapper-register.php               26-Sep-2022 04:10                9701
function.stream-wrapper-restore.php                26-Sep-2022 04:10                2735
function.stream-wrapper-unregister.php             26-Sep-2022 04:10                2948
function.strftime.php                              26-Sep-2022 04:10               61844
function.strip-tags.php                            26-Sep-2022 04:10                8509
function.stripcslashes.php                         26-Sep-2022 04:10                2952
function.stripos.php                               26-Sep-2022 04:10               10368
function.stripslashes.php                          26-Sep-2022 04:10                8122
function.stristr.php                               26-Sep-2022 04:10               10095
function.strlen.php                                26-Sep-2022 04:10                6094
function.strnatcasecmp.php                         26-Sep-2022 04:10                5492
function.strnatcmp.php                             26-Sep-2022 04:10                8592
function.strncasecmp.php                           26-Sep-2022 04:10                4877
function.strncmp.php                               26-Sep-2022 04:10                4871
function.strpbrk.php                               26-Sep-2022 04:10                5328
function.strpos.php                                26-Sep-2022 04:10               13119
function.strptime.php                              26-Sep-2022 04:10               10471
function.strrchr.php                               26-Sep-2022 04:10                7071
function.strrev.php                                26-Sep-2022 04:10                3103
function.strripos.php                              26-Sep-2022 04:10                9091
function.strrpos.php                               26-Sep-2022 04:10               10682
function.strspn.php                                26-Sep-2022 04:10               10271
function.strstr.php                                26-Sep-2022 04:10                8541
function.strtok.php                                26-Sep-2022 04:10               10057
function.strtolower.php                            26-Sep-2022 04:10                5143
function.strtotime.php                             26-Sep-2022 04:10               15521
function.strtoupper.php                            26-Sep-2022 04:10                5125
function.strtr.php                                 26-Sep-2022 04:10               11270
function.strval.php                                26-Sep-2022 04:11                6420
function.substr-compare.php                        26-Sep-2022 04:10               10383
function.substr-count.php                          26-Sep-2022 04:10                9225
function.substr-replace.php                        26-Sep-2022 04:10               16059
function.substr.php                                26-Sep-2022 04:10               23039
function.svn-add.php                               26-Sep-2022 04:10                6007
function.svn-auth-get-parameter.php                26-Sep-2022 04:10                3962
function.svn-auth-set-parameter.php                26-Sep-2022 04:10                5518
function.svn-blame.php                             26-Sep-2022 04:10                4898
function.svn-cat.php                               26-Sep-2022 04:10                4776
function.svn-checkout.php                          26-Sep-2022 04:10                7302
function.svn-cleanup.php                           26-Sep-2022 04:10                5157
function.svn-client-version.php                    26-Sep-2022 04:10                3282
function.svn-commit.php                            26-Sep-2022 04:10                7858
function.svn-delete.php                            26-Sep-2022 04:10                4421
function.svn-diff.php                              26-Sep-2022 04:10               13821
function.svn-export.php                            26-Sep-2022 04:10                4939
function.svn-fs-abort-txn.php                      26-Sep-2022 04:10                2559
function.svn-fs-apply-text.php                     26-Sep-2022 04:10                2651
function.svn-fs-begin-txn2.php                     26-Sep-2022 04:10                2592
function.svn-fs-change-node-prop.php               26-Sep-2022 04:10                3017
function.svn-fs-check-path.php                     26-Sep-2022 04:10                2760
function.svn-fs-contents-changed.php               26-Sep-2022 04:10                3036
function.svn-fs-copy.php                           26-Sep-2022 04:10                3007
function.svn-fs-delete.php                         26-Sep-2022 04:10                2672
function.svn-fs-dir-entries.php                    26-Sep-2022 04:10                2775
function.svn-fs-file-contents.php                  26-Sep-2022 04:10                2762
function.svn-fs-file-length.php                    26-Sep-2022 04:10                2691
function.svn-fs-is-dir.php                         26-Sep-2022 04:10                2627
function.svn-fs-is-file.php                        26-Sep-2022 04:10                2622
function.svn-fs-make-dir.php                       26-Sep-2022 04:10                2694
function.svn-fs-make-file.php                      26-Sep-2022 04:10                2694
function.svn-fs-node-created-rev.php               26-Sep-2022 04:10                2718
function.svn-fs-node-prop.php                      26-Sep-2022 04:10                2734
function.svn-fs-props-changed.php                  26-Sep-2022 04:10                3035
function.svn-fs-revision-prop.php                  26-Sep-2022 04:10                2783
function.svn-fs-revision-root.php                  26-Sep-2022 04:10                2709
function.svn-fs-txn-root.php                       26-Sep-2022 04:10                2510
function.svn-fs-youngest-rev.php                   26-Sep-2022 04:10                2562
function.svn-import.php                            26-Sep-2022 04:10                5913
function.svn-log.php                               26-Sep-2022 04:10                8940
function.svn-ls.php                                26-Sep-2022 04:10                7149
function.svn-mkdir.php                             26-Sep-2022 04:10                3051
function.svn-repos-create.php                      26-Sep-2022 04:10                2818
function.svn-repos-fs-begin-txn-for-commit.php     26-Sep-2022 04:10                3058
function.svn-repos-fs-commit-txn.php               26-Sep-2022 04:10                2605
function.svn-repos-fs.php                          26-Sep-2022 04:10                2513
function.svn-repos-hotcopy.php                     26-Sep-2022 04:10                2794
function.svn-repos-open.php                        26-Sep-2022 04:10                2489
function.svn-repos-recover.php                     26-Sep-2022 04:10                2576
function.svn-revert.php                            26-Sep-2022 04:10                3317
function.svn-status.php                            26-Sep-2022 04:10               15076
function.svn-update.php                            26-Sep-2022 04:10                5989
function.swoole-async-dns-lookup.php               26-Sep-2022 04:10                3560
function.swoole-async-read.php                     26-Sep-2022 04:10                4163
function.swoole-async-readfile.php                 26-Sep-2022 04:10                3582
function.swoole-async-set.php                      26-Sep-2022 04:10                2325
function.swoole-async-write.php                    26-Sep-2022 04:10                3422
function.swoole-async-writefile.php                26-Sep-2022 04:10                3450
function.swoole-clear-error.php                    26-Sep-2022 04:10                2239
function.swoole-client-select.php                  26-Sep-2022 04:10                3210
function.swoole-cpu-num.php                        26-Sep-2022 04:10                2055
function.swoole-errno.php                          26-Sep-2022 04:10                2032
function.swoole-error-log.php                      26-Sep-2022 04:10                2992
function.swoole-event-add.php                      26-Sep-2022 04:10                3333
function.swoole-event-defer.php                    26-Sep-2022 04:10                2471
function.swoole-event-del.php                      26-Sep-2022 04:10                2379
function.swoole-event-exit.php                     26-Sep-2022 04:10                2131
function.swoole-event-set.php                      26-Sep-2022 04:10                3320
function.swoole-event-wait.php                     26-Sep-2022 04:10                2102
function.swoole-event-write.php                    26-Sep-2022 04:10                2595
function.swoole-get-local-ip.php                   26-Sep-2022 04:10                2126
function.swoole-last-error.php                     26-Sep-2022 04:10                2081
function.swoole-load-module.php                    26-Sep-2022 04:10                2278
function.swoole-select.php                         26-Sep-2022 04:10                3177
function.swoole-set-process-name.php               26-Sep-2022 04:10                2485
function.swoole-strerror.php                       26-Sep-2022 04:10                2406
function.swoole-timer-after.php                    26-Sep-2022 04:10                2939
function.swoole-timer-exists.php                   26-Sep-2022 04:10                2302
function.swoole-timer-tick.php                     26-Sep-2022 04:10                2812
function.swoole-version.php                        26-Sep-2022 04:10                2058
function.symlink.php                               26-Sep-2022 04:10                5778
function.sys-get-temp-dir.php                      26-Sep-2022 04:10                3999
function.sys-getloadavg.php                        26-Sep-2022 04:10                3815
function.syslog.php                                26-Sep-2022 04:10                9241
function.system.php                                26-Sep-2022 04:10                7810
function.taint.php                                 26-Sep-2022 04:10                2536
function.tan.php                                   26-Sep-2022 04:10                4289
function.tanh.php                                  26-Sep-2022 04:10                3143
function.tcpwrap-check.php                         26-Sep-2022 04:10                5467
function.tempnam.php                               26-Sep-2022 04:10                6385
function.textdomain.php                            26-Sep-2022 04:10                2657
function.tidy-access-count.php                     26-Sep-2022 04:10                6573
function.tidy-config-count.php                     26-Sep-2022 04:10                4383
function.tidy-error-count.php                      26-Sep-2022 04:10                5346
function.tidy-get-output.php                       26-Sep-2022 04:10                4260
function.tidy-warning-count.php                    26-Sep-2022 04:10                4945
function.time-nanosleep.php                        26-Sep-2022 04:10                9311
function.time-sleep-until.php                      26-Sep-2022 04:10                6304
function.time.php                                  26-Sep-2022 04:10                5783
function.timezone-abbreviations-list.php           26-Sep-2022 04:10                1891
function.timezone-identifiers-list.php             26-Sep-2022 04:10                1907
function.timezone-location-get.php                 26-Sep-2022 04:10                1863
function.timezone-name-from-abbr.php               26-Sep-2022 04:10                5977
function.timezone-name-get.php                     26-Sep-2022 04:10                1807
function.timezone-offset-get.php                   26-Sep-2022 04:10                1805
function.timezone-open.php                         26-Sep-2022 04:10                1795
function.timezone-transitions-get.php              26-Sep-2022 04:10                1866
function.timezone-version-get.php                  26-Sep-2022 04:10                3198
function.tmpfile.php                               26-Sep-2022 04:10                5210
function.token-get-all.php                         26-Sep-2022 04:10                7049
function.token-name.php                            26-Sep-2022 04:10                4105
function.touch.php                                 26-Sep-2022 04:10                7905
function.trader-acos.php                           26-Sep-2022 04:10                2378
function.trader-ad.php                             26-Sep-2022 04:10                3144
function.trader-add.php                            26-Sep-2022 04:10                2632
function.trader-adosc.php                          26-Sep-2022 04:10                3915
function.trader-adx.php                            26-Sep-2022 04:10                3234
function.trader-adxr.php                           26-Sep-2022 04:10                3252
function.trader-apo.php                            26-Sep-2022 04:10                3436
function.trader-aroon.php                          26-Sep-2022 04:10                2845
function.trader-aroonosc.php                       26-Sep-2022 04:10                2881
function.trader-asin.php                           26-Sep-2022 04:10                2384
function.trader-atan.php                           26-Sep-2022 04:10                2386
function.trader-atr.php                            26-Sep-2022 04:10                3222
function.trader-avgprice.php                       26-Sep-2022 04:10                3198
function.trader-bbands.php                         26-Sep-2022 04:10                4169
function.trader-beta.php                           26-Sep-2022 04:10                2810
function.trader-bop.php                            26-Sep-2022 04:10                3151
function.trader-cci.php                            26-Sep-2022 04:10                3230
function.trader-cdl2crows.php                      26-Sep-2022 04:10                3223
function.trader-cdl3blackcrows.php                 26-Sep-2022 04:10                3285
function.trader-cdl3inside.php                     26-Sep-2022 04:10                3283
function.trader-cdl3linestrike.php                 26-Sep-2022 04:10                3282
function.trader-cdl3outside.php                    26-Sep-2022 04:10                3297
function.trader-cdl3starsinsouth.php               26-Sep-2022 04:10                3328
function.trader-cdl3whitesoldiers.php              26-Sep-2022 04:10                3353
function.trader-cdlabandonedbaby.php               26-Sep-2022 04:10                3682
function.trader-cdladvanceblock.php                26-Sep-2022 04:10                3308
function.trader-cdlbelthold.php                    26-Sep-2022 04:10                3261
function.trader-cdlbreakaway.php                   26-Sep-2022 04:10                3272
function.trader-cdlclosingmarubozu.php             26-Sep-2022 04:10                3351
function.trader-cdlconcealbabyswall.php            26-Sep-2022 04:10                3375
function.trader-cdlcounterattack.php               26-Sep-2022 04:10                3332
function.trader-cdldarkcloudcover.php              26-Sep-2022 04:10                3681
function.trader-cdldoji.php                        26-Sep-2022 04:10                3218
function.trader-cdldojistar.php                    26-Sep-2022 04:10                3257
function.trader-cdldragonflydoji.php               26-Sep-2022 04:10                3308
function.trader-cdlengulfing.php                   26-Sep-2022 04:10                3294
function.trader-cdleveningdojistar.php             26-Sep-2022 04:10                3698
function.trader-cdleveningstar.php                 26-Sep-2022 04:10                3677
function.trader-cdlgapsidesidewhite.php            26-Sep-2022 04:10                3388
function.trader-cdlgravestonedoji.php              26-Sep-2022 04:10                3326
function.trader-cdlhammer.php                      26-Sep-2022 04:10                3246
function.trader-cdlhangingman.php                  26-Sep-2022 04:10                3268
function.trader-cdlharami.php                      26-Sep-2022 04:10                3246
function.trader-cdlharamicross.php                 26-Sep-2022 04:10                3287
function.trader-cdlhighwave.php                    26-Sep-2022 04:10                3263
function.trader-cdlhikkake.php                     26-Sep-2022 04:10                3251
function.trader-cdlhikkakemod.php                  26-Sep-2022 04:10                3294
function.trader-cdlhomingpigeon.php                26-Sep-2022 04:10                3316
function.trader-cdlidentical3crows.php             26-Sep-2022 04:10                3339
function.trader-cdlinneck.php                      26-Sep-2022 04:10                3279
function.trader-cdlinvertedhammer.php              26-Sep-2022 04:10                3315
function.trader-cdlkicking.php                     26-Sep-2022 04:10                3264
function.trader-cdlkickingbylength.php             26-Sep-2022 04:10                3375
function.trader-cdlladderbottom.php                26-Sep-2022 04:10                3325
function.trader-cdllongleggeddoji.php              26-Sep-2022 04:10                3322
function.trader-cdllongline.php                    26-Sep-2022 04:10                3274
function.trader-cdlmarubozu.php                    26-Sep-2022 04:10                3256
function.trader-cdlmatchinglow.php                 26-Sep-2022 04:10                3291
function.trader-cdlmathold.php                     26-Sep-2022 04:10                3614
function.trader-cdlmorningdojistar.php             26-Sep-2022 04:10                3690
function.trader-cdlmorningstar.php                 26-Sep-2022 04:10                3651
function.trader-cdlonneck.php                      26-Sep-2022 04:10                3251
function.trader-cdlpiercing.php                    26-Sep-2022 04:10                3262
function.trader-cdlrickshawman.php                 26-Sep-2022 04:10                3296
function.trader-cdlrisefall3methods.php            26-Sep-2022 04:10                3375
function.trader-cdlseparatinglines.php             26-Sep-2022 04:10                3352
function.trader-cdlshootingstar.php                26-Sep-2022 04:10                3312
function.trader-cdlshortline.php                   26-Sep-2022 04:10                3286
function.trader-cdlspinningtop.php                 26-Sep-2022 04:10                3292
function.trader-cdlstalledpattern.php              26-Sep-2022 04:10                3332
function.trader-cdlsticksandwich.php               26-Sep-2022 04:10                3309
function.trader-cdltakuri.php                      26-Sep-2022 04:10                3278
function.trader-cdltasukigap.php                   26-Sep-2022 04:10                3262
function.trader-cdlthrusting.php                   26-Sep-2022 04:10                3269
function.trader-cdltristar.php                     26-Sep-2022 04:10                3267
function.trader-cdlunique3river.php                26-Sep-2022 04:10                3312
function.trader-cdlupsidegap2crows.php             26-Sep-2022 04:10                3369
function.trader-cdlxsidegap3methods.php            26-Sep-2022 04:10                3358
function.trader-ceil.php                           26-Sep-2022 04:10                2414
function.trader-cmo.php                            26-Sep-2022 04:10                2578
function.trader-correl.php                         26-Sep-2022 04:10                2862
function.trader-cos.php                            26-Sep-2022 04:10                2370
function.trader-cosh.php                           26-Sep-2022 04:10                2385
function.trader-dema.php                           26-Sep-2022 04:10                2582
function.trader-div.php                            26-Sep-2022 04:10                2660
function.trader-dx.php                             26-Sep-2022 04:10                3212
function.trader-ema.php                            26-Sep-2022 04:10                2566
function.trader-errno.php                          26-Sep-2022 04:10                1983
function.trader-exp.php                            26-Sep-2022 04:10                2417
function.trader-floor.php                          26-Sep-2022 04:10                2399
function.trader-get-compat.php                     26-Sep-2022 04:10                2182
function.trader-get-unstable-period.php            26-Sep-2022 04:10                2602
function.trader-ht-dcperiod.php                    26-Sep-2022 04:10                2397
function.trader-ht-dcphase.php                     26-Sep-2022 04:10                2365
function.trader-ht-phasor.php                      26-Sep-2022 04:10                2349
function.trader-ht-sine.php                        26-Sep-2022 04:10                2323
function.trader-ht-trendline.php                   26-Sep-2022 04:10                2392
function.trader-ht-trendmode.php                   26-Sep-2022 04:10                2380
function.trader-kama.php                           26-Sep-2022 04:10                2626
function.trader-linearreg-angle.php                26-Sep-2022 04:10                2722
function.trader-linearreg-intercept.php            26-Sep-2022 04:10                2782
function.trader-linearreg-slope.php                26-Sep-2022 04:10                2734
function.trader-linearreg.php                      26-Sep-2022 04:10                2639
function.trader-ln.php                             26-Sep-2022 04:10                2374
function.trader-log10.php                          26-Sep-2022 04:10                2390
function.trader-ma.php                             26-Sep-2022 04:10                2936
function.trader-macd.php                           26-Sep-2022 04:10                3433
function.trader-macdext.php                        26-Sep-2022 04:10                4780
function.trader-macdfix.php                        26-Sep-2022 04:10                2679
function.trader-mama.php                           26-Sep-2022 04:10                2975
function.trader-mavp.php                           26-Sep-2022 04:10                3768
function.trader-max.php                            26-Sep-2022 04:10                2593
function.trader-maxindex.php                       26-Sep-2022 04:10                2653
function.trader-medprice.php                       26-Sep-2022 04:10                2557
function.trader-mfi.php                            26-Sep-2022 04:10                3532
function.trader-midpoint.php                       26-Sep-2022 04:10                2628
function.trader-midprice.php                       26-Sep-2022 04:10                2908
function.trader-min.php                            26-Sep-2022 04:10                2605
function.trader-minindex.php                       26-Sep-2022 04:10                2653
function.trader-minmax.php                         26-Sep-2022 04:10                2652
function.trader-minmaxindex.php                    26-Sep-2022 04:10                2708
function.trader-minus-di.php                       26-Sep-2022 04:10                3292
function.trader-minus-dm.php                       26-Sep-2022 04:10                2898
function.trader-mom.php                            26-Sep-2022 04:10                2560
function.trader-mult.php                           26-Sep-2022 04:10                2672
function.trader-natr.php                           26-Sep-2022 04:10                3240
function.trader-obv.php                            26-Sep-2022 04:10                2516
function.trader-plus-di.php                        26-Sep-2022 04:10                3263
function.trader-plus-dm.php                        26-Sep-2022 04:10                2885
function.trader-ppo.php                            26-Sep-2022 04:10                3440
function.trader-roc.php                            26-Sep-2022 04:10                2591
function.trader-rocp.php                           26-Sep-2022 04:10                2627
function.trader-rocr.php                           26-Sep-2022 04:10                2608
function.trader-rocr100.php                        26-Sep-2022 04:10                2652
function.trader-rsi.php                            26-Sep-2022 04:10                2568
function.trader-sar.php                            26-Sep-2022 04:10                3486
function.trader-sarext.php                         26-Sep-2022 04:10                6656
function.trader-set-compat.php                     26-Sep-2022 04:10                2591
function.trader-set-unstable-period.php            26-Sep-2022 04:10                3129
function.trader-sin.php                            26-Sep-2022 04:10                2392
function.trader-sinh.php                           26-Sep-2022 04:10                2378
function.trader-sma.php                            26-Sep-2022 04:10                2563
function.trader-sqrt.php                           26-Sep-2022 04:10                2376
function.trader-stddev.php                         26-Sep-2022 04:10                2858
function.trader-stoch.php                          26-Sep-2022 04:10                4965
function.trader-stochf.php                         26-Sep-2022 04:10                4161
function.trader-stochrsi.php                       26-Sep-2022 04:10                3954
function.trader-sub.php                            26-Sep-2022 04:10                2669
function.trader-sum.php                            26-Sep-2022 04:10                2547
function.trader-t3.php                             26-Sep-2022 04:10                2880
function.trader-tan.php                            26-Sep-2022 04:10                2366
function.trader-tanh.php                           26-Sep-2022 04:10                2404
function.trader-tema.php                           26-Sep-2022 04:10                2589
function.trader-trange.php                         26-Sep-2022 04:10                2802
function.trader-trima.php                          26-Sep-2022 04:10                2591
function.trader-trix.php                           26-Sep-2022 04:10                2609
function.trader-tsf.php                            26-Sep-2022 04:10                2582
function.trader-typprice.php                       26-Sep-2022 04:10                2821
function.trader-ultosc.php                         26-Sep-2022 04:10                4009
function.trader-var.php                            26-Sep-2022 04:10                2825
function.trader-wclprice.php                       26-Sep-2022 04:10                2831
function.trader-willr.php                          26-Sep-2022 04:10                3233
function.trader-wma.php                            26-Sep-2022 04:10                2585
function.trait-exists.php                          26-Sep-2022 04:10                2709
function.trigger-error.php                         26-Sep-2022 04:10                6379
function.trim.php                                  26-Sep-2022 04:10               13843
function.uasort.php                                26-Sep-2022 04:10                8457
function.ucfirst.php                               26-Sep-2022 04:10                5601
function.ucwords.php                               26-Sep-2022 04:10                8445
function.ui-draw-text-font-fontfamilies.php        26-Sep-2022 04:11                2024
function.ui-quit.php                               26-Sep-2022 04:11                1998
function.ui-run.php                                26-Sep-2022 04:11                2325
function.uksort.php                                26-Sep-2022 04:10                8448
function.umask.php                                 26-Sep-2022 04:10                5126
function.uniqid.php                                26-Sep-2022 04:10                7213
function.unixtojd.php                              26-Sep-2022 04:10                2866
function.unlink.php                                26-Sep-2022 04:10                4804
function.unpack.php                                26-Sep-2022 04:10                9294
function.unregister-tick-function.php              26-Sep-2022 04:10                3164
function.unserialize.php                           26-Sep-2022 04:11               16463
function.unset.php                                 26-Sep-2022 04:11               15192
function.untaint.php                               26-Sep-2022 04:10                2373
function.uopz-add-function.php                     26-Sep-2022 04:10                6565
function.uopz-allow-exit.php                       26-Sep-2022 04:10                4548
function.uopz-backup.php                           26-Sep-2022 04:10                4364
function.uopz-compose.php                          26-Sep-2022 04:10                6861
function.uopz-copy.php                             26-Sep-2022 04:10                5076
function.uopz-del-function.php                     26-Sep-2022 04:10                6110
function.uopz-delete.php                           26-Sep-2022 04:10                5851
function.uopz-extend.php                           26-Sep-2022 04:10                4741
function.uopz-flags.php                            26-Sep-2022 04:10               10706
function.uopz-function.php                         26-Sep-2022 04:10                7051
function.uopz-get-exit-status.php                  26-Sep-2022 04:10                4174
function.uopz-get-hook.php                         26-Sep-2022 04:10                5169
function.uopz-get-mock.php                         26-Sep-2022 04:10                5116
function.uopz-get-property.php                     26-Sep-2022 04:10                6102
function.uopz-get-return.php                       26-Sep-2022 04:10                4319
function.uopz-get-static.php                       26-Sep-2022 04:10                4793
function.uopz-implement.php                        26-Sep-2022 04:10                4766
function.uopz-overload.php                         26-Sep-2022 04:10                3849
function.uopz-redefine.php                         26-Sep-2022 04:10                4805
function.uopz-rename.php                           26-Sep-2022 04:10                6531
function.uopz-restore.php                          26-Sep-2022 04:10                4728
function.uopz-set-hook.php                         26-Sep-2022 04:10                5331
function.uopz-set-mock.php                         26-Sep-2022 04:10               12561
function.uopz-set-property.php                     26-Sep-2022 04:10                7559
function.uopz-set-return.php                       26-Sep-2022 04:10                9351
function.uopz-set-static.php                       26-Sep-2022 04:10                5434
function.uopz-undefine.php                         26-Sep-2022 04:10                4267
function.uopz-unset-hook.php                       26-Sep-2022 04:10                5225
function.uopz-unset-mock.php                       26-Sep-2022 04:10                5459
function.uopz-unset-return.php                     26-Sep-2022 04:10                4615
function.urldecode.php                             26-Sep-2022 04:10                6508
function.urlencode.php                             26-Sep-2022 04:10                8277
function.use-soap-error-handler.php                26-Sep-2022 04:11                3800
function.user-error.php                            26-Sep-2022 04:10                1687
function.usleep.php                                26-Sep-2022 04:10                5088
function.usort.php                                 26-Sep-2022 04:10               22294
function.utf8-decode.php                           26-Sep-2022 04:10                8819
function.utf8-encode.php                           26-Sep-2022 04:10                7245
function.var-dump.php                              26-Sep-2022 04:11                6712
function.var-export.php                            26-Sep-2022 04:11               15364
function.var-representation.php                    26-Sep-2022 04:10               14338
function.variant-abs.php                           26-Sep-2022 04:11                4043
function.variant-add.php                           26-Sep-2022 04:11                5691
function.variant-and.php                           26-Sep-2022 04:11                6426
function.variant-cast.php                          26-Sep-2022 04:11                3506
function.variant-cat.php                           26-Sep-2022 04:11                4892
function.variant-cmp.php                           26-Sep-2022 04:11                7381
function.variant-date-from-timestamp.php           26-Sep-2022 04:11                3563
function.variant-date-to-timestamp.php             26-Sep-2022 04:11                3542
function.variant-div.php                           26-Sep-2022 04:11                6599
function.variant-eqv.php                           26-Sep-2022 04:11                4498
function.variant-fix.php                           26-Sep-2022 04:11                5454
function.variant-get-type.php                      26-Sep-2022 04:11                3362
function.variant-idiv.php                          26-Sep-2022 04:11                5933
function.variant-imp.php                           26-Sep-2022 04:11                5947
function.variant-int.php                           26-Sep-2022 04:11                4952
function.variant-mod.php                           26-Sep-2022 04:11                4962
function.variant-mul.php                           26-Sep-2022 04:11                6025
function.variant-neg.php                           26-Sep-2022 04:11                3717
function.variant-not.php                           26-Sep-2022 04:11                3910
function.variant-or.php                            26-Sep-2022 04:11                6611
function.variant-pow.php                           26-Sep-2022 04:11                4803
function.variant-round.php                         26-Sep-2022 04:11                4419
function.variant-set-type.php                      26-Sep-2022 04:11                3429
function.variant-set.php                           26-Sep-2022 04:11                2902
function.variant-sub.php                           26-Sep-2022 04:11                5617
function.variant-xor.php                           26-Sep-2022 04:11                5954
function.version-compare.php                       26-Sep-2022 04:10               11766
function.vfprintf.php                              26-Sep-2022 04:10                6153
function.virtual.php                               26-Sep-2022 04:10                5338
function.vprintf.php                               26-Sep-2022 04:10                4770
function.vsprintf.php                              26-Sep-2022 04:10                4615
function.wddx-add-vars.php                         26-Sep-2022 04:11                3673
function.wddx-deserialize.php                      26-Sep-2022 04:11                2635
function.wddx-packet-end.php                       26-Sep-2022 04:11                2736
function.wddx-packet-start.php                     26-Sep-2022 04:11                2902
function.wddx-serialize-value.php                  26-Sep-2022 04:11                3171
function.wddx-serialize-vars.php                   26-Sep-2022 04:11                6054
function.win32-continue-service.php                26-Sep-2022 04:11                3590
function.win32-create-service.php                  26-Sep-2022 04:11               12436
function.win32-delete-service.php                  26-Sep-2022 04:11                5005
function.win32-get-last-control-message.php        26-Sep-2022 04:11                3527
function.win32-pause-service.php                   26-Sep-2022 04:11                3581
function.win32-query-service-status.php            26-Sep-2022 04:11                6267
function.win32-send-custom-control.php             26-Sep-2022 04:11                4864
function.win32-set-service-exit-code.php           26-Sep-2022 04:11                4441
function.win32-set-service-exit-mode.php           26-Sep-2022 04:11                4467
function.win32-set-service-status.php              26-Sep-2022 04:11                4982
function.win32-start-service-ctrl-dispatcher.php   26-Sep-2022 04:11                7602
function.win32-start-service.php                   26-Sep-2022 04:11                3596
function.win32-stop-service.php                    26-Sep-2022 04:11                3516
function.wincache-fcache-fileinfo.php              26-Sep-2022 04:10                9248
function.wincache-fcache-meminfo.php               26-Sep-2022 04:10                6992
function.wincache-lock.php                         26-Sep-2022 04:10                8830
function.wincache-ocache-fileinfo.php              26-Sep-2022 04:10                9931
function.wincache-ocache-meminfo.php               26-Sep-2022 04:10                7385
function.wincache-refresh-if-changed.php           26-Sep-2022 04:10                7904
function.wincache-rplist-fileinfo.php              26-Sep-2022 04:10                7612
function.wincache-rplist-meminfo.php               26-Sep-2022 04:10                7289
function.wincache-scache-info.php                  26-Sep-2022 04:10                9515
function.wincache-scache-meminfo.php               26-Sep-2022 04:10                6498
function.wincache-ucache-add.php                   26-Sep-2022 04:10               13348
function.wincache-ucache-cas.php                   26-Sep-2022 04:10                6206
function.wincache-ucache-clear.php                 26-Sep-2022 04:10                7500
function.wincache-ucache-dec.php                   26-Sep-2022 04:10                6176
function.wincache-ucache-delete.php                26-Sep-2022 04:10               11645
function.wincache-ucache-exists.php                26-Sep-2022 04:10                6238
function.wincache-ucache-get.php                   26-Sep-2022 04:10               10840
function.wincache-ucache-inc.php                   26-Sep-2022 04:10                6150
function.wincache-ucache-info.php                  26-Sep-2022 04:10               11407
function.wincache-ucache-meminfo.php               26-Sep-2022 04:10                6755
function.wincache-ucache-set.php                   26-Sep-2022 04:10               13576
function.wincache-unlock.php                       26-Sep-2022 04:10                8128
function.wordwrap.php                              26-Sep-2022 04:10                9101
function.xattr-get.php                             26-Sep-2022 04:10                5954
function.xattr-list.php                            26-Sep-2022 04:10                6595
function.xattr-remove.php                          26-Sep-2022 04:10                6137
function.xattr-set.php                             26-Sep-2022 04:10                7741
function.xattr-supported.php                       26-Sep-2022 04:10                5163
function.xdiff-file-bdiff-size.php                 26-Sep-2022 04:10                4963
function.xdiff-file-bdiff.php                      26-Sep-2022 04:10                5856
function.xdiff-file-bpatch.php                     26-Sep-2022 04:10                6507
function.xdiff-file-diff-binary.php                26-Sep-2022 04:10                6193
function.xdiff-file-diff.php                       26-Sep-2022 04:10                7052
function.xdiff-file-merge3.php                     26-Sep-2022 04:10                6735
function.xdiff-file-patch-binary.php               26-Sep-2022 04:10                6479
function.xdiff-file-patch.php                      26-Sep-2022 04:10                8859
function.xdiff-file-rabdiff.php                    26-Sep-2022 04:10                6483
function.xdiff-string-bdiff-size.php               26-Sep-2022 04:10                5268
function.xdiff-string-bdiff.php                    26-Sep-2022 04:10                3776
function.xdiff-string-bpatch.php                   26-Sep-2022 04:10                3849
function.xdiff-string-diff-binary.php              26-Sep-2022 04:10                4157
function.xdiff-string-diff.php                     26-Sep-2022 04:10                7537
function.xdiff-string-merge3.php                   26-Sep-2022 04:10                4669
function.xdiff-string-patch-binary.php             26-Sep-2022 04:10                4301
function.xdiff-string-patch.php                    26-Sep-2022 04:10                8277
function.xdiff-string-rabdiff.php                  26-Sep-2022 04:10                4486
function.xhprof-disable.php                        26-Sep-2022 04:10                3881
function.xhprof-enable.php                         26-Sep-2022 04:10                7890
function.xhprof-sample-disable.php                 26-Sep-2022 04:10                4694
function.xhprof-sample-enable.php                  26-Sep-2022 04:10                3561
function.xml-error-string.php                      26-Sep-2022 04:11                3198
function.xml-get-current-byte-index.php            26-Sep-2022 04:11                3971
function.xml-get-current-column-number.php         26-Sep-2022 04:11                4385
function.xml-get-current-line-number.php           26-Sep-2022 04:11                4183
function.xml-get-error-code.php                    26-Sep-2022 04:11                3796
function.xml-parse-into-struct.php                 26-Sep-2022 04:11               20627
function.xml-parse.php                             26-Sep-2022 04:11                4560
function.xml-parser-create-ns.php                  26-Sep-2022 04:11                4645
function.xml-parser-create.php                     26-Sep-2022 04:11                4036
function.xml-parser-free.php                       26-Sep-2022 04:11                2612
function.xml-parser-get-option.php                 26-Sep-2022 04:11                3475
function.xml-parser-set-option.php                 26-Sep-2022 04:11                5956
function.xml-set-character-data-handler.php        26-Sep-2022 04:11                5825
function.xml-set-default-handler.php               26-Sep-2022 04:11                5647
function.xml-set-element-handler.php               26-Sep-2022 04:11                7751
function.xml-set-end-namespace-decl-handler.php    26-Sep-2022 04:11                6896
function.xml-set-external-entity-ref-handler.php   26-Sep-2022 04:11                7226
function.xml-set-notation-decl-handler.php         26-Sep-2022 04:11                7622
function.xml-set-object.php                        26-Sep-2022 04:11               10485
function.xml-set-processing-instruction-handler..> 26-Sep-2022 04:11                6840
function.xml-set-start-namespace-decl-handler.php  26-Sep-2022 04:11                7173
function.xml-set-unparsed-entity-decl-handler.php  26-Sep-2022 04:11                8198
function.xmlrpc-decode-request.php                 26-Sep-2022 04:11                2699
function.xmlrpc-decode.php                         26-Sep-2022 04:11                4112
function.xmlrpc-encode-request.php                 26-Sep-2022 04:11                8894
function.xmlrpc-encode.php                         26-Sep-2022 04:11                2383
function.xmlrpc-get-type.php                       26-Sep-2022 04:11                6577
function.xmlrpc-is-fault.php                       26-Sep-2022 04:11                3774
function.xmlrpc-parse-method-descriptions.php      26-Sep-2022 04:11                2499
function.xmlrpc-server-add-introspection-data.php  26-Sep-2022 04:11                2625
function.xmlrpc-server-call-method.php             26-Sep-2022 04:11                3034
function.xmlrpc-server-create.php                  26-Sep-2022 04:11                2255
function.xmlrpc-server-destroy.php                 26-Sep-2022 04:11                2414
function.xmlrpc-server-register-introspection-c..> 26-Sep-2022 04:11                2706
function.xmlrpc-server-register-method.php         26-Sep-2022 04:11                2735
function.xmlrpc-set-type.php                       26-Sep-2022 04:11                5267
function.xmlwriter-end-attribute.php               26-Sep-2022 04:11                4293
function.xmlwriter-end-cdata.php                   26-Sep-2022 04:11                3836
function.xmlwriter-end-comment.php                 26-Sep-2022 04:11                3856
function.xmlwriter-end-document.php                26-Sep-2022 04:11                3655
function.xmlwriter-end-dtd-attlist.php             26-Sep-2022 04:11                3934
function.xmlwriter-end-dtd-element.php             26-Sep-2022 04:11                3953
function.xmlwriter-end-dtd-entity.php              26-Sep-2022 04:11                3914
function.xmlwriter-end-dtd.php                     26-Sep-2022 04:11                3800
function.xmlwriter-end-element.php                 26-Sep-2022 04:11                3867
function.xmlwriter-end-pi.php                      26-Sep-2022 04:11                3747
function.xmlwriter-flush.php                       26-Sep-2022 04:11                3995
function.xmlwriter-full-end-element.php            26-Sep-2022 04:11                3750
function.xmlwriter-open-memory.php                 26-Sep-2022 04:11                3525
function.xmlwriter-open-uri.php                    26-Sep-2022 04:11                3887
function.xmlwriter-output-memory.php               26-Sep-2022 04:11                4144
function.xmlwriter-set-indent-string.php           26-Sep-2022 04:11                4202
function.xmlwriter-set-indent.php                  26-Sep-2022 04:11                4055
function.xmlwriter-start-attribute-ns.php          26-Sep-2022 04:11                5581
function.xmlwriter-start-attribute.php             26-Sep-2022 04:11                4720
function.xmlwriter-start-cdata.php                 26-Sep-2022 04:11                3853
function.xmlwriter-start-comment.php               26-Sep-2022 04:11                3884
function.xmlwriter-start-document.php              26-Sep-2022 04:11                5329
function.xmlwriter-start-dtd-attlist.php           26-Sep-2022 04:11                4338
function.xmlwriter-start-dtd-element.php           26-Sep-2022 04:11                4388
function.xmlwriter-start-dtd-entity.php            26-Sep-2022 04:11                4628
function.xmlwriter-start-dtd.php                   26-Sep-2022 04:11                5276
function.xmlwriter-start-element-ns.php            26-Sep-2022 04:11                5160
function.xmlwriter-start-element.php               26-Sep-2022 04:11                4263
function.xmlwriter-start-pi.php                    26-Sep-2022 04:11                4175
function.xmlwriter-text.php                        26-Sep-2022 04:11                3503
function.xmlwriter-write-attribute-ns.php          26-Sep-2022 04:11                6105
function.xmlwriter-write-attribute.php             26-Sep-2022 04:11                5067
function.xmlwriter-write-cdata.php                 26-Sep-2022 04:11                4229
function.xmlwriter-write-comment.php               26-Sep-2022 04:11                4254
function.xmlwriter-write-dtd-attlist.php           26-Sep-2022 04:11                4728
function.xmlwriter-write-dtd-element.php           26-Sep-2022 04:11                4718
function.xmlwriter-write-dtd-entity.php            26-Sep-2022 04:11                5862
function.xmlwriter-write-dtd.php                   26-Sep-2022 04:11                5800
function.xmlwriter-write-element-ns.php            26-Sep-2022 04:11                6515
function.xmlwriter-write-element.php               26-Sep-2022 04:11                5501
function.xmlwriter-write-pi.php                    26-Sep-2022 04:11                4563
function.xmlwriter-write-raw.php                   26-Sep-2022 04:11                3922
function.yaml-emit-file.php                        26-Sep-2022 04:10                5960
function.yaml-emit.php                             26-Sep-2022 04:10               12965
function.yaml-parse-file.php                       26-Sep-2022 04:10                5969
function.yaml-parse-url.php                        26-Sep-2022 04:10                5623
function.yaml-parse.php                            26-Sep-2022 04:10               10252
function.yaz-addinfo.php                           26-Sep-2022 04:10                3369
function.yaz-ccl-conf.php                          26-Sep-2022 04:10                5820
function.yaz-ccl-parse.php                         26-Sep-2022 04:10                6743
function.yaz-close.php                             26-Sep-2022 04:10                3298
function.yaz-connect.php                           26-Sep-2022 04:10                9314
function.yaz-database.php                          26-Sep-2022 04:10                3224
function.yaz-element.php                           26-Sep-2022 04:10                3658
function.yaz-errno.php                             26-Sep-2022 04:10                3644
function.yaz-error.php                             26-Sep-2022 04:10                3362
function.yaz-es-result.php                         26-Sep-2022 04:10                3241
function.yaz-es.php                                26-Sep-2022 04:10                7297
function.yaz-get-option.php                        26-Sep-2022 04:10                3260
function.yaz-hits.php                              26-Sep-2022 04:10                4927
function.yaz-itemorder.php                         26-Sep-2022 04:10                7012
function.yaz-present.php                           26-Sep-2022 04:10                2816
function.yaz-range.php                             26-Sep-2022 04:10                3429
function.yaz-record.php                            26-Sep-2022 04:10               14876
function.yaz-scan-result.php                       26-Sep-2022 04:10                3932
function.yaz-scan.php                              26-Sep-2022 04:10                9877
function.yaz-schema.php                            26-Sep-2022 04:10                3352
function.yaz-search.php                            26-Sep-2022 04:10                8703
function.yaz-set-option.php                        26-Sep-2022 04:10                6871
function.yaz-sort.php                              26-Sep-2022 04:10                5803
function.yaz-syntax.php                            26-Sep-2022 04:10                3304
function.yaz-wait.php                              26-Sep-2022 04:10                4058
function.zend-thread-id.php                        26-Sep-2022 04:10                3496
function.zend-version.php                          26-Sep-2022 04:10                3843
function.zip-close.php                             26-Sep-2022 04:10                2959
function.zip-entry-close.php                       26-Sep-2022 04:10                3219
function.zip-entry-compressedsize.php              26-Sep-2022 04:10                3216
function.zip-entry-compressionmethod.php           26-Sep-2022 04:10                3315
function.zip-entry-filesize.php                    26-Sep-2022 04:10                3172
function.zip-entry-name.php                        26-Sep-2022 04:10                3103
function.zip-entry-open.php                        26-Sep-2022 04:10                4822
function.zip-entry-read.php                        26-Sep-2022 04:10                3914
function.zip-open.php                              26-Sep-2022 04:10                3184
function.zip-read.php                              26-Sep-2022 04:10                3538
function.zlib-decode.php                           26-Sep-2022 04:10                3171
function.zlib-encode.php                           26-Sep-2022 04:10                4920
function.zlib-get-coding-type.php                  26-Sep-2022 04:10                2500
function.zookeeper-dispatch.php                    26-Sep-2022 04:10                8649
functional.parallel.php                            26-Sep-2022 04:10                2553
functions.anonymous.php                            26-Sep-2022 04:10               26478
functions.arguments.php                            26-Sep-2022 04:10               57744
functions.arrow.php                                26-Sep-2022 04:10               11342
functions.internal.php                             26-Sep-2022 04:10                4760
functions.returning-values.php                     26-Sep-2022 04:10               13910
functions.user-defined.php                         26-Sep-2022 04:10               10321
functions.variable-functions.php                   26-Sep-2022 04:10               13609
gearman.configuration.php                          26-Sep-2022 04:10                1301
gearman.constants.php                              26-Sep-2022 04:10               18442
gearman.examples-reverse-bg.php                    26-Sep-2022 04:10               11951
gearman.examples-reverse-task.php                  26-Sep-2022 04:10               19042
gearman.examples-reverse.php                       26-Sep-2022 04:10               14327
gearman.examples.php                               26-Sep-2022 04:10                1552
gearman.installation.php                           26-Sep-2022 04:10                1650
gearman.requirements.php                           26-Sep-2022 04:10                1340
gearman.resources.php                              26-Sep-2022 04:10                1263
gearman.setup.php                                  26-Sep-2022 04:10                1636
gearmanclient.addoptions.php                       26-Sep-2022 04:10                2472
gearmanclient.addserver.php                        26-Sep-2022 04:10                5056
gearmanclient.addservers.php                       26-Sep-2022 04:10                4600
gearmanclient.addtask.php                          26-Sep-2022 04:10               15465
gearmanclient.addtaskbackground.php                26-Sep-2022 04:10               22011
gearmanclient.addtaskhigh.php                      26-Sep-2022 04:10               11656
gearmanclient.addtaskhighbackground.php            26-Sep-2022 04:10                6084
gearmanclient.addtasklow.php                       26-Sep-2022 04:10               11636
gearmanclient.addtasklowbackground.php             26-Sep-2022 04:10                6092
gearmanclient.addtaskstatus.php                    26-Sep-2022 04:10               10156
gearmanclient.clearcallbacks.php                   26-Sep-2022 04:10                4592
gearmanclient.clone.php                            26-Sep-2022 04:10                2586
gearmanclient.construct.php                        26-Sep-2022 04:10                2844
gearmanclient.context.php                          26-Sep-2022 04:10                2900
gearmanclient.data.php                             26-Sep-2022 04:10                3164
gearmanclient.do.php                               26-Sep-2022 04:10               24237
gearmanclient.dobackground.php                     26-Sep-2022 04:10                9885
gearmanclient.dohigh.php                           26-Sep-2022 04:10                4788
gearmanclient.dohighbackground.php                 26-Sep-2022 04:10                4687
gearmanclient.dojobhandle.php                      26-Sep-2022 04:10                2954
gearmanclient.dolow.php                            26-Sep-2022 04:10                4787
gearmanclient.dolowbackground.php                  26-Sep-2022 04:10                4670
gearmanclient.donormal.php                         26-Sep-2022 04:10               24758
gearmanclient.dostatus.php                         26-Sep-2022 04:10                8897
gearmanclient.echo.php                             26-Sep-2022 04:10                2755
gearmanclient.error.php                            26-Sep-2022 04:10                2564
gearmanclient.geterrno.php                         26-Sep-2022 04:10                2607
gearmanclient.jobstatus.php                        26-Sep-2022 04:10                8754
gearmanclient.ping.php                             26-Sep-2022 04:10                2778
gearmanclient.removeoptions.php                    26-Sep-2022 04:10                2497
gearmanclient.returncode.php                       26-Sep-2022 04:10                2264
gearmanclient.runtasks.php                         26-Sep-2022 04:10                3599
gearmanclient.setclientcallback.php                26-Sep-2022 04:10                5624
gearmanclient.setcompletecallback.php              26-Sep-2022 04:10                4967
gearmanclient.setcontext.php                       26-Sep-2022 04:10                3131
gearmanclient.setcreatedcallback.php               26-Sep-2022 04:10                4900
gearmanclient.setdata.php                          26-Sep-2022 04:10                3305
gearmanclient.setdatacallback.php                  26-Sep-2022 04:10                4933
gearmanclient.setexceptioncallback.php             26-Sep-2022 04:10                4854
gearmanclient.setfailcallback.php                  26-Sep-2022 04:10                4932
gearmanclient.setoptions.php                       26-Sep-2022 04:10                2510
gearmanclient.setstatuscallback.php                26-Sep-2022 04:10                4947
gearmanclient.settimeout.php                       26-Sep-2022 04:10                2638
gearmanclient.setwarningcallback.php               26-Sep-2022 04:10                4946
gearmanclient.setworkloadcallback.php              26-Sep-2022 04:10                5151
gearmanclient.timeout.php                          26-Sep-2022 04:10                2834
gearmanclient.wait.php                             26-Sep-2022 04:10                2649
gearmanjob.complete.php                            26-Sep-2022 04:10                3478
gearmanjob.construct.php                           26-Sep-2022 04:10                2340
gearmanjob.data.php                                26-Sep-2022 04:10                3410
gearmanjob.exception.php                           26-Sep-2022 04:10                3638
gearmanjob.fail.php                                26-Sep-2022 04:10                3672
gearmanjob.functionname.php                        26-Sep-2022 04:10                2661
gearmanjob.handle.php                              26-Sep-2022 04:10                2549
gearmanjob.returncode.php                          26-Sep-2022 04:10                2619
gearmanjob.sendcomplete.php                        26-Sep-2022 04:10                3171
gearmanjob.senddata.php                            26-Sep-2022 04:10                3136
gearmanjob.sendexception.php                       26-Sep-2022 04:10                3355
gearmanjob.sendfail.php                            26-Sep-2022 04:10                3356
gearmanjob.sendstatus.php                          26-Sep-2022 04:10                3888
gearmanjob.sendwarning.php                         26-Sep-2022 04:10                3382
gearmanjob.setreturn.php                           26-Sep-2022 04:10                2470
gearmanjob.status.php                              26-Sep-2022 04:10                4166
gearmanjob.unique.php                              26-Sep-2022 04:10                2786
gearmanjob.warning.php                             26-Sep-2022 04:10                3637
gearmanjob.workload.php                            26-Sep-2022 04:10                2811
gearmanjob.workloadsize.php                        26-Sep-2022 04:10                2608
gearmantask.construct.php                          26-Sep-2022 04:10                2352
gearmantask.create.php                             26-Sep-2022 04:10                2608
gearmantask.data.php                               26-Sep-2022 04:10                2615
gearmantask.datasize.php                           26-Sep-2022 04:10                2638
gearmantask.function.php                           26-Sep-2022 04:10                2610
gearmantask.functionname.php                       26-Sep-2022 04:10                2296
gearmantask.isknown.php                            26-Sep-2022 04:10                2304
gearmantask.isrunning.php                          26-Sep-2022 04:10                2291
gearmantask.jobhandle.php                          26-Sep-2022 04:10                2706
gearmantask.recvdata.php                           26-Sep-2022 04:10                3264
gearmantask.returncode.php                         26-Sep-2022 04:10                2640
gearmantask.senddata.php                           26-Sep-2022 04:10                3189
gearmantask.sendworkload.php                       26-Sep-2022 04:10                3224
gearmantask.taskdenominator.php                    26-Sep-2022 04:10                2861
gearmantask.tasknumerator.php                      26-Sep-2022 04:10                2825
gearmantask.unique.php                             26-Sep-2022 04:10                3066
gearmantask.uuid.php                               26-Sep-2022 04:10                3349
gearmanworker.addfunction.php                      26-Sep-2022 04:10                8078
gearmanworker.addoptions.php                       26-Sep-2022 04:10                3297
gearmanworker.addserver.php                        26-Sep-2022 04:10                4689
gearmanworker.addservers.php                       26-Sep-2022 04:10                4223
gearmanworker.clone.php                            26-Sep-2022 04:10                2275
gearmanworker.construct.php                        26-Sep-2022 04:10                2811
gearmanworker.echo.php                             26-Sep-2022 04:10                3013
gearmanworker.error.php                            26-Sep-2022 04:10                2571
gearmanworker.geterrno.php                         26-Sep-2022 04:10                2616
gearmanworker.options.php                          26-Sep-2022 04:10                2646
gearmanworker.register.php                         26-Sep-2022 04:10                3782
gearmanworker.removeoptions.php                    26-Sep-2022 04:10                3330
gearmanworker.returncode.php                       26-Sep-2022 04:10                2856
gearmanworker.setid.php                            26-Sep-2022 04:10                3919
gearmanworker.setoptions.php                       26-Sep-2022 04:10                3505
gearmanworker.settimeout.php                       26-Sep-2022 04:10                8364
gearmanworker.timeout.php                          26-Sep-2022 04:10                2808
gearmanworker.unregister.php                       26-Sep-2022 04:10                3365
gearmanworker.unregisterall.php                    26-Sep-2022 04:10                3069
gearmanworker.wait.php                             26-Sep-2022 04:10                8533
gearmanworker.work.php                             26-Sep-2022 04:10                5377
gender-gender.connect.php                          26-Sep-2022 04:10                2483
gender-gender.construct.php                        26-Sep-2022 04:10                2538
gender-gender.country.php                          26-Sep-2022 04:10                3554
gender-gender.get.php                              26-Sep-2022 04:10                2714
gender-gender.isnick.php                           26-Sep-2022 04:10                3072
gender-gender.similarnames.php                     26-Sep-2022 04:10                2796
gender.example.admin.php                           26-Sep-2022 04:10                9374
gender.examples.php                                26-Sep-2022 04:10                1342
gender.installation.php                            26-Sep-2022 04:10                2025
gender.setup.php                                   26-Sep-2022 04:10                1389
generator.current.php                              26-Sep-2022 04:10                2134
generator.getreturn.php                            26-Sep-2022 04:10                3983
generator.key.php                                  26-Sep-2022 04:10                3965
generator.next.php                                 26-Sep-2022 04:10                2350
generator.rewind.php                               26-Sep-2022 04:10                2139
generator.send.php                                 26-Sep-2022 04:10                5729
generator.throw.php                                26-Sep-2022 04:10                5984
generator.valid.php                                26-Sep-2022 04:10                2135
generator.wakeup.php                               26-Sep-2022 04:10                2163
geoip.configuration.php                            26-Sep-2022 04:10                2338
geoip.constants.php                                26-Sep-2022 04:10                4543
geoip.installation.php                             26-Sep-2022 04:10                1780
geoip.requirements.php                             26-Sep-2022 04:10                1759
geoip.resources.php                                26-Sep-2022 04:10                1219
geoip.setup.php                                    26-Sep-2022 04:10                1603
gettext.configuration.php                          26-Sep-2022 04:10                1301
gettext.constants.php                              26-Sep-2022 04:10                1149
gettext.installation.php                           26-Sep-2022 04:10                1448
gettext.requirements.php                           26-Sep-2022 04:10                1391
gettext.resources.php                              26-Sep-2022 04:10                1233
gettext.setup.php                                  26-Sep-2022 04:10                1640
getting-started.php                                26-Sep-2022 04:10                1990
globiterator.construct.php                         26-Sep-2022 04:10                6565
globiterator.count.php                             26-Sep-2022 04:10                4427
gmagick.addimage.php                               26-Sep-2022 04:10                2897
gmagick.addnoiseimage.php                          26-Sep-2022 04:10                2846
gmagick.annotateimage.php                          26-Sep-2022 04:10                4075
gmagick.blurimage.php                              26-Sep-2022 04:10                3088
gmagick.borderimage.php                            26-Sep-2022 04:10                3397
gmagick.charcoalimage.php                          26-Sep-2022 04:10                3050
gmagick.chopimage.php                              26-Sep-2022 04:10                3601
gmagick.clear.php                                  26-Sep-2022 04:10                2432
gmagick.commentimage.php                           26-Sep-2022 04:10                2723
gmagick.compositeimage.php                         26-Sep-2022 04:10                3736
gmagick.configuration.php                          26-Sep-2022 04:10                1307
gmagick.constants.php                              26-Sep-2022 04:10               68506
gmagick.construct.php                              26-Sep-2022 04:10                2680
gmagick.cropimage.php                              26-Sep-2022 04:10                3744
gmagick.cropthumbnailimage.php                     26-Sep-2022 04:10                3106
gmagick.current.php                                26-Sep-2022 04:10                2539
gmagick.cyclecolormapimage.php                     26-Sep-2022 04:10                2970
gmagick.deconstructimages.php                      26-Sep-2022 04:10                2792
gmagick.despeckleimage.php                         26-Sep-2022 04:10                3674
gmagick.destroy.php                                26-Sep-2022 04:10                2299
gmagick.drawimage.php                              26-Sep-2022 04:10                2811
gmagick.edgeimage.php                              26-Sep-2022 04:10                2813
gmagick.embossimage.php                            26-Sep-2022 04:10                3287
gmagick.enhanceimage.php                           26-Sep-2022 04:10                2333
gmagick.equalizeimage.php                          26-Sep-2022 04:10                2297
gmagick.examples.php                               26-Sep-2022 04:10                3770
gmagick.flipimage.php                              26-Sep-2022 04:10                2300
gmagick.flopimage.php                              26-Sep-2022 04:10                2299
gmagick.frameimage.php                             26-Sep-2022 04:10                4218
gmagick.gammaimage.php                             26-Sep-2022 04:10                3060
gmagick.getcopyright.php                           26-Sep-2022 04:10                2380
gmagick.getfilename.php                            26-Sep-2022 04:10                2317
gmagick.getimagebackgroundcolor.php                26-Sep-2022 04:10                2681
gmagick.getimageblueprimary.php                    26-Sep-2022 04:10                2962
gmagick.getimagebordercolor.php                    26-Sep-2022 04:10                2635
gmagick.getimagechanneldepth.php                   26-Sep-2022 04:10                2699
gmagick.getimagecolors.php                         26-Sep-2022 04:10                2537
gmagick.getimagecolorspace.php                     26-Sep-2022 04:10                2513
gmagick.getimagecompose.php                        26-Sep-2022 04:10                2552
gmagick.getimagedelay.php                          26-Sep-2022 04:10                2470
gmagick.getimagedepth.php                          26-Sep-2022 04:10                2449
gmagick.getimagedispose.php                        26-Sep-2022 04:10                2517
gmagick.getimageextrema.php                        26-Sep-2022 04:10                2687
gmagick.getimagefilename.php                       26-Sep-2022 04:10                2596
gmagick.getimageformat.php                         26-Sep-2022 04:10                2570
gmagick.getimagegamma.php                          26-Sep-2022 04:10                2489
gmagick.getimagegreenprimary.php                   26-Sep-2022 04:10                2681
gmagick.getimageheight.php                         26-Sep-2022 04:10                2482
gmagick.getimagehistogram.php                      26-Sep-2022 04:10                2657
gmagick.getimageindex.php                          26-Sep-2022 04:10                2533
gmagick.getimageinterlacescheme.php                26-Sep-2022 04:10                2646
gmagick.getimageiterations.php                     26-Sep-2022 04:10                2551
gmagick.getimagematte.php                          26-Sep-2022 04:10                2662
gmagick.getimagemattecolor.php                     26-Sep-2022 04:10                2664
gmagick.getimageprofile.php                        26-Sep-2022 04:10                2634
gmagick.getimageredprimary.php                     26-Sep-2022 04:10                2704
gmagick.getimagerenderingintent.php                26-Sep-2022 04:10                2648
gmagick.getimageresolution.php                     26-Sep-2022 04:10                2547
gmagick.getimagescene.php                          26-Sep-2022 04:10                2460
gmagick.getimagesignature.php                      26-Sep-2022 04:10                2567
gmagick.getimagetype.php                           26-Sep-2022 04:10                2457
gmagick.getimageunits.php                          26-Sep-2022 04:10                2228
gmagick.getimagewhitepoint.php                     26-Sep-2022 04:10                2668
gmagick.getimagewidth.php                          26-Sep-2022 04:10                2445
gmagick.getpackagename.php                         26-Sep-2022 04:10                2521
gmagick.getquantumdepth.php                        26-Sep-2022 04:10                2564
gmagick.getreleasedate.php                         26-Sep-2022 04:10                2574
gmagick.getsamplingfactors.php                     26-Sep-2022 04:10                2584
gmagick.getsize.php                                26-Sep-2022 04:10                2617
gmagick.getversion.php                             26-Sep-2022 04:10                2501
gmagick.hasnextimage.php                           26-Sep-2022 04:10                2723
gmagick.haspreviousimage.php                       26-Sep-2022 04:10                2755
gmagick.implodeimage.php                           26-Sep-2022 04:10                2895
gmagick.installation.php                           26-Sep-2022 04:10                2036
gmagick.labelimage.php                             26-Sep-2022 04:10                2732
gmagick.levelimage.php                             26-Sep-2022 04:10                4581
gmagick.magnifyimage.php                           26-Sep-2022 04:10                2564
gmagick.mapimage.php                               26-Sep-2022 04:10                3159
gmagick.medianfilterimage.php                      26-Sep-2022 04:10                2927
gmagick.minifyimage.php                            26-Sep-2022 04:10                2575
gmagick.modulateimage.php                          26-Sep-2022 04:10                3713
gmagick.motionblurimage.php                        26-Sep-2022 04:10                3667
gmagick.newimage.php                               26-Sep-2022 04:10                3646
gmagick.nextimage.php                              26-Sep-2022 04:10                2520
gmagick.normalizeimage.php                         26-Sep-2022 04:10                2901
gmagick.oilpaintimage.php                          26-Sep-2022 04:10                2985
gmagick.previousimage.php                          26-Sep-2022 04:10                2575
gmagick.profileimage.php                           26-Sep-2022 04:10                3227
gmagick.quantizeimage.php                          26-Sep-2022 04:10                5329
gmagick.quantizeimages.php                         26-Sep-2022 04:10                5350
gmagick.queryfontmetrics.php                       26-Sep-2022 04:10                2823
gmagick.queryfonts.php                             26-Sep-2022 04:10                2582
gmagick.queryformats.php                           26-Sep-2022 04:10                2793
gmagick.radialblurimage.php                        26-Sep-2022 04:10                3093
gmagick.raiseimage.php                             26-Sep-2022 04:10                4088
gmagick.read.php                                   26-Sep-2022 04:10                2660
gmagick.readimage.php                              26-Sep-2022 04:10                2711
gmagick.readimageblob.php                          26-Sep-2022 04:10                3072
gmagick.readimagefile.php                          26-Sep-2022 04:10                2954
gmagick.reducenoiseimage.php                       26-Sep-2022 04:10                3100
gmagick.removeimage.php                            26-Sep-2022 04:10                2516
gmagick.removeimageprofile.php                     26-Sep-2022 04:10                2808
gmagick.requirements.php                           26-Sep-2022 04:10                1747
gmagick.resampleimage.php                          26-Sep-2022 04:10                3761
gmagick.resizeimage.php                            26-Sep-2022 04:10                3856
gmagick.rollimage.php                              26-Sep-2022 04:10                2908
gmagick.rotateimage.php                            26-Sep-2022 04:10                3195
gmagick.scaleimage.php                             26-Sep-2022 04:10                3245
gmagick.separateimagechannel.php                   26-Sep-2022 04:10                3067
gmagick.setcompressionquality.php                  26-Sep-2022 04:10                4120
gmagick.setfilename.php                            26-Sep-2022 04:10                2846
gmagick.setimagebackgroundcolor.php                26-Sep-2022 04:10                2956
gmagick.setimageblueprimary.php                    26-Sep-2022 04:10                3144
gmagick.setimagebordercolor.php                    26-Sep-2022 04:10                2922
gmagick.setimagechanneldepth.php                   26-Sep-2022 04:10                3291
gmagick.setimagecolorspace.php                     26-Sep-2022 04:10                3139
gmagick.setimagecompose.php                        26-Sep-2022 04:10                2829
gmagick.setimagedelay.php                          26-Sep-2022 04:10                2767
gmagick.setimagedepth.php                          26-Sep-2022 04:10                2786
gmagick.setimagedispose.php                        26-Sep-2022 04:10                2826
gmagick.setimagefilename.php                       26-Sep-2022 04:10                2881
gmagick.setimageformat.php                         26-Sep-2022 04:10                2818
gmagick.setimagegamma.php                          26-Sep-2022 04:10                2769
gmagick.setimagegreenprimary.php                   26-Sep-2022 04:10                3165
gmagick.setimageindex.php                          26-Sep-2022 04:10                2899
gmagick.setimageinterlacescheme.php                26-Sep-2022 04:10                2996
gmagick.setimageiterations.php                     26-Sep-2022 04:10                2862
gmagick.setimageprofile.php                        26-Sep-2022 04:10                3269
gmagick.setimageredprimary.php                     26-Sep-2022 04:10                3125
gmagick.setimagerenderingintent.php                26-Sep-2022 04:10                3036
gmagick.setimageresolution.php                     26-Sep-2022 04:10                3117
gmagick.setimagescene.php                          26-Sep-2022 04:10                2764
gmagick.setimagetype.php                           26-Sep-2022 04:10                2929
gmagick.setimageunits.php                          26-Sep-2022 04:10                2895
gmagick.setimagewhitepoint.php                     26-Sep-2022 04:10                3077
gmagick.setsamplingfactors.php                     26-Sep-2022 04:10                2930
gmagick.setsize.php                                26-Sep-2022 04:10                3021
gmagick.setup.php                                  26-Sep-2022 04:10                1560
gmagick.shearimage.php                             26-Sep-2022 04:10                3886
gmagick.solarizeimage.php                          26-Sep-2022 04:10                3030
gmagick.spreadimage.php                            26-Sep-2022 04:10                2863
gmagick.stripimage.php                             26-Sep-2022 04:10                2500
gmagick.swirlimage.php                             26-Sep-2022 04:10                2943
gmagick.thumbnailimage.php                         26-Sep-2022 04:10                3597
gmagick.trimimage.php                              26-Sep-2022 04:10                3058
gmagick.write.php                                  26-Sep-2022 04:10                1693
gmagick.writeimage.php                             26-Sep-2022 04:10                3019
gmagickdraw.annotate.php                           26-Sep-2022 04:10                2969
gmagickdraw.arc.php                                26-Sep-2022 04:10                3986
gmagickdraw.bezier.php                             26-Sep-2022 04:10                2509
gmagickdraw.ellipse.php                            26-Sep-2022 04:10                3872
gmagickdraw.getfillcolor.php                       26-Sep-2022 04:10                2415
gmagickdraw.getfillopacity.php                     26-Sep-2022 04:10                2359
gmagickdraw.getfont.php                            26-Sep-2022 04:10                2409
gmagickdraw.getfontsize.php                        26-Sep-2022 04:10                2302
gmagickdraw.getfontstyle.php                       26-Sep-2022 04:10                2343
gmagickdraw.getfontweight.php                      26-Sep-2022 04:10                2314
gmagickdraw.getstrokecolor.php                     26-Sep-2022 04:10                2491
gmagickdraw.getstrokeopacity.php                   26-Sep-2022 04:10                2360
gmagickdraw.getstrokewidth.php                     26-Sep-2022 04:10                2377
gmagickdraw.gettextdecoration.php                  26-Sep-2022 04:10                2363
gmagickdraw.gettextencoding.php                    26-Sep-2022 04:10                2568
gmagickdraw.line.php                               26-Sep-2022 04:10                3384
gmagickdraw.point.php                              26-Sep-2022 04:10                2754
gmagickdraw.polygon.php                            26-Sep-2022 04:10                2590
gmagickdraw.polyline.php                           26-Sep-2022 04:10                2622
gmagickdraw.rectangle.php                          26-Sep-2022 04:10                3422
gmagickdraw.rotate.php                             26-Sep-2022 04:10                2550
gmagickdraw.roundrectangle.php                     26-Sep-2022 04:10                4119
gmagickdraw.scale.php                              26-Sep-2022 04:10                2796
gmagickdraw.setfillcolor.php                       26-Sep-2022 04:10                2965
gmagickdraw.setfillopacity.php                     26-Sep-2022 04:10                2696
gmagickdraw.setfont.php                            26-Sep-2022 04:10                2581
gmagickdraw.setfontsize.php                        26-Sep-2022 04:10                2617
gmagickdraw.setfontstyle.php                       26-Sep-2022 04:10                2740
gmagickdraw.setfontweight.php                      26-Sep-2022 04:10                2599
gmagickdraw.setstrokecolor.php                     26-Sep-2022 04:10                2985
gmagickdraw.setstrokeopacity.php                   26-Sep-2022 04:10                2697
gmagickdraw.setstrokewidth.php                     26-Sep-2022 04:10                2666
gmagickdraw.settextdecoration.php                  26-Sep-2022 04:10                2730
gmagickdraw.settextencoding.php                    26-Sep-2022 04:10                3041
gmagickpixel.construct.php                         26-Sep-2022 04:10                2612
gmagickpixel.getcolor.php                          26-Sep-2022 04:10                3552
gmagickpixel.getcolorcount.php                     26-Sep-2022 04:10                2399
gmagickpixel.getcolorvalue.php                     26-Sep-2022 04:10                2740
gmagickpixel.setcolor.php                          26-Sep-2022 04:10                2718
gmagickpixel.setcolorvalue.php                     26-Sep-2022 04:10                3064
gmp.configuration.php                              26-Sep-2022 04:10                1273
gmp.constants.php                                  26-Sep-2022 04:10                2123
gmp.examples.php                                   26-Sep-2022 04:10                3242
gmp.installation.php                               26-Sep-2022 04:10                1368
gmp.requirements.php                               26-Sep-2022 04:10                1680
gmp.resources.php                                  26-Sep-2022 04:10                1423
gmp.setup.php                                      26-Sep-2022 04:10                1593
gnupg.configuration.php                            26-Sep-2022 04:10                1285
gnupg.constants.php                                26-Sep-2022 04:10                6455
gnupg.examples-clearsign.php                       26-Sep-2022 04:10                6984
gnupg.examples.php                                 26-Sep-2022 04:10                1366
gnupg.installation.php                             26-Sep-2022 04:10                1631
gnupg.requirements.php                             26-Sep-2022 04:10                1432
gnupg.resources.php                                26-Sep-2022 04:10                1219
gnupg.setup.php                                    26-Sep-2022 04:10                1614
hash.configuration.php                             26-Sep-2022 04:10                1280
hash.constants.php                                 26-Sep-2022 04:10                1681
hash.installation.php                              26-Sep-2022 04:10                1575
hash.requirements.php                              26-Sep-2022 04:10                1235
hash.resources.php                                 26-Sep-2022 04:10                1328
hash.setup.php                                     26-Sep-2022 04:10                1600
history.php                                        26-Sep-2022 04:11                2267
history.php.books.php                              26-Sep-2022 04:11                2654
history.php.php                                    26-Sep-2022 04:11               11716
history.php.publications.php                       26-Sep-2022 04:11                1810
history.php.related.php                            26-Sep-2022 04:11                6289
hrtime-performancecounter.getfrequency.php         26-Sep-2022 04:10                2653
hrtime-performancecounter.getticks.php             26-Sep-2022 04:10                2471
hrtime-performancecounter.gettickssince.php        26-Sep-2022 04:10                2726
hrtime-stopwatch.getelapsedticks.php               26-Sep-2022 04:10                2373
hrtime-stopwatch.getelapsedtime.php                26-Sep-2022 04:10                2817
hrtime-stopwatch.getlastelapsedticks.php           26-Sep-2022 04:10                2441
hrtime-stopwatch.getlastelapsedtime.php            26-Sep-2022 04:10                2831
hrtime-stopwatch.isrunning.php                     26-Sep-2022 04:10                2332
hrtime-stopwatch.start.php                         26-Sep-2022 04:10                2326
hrtime-stopwatch.stop.php                          26-Sep-2022 04:10                2205
hrtime.example.basic.php                           26-Sep-2022 04:10                6056
hrtime.examples.php                                26-Sep-2022 04:10                1346
hrtime.installation.php                            26-Sep-2022 04:10                2000
hrtime.setup.php                                   26-Sep-2022 04:10                1390
ibase.configuration.php                            26-Sep-2022 04:10                7323
ibase.constants.php                                26-Sep-2022 04:10               16763
ibase.installation.php                             26-Sep-2022 04:10                2841
ibase.requirements.php                             26-Sep-2022 04:10                1215
ibase.resources.php                                26-Sep-2022 04:10                1219
ibase.setup.php                                    26-Sep-2022 04:10                1637
ibm-db2.configuration.php                          26-Sep-2022 04:10                9192
ibm-db2.constants.php                              26-Sep-2022 04:10                7087
ibm-db2.installation.php                           26-Sep-2022 04:10                3718
ibm-db2.requirements.php                           26-Sep-2022 04:10                3221
ibm-db2.resources.php                              26-Sep-2022 04:10                1298
ibm-db2.setup.php                                  26-Sep-2022 04:10                1648
iconv.configuration.php                            26-Sep-2022 04:10                4756
iconv.constants.php                                26-Sep-2022 04:10                3326
iconv.installation.php                             26-Sep-2022 04:10                2159
iconv.requirements.php                             26-Sep-2022 04:10                1540
iconv.resources.php                                26-Sep-2022 04:10                1219
iconv.setup.php                                    26-Sep-2022 04:10                1622
igbinary.configuration.php                         26-Sep-2022 04:10                3377
igbinary.installation.php                          26-Sep-2022 04:10                2052
igbinary.requirements.php                          26-Sep-2022 04:10                1236
igbinary.setup.php                                 26-Sep-2022 04:10                1567
image.configuration.php                            26-Sep-2022 04:10                3445
image.constants.php                                26-Sep-2022 04:10               40082
image.examples-png.php                             26-Sep-2022 04:10                4966
image.examples-watermark.php                       26-Sep-2022 04:10                6374
image.examples.merged-watermark.php                26-Sep-2022 04:10                9547
image.examples.php                                 26-Sep-2022 04:10                1613
image.installation.php                             26-Sep-2022 04:10                5298
image.requirements.php                             26-Sep-2022 04:10                5586
image.resources.php                                26-Sep-2022 04:10                2644
image.setup.php                                    26-Sep-2022 04:10                1627
imagick.adaptiveblurimage.php                      26-Sep-2022 04:10                6854
imagick.adaptiveresizeimage.php                    26-Sep-2022 04:10                9117
imagick.adaptivesharpenimage.php                   26-Sep-2022 04:10                6349
imagick.adaptivethresholdimage.php                 26-Sep-2022 04:10                6106
imagick.addimage.php                               26-Sep-2022 04:10                2836
imagick.addnoiseimage.php                          26-Sep-2022 04:10                5450
imagick.affinetransformimage.php                   26-Sep-2022 04:10                6956
imagick.animateimages.php                          26-Sep-2022 04:10                3023
imagick.annotateimage.php                          26-Sep-2022 04:10                8762
imagick.appendimages.php                           26-Sep-2022 04:10                6806
imagick.autolevelimage.php                         26-Sep-2022 04:10                4367
imagick.averageimages.php                          26-Sep-2022 04:10                2260
imagick.blackthresholdimage.php                    26-Sep-2022 04:10                5411
imagick.blueshiftimage.php                         26-Sep-2022 04:10                4436
imagick.blurimage.php                              26-Sep-2022 04:10                5711
imagick.borderimage.php                            26-Sep-2022 04:10                6037
imagick.brightnesscontrastimage.php                26-Sep-2022 04:10                5488
imagick.charcoalimage.php                          26-Sep-2022 04:10                4898
imagick.chopimage.php                              26-Sep-2022 04:10                6948
imagick.clampimage.php                             26-Sep-2022 04:10                2443
imagick.clear.php                                  26-Sep-2022 04:10                1936
imagick.clipimage.php                              26-Sep-2022 04:10                2188
imagick.clipimagepath.php                          26-Sep-2022 04:10                2958
imagick.clippathimage.php                          26-Sep-2022 04:10                3332
imagick.clone.php                                  26-Sep-2022 04:10                4081
imagick.clutimage.php                              26-Sep-2022 04:10                6072
imagick.coalesceimages.php                         26-Sep-2022 04:10                2617
imagick.colorfloodfillimage.php                    26-Sep-2022 04:10                5360
imagick.colorizeimage.php                          26-Sep-2022 04:10                7024
imagick.colormatriximage.php                       26-Sep-2022 04:10                8395
imagick.combineimages.php                          26-Sep-2022 04:10                3267
imagick.commentimage.php                           26-Sep-2022 04:10                4980
imagick.compareimagechannels.php                   26-Sep-2022 04:10                3816
imagick.compareimagelayers.php                     26-Sep-2022 04:10                5645
imagick.compareimages.php                          26-Sep-2022 04:10                5633
imagick.compositeimage.php                         26-Sep-2022 04:10                7909
imagick.configuration.php                          26-Sep-2022 04:10                4193
imagick.constants.php                              26-Sep-2022 04:10              104875
imagick.construct.php                              26-Sep-2022 04:10                2811
imagick.contrastimage.php                          26-Sep-2022 04:10                5094
imagick.contraststretchimage.php                   26-Sep-2022 04:10                3672
imagick.convolveimage.php                          26-Sep-2022 04:10                5992
imagick.count.php                                  26-Sep-2022 04:10                2576
imagick.cropimage.php                              26-Sep-2022 04:10                5989
imagick.cropthumbnailimage.php                     26-Sep-2022 04:10                3192
imagick.current.php                                26-Sep-2022 04:10                2251
imagick.cyclecolormapimage.php                     26-Sep-2022 04:10                2861
imagick.decipherimage.php                          26-Sep-2022 04:10                3112
imagick.deconstructimages.php                      26-Sep-2022 04:10                2412
imagick.deleteimageartifact.php                    26-Sep-2022 04:10                3570
imagick.deleteimageproperty.php                    26-Sep-2022 04:10                2450
imagick.deskewimage.php                            26-Sep-2022 04:10               11718
imagick.despeckleimage.php                         26-Sep-2022 04:10                4034
imagick.destroy.php                                26-Sep-2022 04:10                2059
imagick.displayimage.php                           26-Sep-2022 04:10                2627
imagick.displayimages.php                          26-Sep-2022 04:10                2691
imagick.distortimage.php                           26-Sep-2022 04:10               13080
imagick.drawimage.php                              26-Sep-2022 04:10                2519
imagick.edgeimage.php                              26-Sep-2022 04:10                4626
imagick.embossimage.php                            26-Sep-2022 04:10                5313
imagick.encipherimage.php                          26-Sep-2022 04:10                3111
imagick.enhanceimage.php                           26-Sep-2022 04:10                4006
imagick.equalizeimage.php                          26-Sep-2022 04:10                3977
imagick.evaluateimage.php                          26-Sep-2022 04:10                5802
imagick.examples-1.php                             26-Sep-2022 04:10               33338
imagick.examples.php                               26-Sep-2022 04:10                1356
imagick.exportimagepixels.php                      26-Sep-2022 04:10                7772
imagick.extentimage.php                            26-Sep-2022 04:10                5131
imagick.filter.php                                 26-Sep-2022 04:10                7883
imagick.flattenimages.php                          26-Sep-2022 04:10                2279
imagick.flipimage.php                              26-Sep-2022 04:10                3979
imagick.floodfillpaintimage.php                    26-Sep-2022 04:10               11858
imagick.flopimage.php                              26-Sep-2022 04:10                4013
imagick.forwardfouriertransformimage.php           26-Sep-2022 04:10               12989
imagick.frameimage.php                             26-Sep-2022 04:10                8535
imagick.functionimage.php                          26-Sep-2022 04:10               13741
imagick.fximage.php                                26-Sep-2022 04:10                6150
imagick.gammaimage.php                             26-Sep-2022 04:10                5693
imagick.gaussianblurimage.php                      26-Sep-2022 04:10                6175
imagick.getcolorspace.php                          26-Sep-2022 04:10                2168
imagick.getcompression.php                         26-Sep-2022 04:10                1991
imagick.getcompressionquality.php                  26-Sep-2022 04:10                2076
imagick.getcopyright.php                           26-Sep-2022 04:10                2078
imagick.getfilename.php                            26-Sep-2022 04:10                2166
imagick.getfont.php                                26-Sep-2022 04:10                2862
imagick.getformat.php                              26-Sep-2022 04:10                2105
imagick.getgravity.php                             26-Sep-2022 04:10                2153
imagick.gethomeurl.php                             26-Sep-2022 04:10                1944
imagick.getimage.php                               26-Sep-2022 04:10                2228
imagick.getimagealphachannel.php                   26-Sep-2022 04:10                2649
imagick.getimageartifact.php                       26-Sep-2022 04:10                3528
imagick.getimageattribute.php                      26-Sep-2022 04:10                2690
imagick.getimagebackgroundcolor.php                26-Sep-2022 04:10                2377
imagick.getimageblob.php                           26-Sep-2022 04:10                2448
imagick.getimageblueprimary.php                    26-Sep-2022 04:10                2858
imagick.getimagebordercolor.php                    26-Sep-2022 04:10                2346
imagick.getimagechanneldepth.php                   26-Sep-2022 04:10                3029
imagick.getimagechanneldistortion.php              26-Sep-2022 04:10                3924
imagick.getimagechanneldistortions.php             26-Sep-2022 04:10                4261
imagick.getimagechannelextrema.php                 26-Sep-2022 04:10                3556
imagick.getimagechannelkurtosis.php                26-Sep-2022 04:10                3563
imagick.getimagechannelmean.php                    26-Sep-2022 04:10                3168
imagick.getimagechannelrange.php                   26-Sep-2022 04:10                3338
imagick.getimagechannelstatistics.php              26-Sep-2022 04:10                2327
imagick.getimageclipmask.php                       26-Sep-2022 04:10                2528
imagick.getimagecolormapcolor.php                  26-Sep-2022 04:10                2877
imagick.getimagecolors.php                         26-Sep-2022 04:10                2044
imagick.getimagecolorspace.php                     26-Sep-2022 04:10                2126
imagick.getimagecompose.php                        26-Sep-2022 04:10                2063
imagick.getimagecompression.php                    26-Sep-2022 04:10                2064
imagick.getimagecompressionquality.php             26-Sep-2022 04:10                2184
imagick.getimagedelay.php                          26-Sep-2022 04:10                2164
imagick.getimagedepth.php                          26-Sep-2022 04:10                1945
imagick.getimagedispose.php                        26-Sep-2022 04:10                2221
imagick.getimagedistortion.php                     26-Sep-2022 04:10                3220
imagick.getimageextrema.php                        26-Sep-2022 04:10                2334
imagick.getimagefilename.php                       26-Sep-2022 04:10                2288
imagick.getimageformat.php                         26-Sep-2022 04:10                2262
imagick.getimagegamma.php                          26-Sep-2022 04:10                2178
imagick.getimagegeometry.php                       26-Sep-2022 04:10                3836
imagick.getimagegravity.php                        26-Sep-2022 04:10                2478
imagick.getimagegreenprimary.php                   26-Sep-2022 04:10                2420
imagick.getimageheight.php                         26-Sep-2022 04:10                2175
imagick.getimagehistogram.php                      26-Sep-2022 04:10               19557
imagick.getimageindex.php                          26-Sep-2022 04:10                2437
imagick.getimageinterlacescheme.php                26-Sep-2022 04:10                2250
imagick.getimageinterpolatemethod.php              26-Sep-2022 04:10                2446
imagick.getimageiterations.php                     26-Sep-2022 04:10                2255
imagick.getimagelength.php                         26-Sep-2022 04:10                3168
imagick.getimagematte.php                          26-Sep-2022 04:10                2236
imagick.getimagemattecolor.php                     26-Sep-2022 04:10                2294
imagick.getimagemimetype.php                       26-Sep-2022 04:10                2174
imagick.getimageorientation.php                    26-Sep-2022 04:10                2359
imagick.getimagepage.php                           26-Sep-2022 04:10                2415
imagick.getimagepixelcolor.php                     26-Sep-2022 04:10                3033
imagick.getimageprofile.php                        26-Sep-2022 04:10                2702
imagick.getimageprofiles.php                       26-Sep-2022 04:10                3216
imagick.getimageproperties.php                     26-Sep-2022 04:10                5705
imagick.getimageproperty.php                       26-Sep-2022 04:10                4905
imagick.getimageredprimary.php                     26-Sep-2022 04:10                2491
imagick.getimageregion.php                         26-Sep-2022 04:10                3757
imagick.getimagerenderingintent.php                26-Sep-2022 04:10                2400
imagick.getimageresolution.php                     26-Sep-2022 04:10                2238
imagick.getimagesblob.php                          26-Sep-2022 04:10                2288
imagick.getimagescene.php                          26-Sep-2022 04:10                2143
imagick.getimagesignature.php                      26-Sep-2022 04:10                2263
imagick.getimagesize.php                           26-Sep-2022 04:10                2129
imagick.getimagetickspersecond.php                 26-Sep-2022 04:10                2287
imagick.getimagetotalinkdensity.php                26-Sep-2022 04:10                2206
imagick.getimagetype.php                           26-Sep-2022 04:10                3770
imagick.getimageunits.php                          26-Sep-2022 04:10                2217
imagick.getimagevirtualpixelmethod.php             26-Sep-2022 04:10                2339
imagick.getimagewhitepoint.php                     26-Sep-2022 04:10                2393
imagick.getimagewidth.php                          26-Sep-2022 04:10                2154
imagick.getinterlacescheme.php                     26-Sep-2022 04:10                2336
imagick.getiteratorindex.php                       26-Sep-2022 04:10                5974
imagick.getnumberimages.php                        26-Sep-2022 04:10                2237
imagick.getoption.php                              26-Sep-2022 04:10                2664
imagick.getpackagename.php                         26-Sep-2022 04:10                2191
imagick.getpage.php                                26-Sep-2022 04:10                2273
imagick.getpixeliterator.php                       26-Sep-2022 04:10                6638
imagick.getpixelregioniterator.php                 26-Sep-2022 04:10                6813
imagick.getpointsize.php                           26-Sep-2022 04:10                2517
imagick.getquantum.php                             26-Sep-2022 04:10                2141
imagick.getquantumdepth.php                        26-Sep-2022 04:10                2229
imagick.getquantumrange.php                        26-Sep-2022 04:10                2442
imagick.getregistry.php                            26-Sep-2022 04:10                2366
imagick.getreleasedate.php                         26-Sep-2022 04:10                2230
imagick.getresource.php                            26-Sep-2022 04:10                2743
imagick.getresourcelimit.php                       26-Sep-2022 04:10                2769
imagick.getsamplingfactors.php                     26-Sep-2022 04:10                2287
imagick.getsize.php                                26-Sep-2022 04:10                2136
imagick.getsizeoffset.php                          26-Sep-2022 04:10                2290
imagick.getversion.php                             26-Sep-2022 04:10                2208
imagick.haldclutimage.php                          26-Sep-2022 04:10                6108
imagick.hasnextimage.php                           26-Sep-2022 04:10                2227
imagick.haspreviousimage.php                       26-Sep-2022 04:10                2249
imagick.identifyformat.php                         26-Sep-2022 04:10                4485
imagick.identifyimage.php                          26-Sep-2022 04:10                3721
imagick.implodeimage.php                           26-Sep-2022 04:10                4633
imagick.importimagepixels.php                      26-Sep-2022 04:10               11924
imagick.installation.php                           26-Sep-2022 04:10                2216
imagick.inversefouriertransformimage.php           26-Sep-2022 04:10                3298
imagick.labelimage.php                             26-Sep-2022 04:10                2430
imagick.levelimage.php                             26-Sep-2022 04:10                7819
imagick.linearstretchimage.php                     26-Sep-2022 04:10                5673
imagick.liquidrescaleimage.php                     26-Sep-2022 04:10                4283
imagick.listregistry.php                           26-Sep-2022 04:10                2283
imagick.magnifyimage.php                           26-Sep-2022 04:10                4014
imagick.mapimage.php                               26-Sep-2022 04:10                3096
imagick.mattefloodfillimage.php                    26-Sep-2022 04:10                5586
imagick.medianfilterimage.php                      26-Sep-2022 04:10                5140
imagick.mergeimagelayers.php                       26-Sep-2022 04:10                6586
imagick.minifyimage.php                            26-Sep-2022 04:10                2057
imagick.modulateimage.php                          26-Sep-2022 04:10                5556
imagick.montageimage.php                           26-Sep-2022 04:10                4293
imagick.morphimages.php                            26-Sep-2022 04:10                2774
imagick.morphology.php                             26-Sep-2022 04:10               75791
imagick.mosaicimages.php                           26-Sep-2022 04:10                2200
imagick.motionblurimage.php                        26-Sep-2022 04:10                6705
imagick.negateimage.php                            26-Sep-2022 04:10                5563
imagick.newimage.php                               26-Sep-2022 04:10                6158
imagick.newpseudoimage.php                         26-Sep-2022 04:10                5727
imagick.nextimage.php                              26-Sep-2022 04:10                1982
imagick.normalizeimage.php                         26-Sep-2022 04:10                6517
imagick.oilpaintimage.php                          26-Sep-2022 04:10                4576
imagick.opaquepaintimage.php                       26-Sep-2022 04:10                4779
imagick.optimizeimagelayers.php                    26-Sep-2022 04:10                5247
imagick.orderedposterizeimage.php                  26-Sep-2022 04:10                6820
imagick.paintfloodfillimage.php                    26-Sep-2022 04:10                5561
imagick.paintopaqueimage.php                       26-Sep-2022 04:10                5366
imagick.painttransparentimage.php                  26-Sep-2022 04:10                4563
imagick.pingimage.php                              26-Sep-2022 04:10                2566
imagick.pingimageblob.php                          26-Sep-2022 04:10                6195
imagick.pingimagefile.php                          26-Sep-2022 04:10                5910
imagick.polaroidimage.php                          26-Sep-2022 04:10                4715
imagick.posterizeimage.php                         26-Sep-2022 04:10                5586
imagick.previewimages.php                          26-Sep-2022 04:10                3041
imagick.previousimage.php                          26-Sep-2022 04:10                2017
imagick.profileimage.php                           26-Sep-2022 04:10                3029
imagick.quantizeimage.php                          26-Sep-2022 04:10                6498
imagick.quantizeimages.php                         26-Sep-2022 04:10                3646
imagick.queryfontmetrics.php                       26-Sep-2022 04:10                5655
imagick.queryfonts.php                             26-Sep-2022 04:10                4948
imagick.queryformats.php                           26-Sep-2022 04:10                8177
imagick.radialblurimage.php                        26-Sep-2022 04:10                5566
imagick.raiseimage.php                             26-Sep-2022 04:10                6337
imagick.randomthresholdimage.php                   26-Sep-2022 04:10                6507
imagick.readimage.php                              26-Sep-2022 04:10                2404
imagick.readimageblob.php                          26-Sep-2022 04:10                5440
imagick.readimagefile.php                          26-Sep-2022 04:10                2945
imagick.readimages.php                             26-Sep-2022 04:10                2394
imagick.recolorimage.php                           26-Sep-2022 04:10                6378
imagick.reducenoiseimage.php                       26-Sep-2022 04:10                5218
imagick.remapimage.php                             26-Sep-2022 04:10                3356
imagick.removeimage.php                            26-Sep-2022 04:10                2175
imagick.removeimageprofile.php                     26-Sep-2022 04:10                2680
imagick.render.php                                 26-Sep-2022 04:10                1957
imagick.requirements.php                           26-Sep-2022 04:10                1996
imagick.resampleimage.php                          26-Sep-2022 04:10                5448
imagick.resetimagepage.php                         26-Sep-2022 04:10                2683
imagick.resizeimage.php                            26-Sep-2022 04:10               11855
imagick.resources.php                              26-Sep-2022 04:10                1233
imagick.rollimage.php                              26-Sep-2022 04:10                4724
imagick.rotateimage.php                            26-Sep-2022 04:10                5756
imagick.rotationalblurimage.php                    26-Sep-2022 04:10                5637
imagick.roundcorners.php                           26-Sep-2022 04:10                6047
imagick.sampleimage.php                            26-Sep-2022 04:10                2770
imagick.scaleimage.php                             26-Sep-2022 04:10                6686
imagick.segmentimage.php                           26-Sep-2022 04:10                6594
imagick.selectiveblurimage.php                     26-Sep-2022 04:10                6339
imagick.separateimagechannel.php                   26-Sep-2022 04:10                5378
imagick.sepiatoneimage.php                         26-Sep-2022 04:10                4884
imagick.setbackgroundcolor.php                     26-Sep-2022 04:10                3219
imagick.setcolorspace.php                          26-Sep-2022 04:10                2865
imagick.setcompression.php                         26-Sep-2022 04:10                2456
imagick.setcompressionquality.php                  26-Sep-2022 04:10                7193
imagick.setfilename.php                            26-Sep-2022 04:10                2503
imagick.setfirstiterator.php                       26-Sep-2022 04:10                2025
imagick.setfont.php                                26-Sep-2022 04:10                5731
imagick.setformat.php                              26-Sep-2022 04:10                2365
imagick.setgravity.php                             26-Sep-2022 04:10                2625
imagick.setimage.php                               26-Sep-2022 04:10                4732
imagick.setimagealphachannel.php                   26-Sep-2022 04:10                3567
imagick.setimageartifact.php                       26-Sep-2022 04:10                7402
imagick.setimageattribute.php                      26-Sep-2022 04:10                2785
imagick.setimagebackgroundcolor.php                26-Sep-2022 04:10                3463
imagick.setimagebias.php                           26-Sep-2022 04:10                7046
imagick.setimagebiasquantum.php                    26-Sep-2022 04:10                2852
imagick.setimageblueprimary.php                    26-Sep-2022 04:10                2967
imagick.setimagebordercolor.php                    26-Sep-2022 04:10                3449
imagick.setimagechanneldepth.php                   26-Sep-2022 04:10                2982
imagick.setimageclipmask.php                       26-Sep-2022 04:10                9432
imagick.setimagecolormapcolor.php                  26-Sep-2022 04:10                3061
imagick.setimagecolorspace.php                     26-Sep-2022 04:10                3104
imagick.setimagecompose.php                        26-Sep-2022 04:10                2807
imagick.setimagecompression.php                    26-Sep-2022 04:10                2751
imagick.setimagecompressionquality.php             26-Sep-2022 04:10                4876
imagick.setimagedelay.php                          26-Sep-2022 04:10                6393
imagick.setimagedepth.php                          26-Sep-2022 04:10                2619
imagick.setimagedispose.php                        26-Sep-2022 04:10                2667
imagick.setimageextent.php                         26-Sep-2022 04:10                2877
imagick.setimagefilename.php                       26-Sep-2022 04:10                2718
imagick.setimageformat.php                         26-Sep-2022 04:10                2607
imagick.setimagegamma.php                          26-Sep-2022 04:10                2621
imagick.setimagegravity.php                        26-Sep-2022 04:10                2815
imagick.setimagegreenprimary.php                   26-Sep-2022 04:10                2960
imagick.setimageindex.php                          26-Sep-2022 04:10                3241
imagick.setimageinterlacescheme.php                26-Sep-2022 04:10                2769
imagick.setimageinterpolatemethod.php              26-Sep-2022 04:10                2687
imagick.setimageiterations.php                     26-Sep-2022 04:10                4924
imagick.setimagematte.php                          26-Sep-2022 04:10                2614
imagick.setimagemattecolor.php                     26-Sep-2022 04:10                3669
imagick.setimageopacity.php                        26-Sep-2022 04:10                5034
imagick.setimageorientation.php                    26-Sep-2022 04:10                4714
imagick.setimagepage.php                           26-Sep-2022 04:10                3409
imagick.setimageprofile.php                        26-Sep-2022 04:10                3050
imagick.setimageproperty.php                       26-Sep-2022 04:10                5014
imagick.setimageredprimary.php                     26-Sep-2022 04:10                2958
imagick.setimagerenderingintent.php                26-Sep-2022 04:10                2799
imagick.setimageresolution.php                     26-Sep-2022 04:10                4922
imagick.setimagescene.php                          26-Sep-2022 04:10                2631
imagick.setimagetickspersecond.php                 26-Sep-2022 04:10                8258
imagick.setimagetype.php                           26-Sep-2022 04:10                2412
imagick.setimageunits.php                          26-Sep-2022 04:10                2464
imagick.setimagevirtualpixelmethod.php             26-Sep-2022 04:10                2584
imagick.setimagewhitepoint.php                     26-Sep-2022 04:10                2948
imagick.setinterlacescheme.php                     26-Sep-2022 04:10                2502
imagick.setiteratorindex.php                       26-Sep-2022 04:10                6275
imagick.setlastiterator.php                        26-Sep-2022 04:10                2042
imagick.setoption.php                              26-Sep-2022 04:10               12818
imagick.setpage.php                                26-Sep-2022 04:10                3141
imagick.setpointsize.php                           26-Sep-2022 04:10                5333
imagick.setprogressmonitor.php                     26-Sep-2022 04:10               12767
imagick.setregistry.php                            26-Sep-2022 04:10                2807
imagick.setresolution.php                          26-Sep-2022 04:10                3606
imagick.setresourcelimit.php                       26-Sep-2022 04:10                2955
imagick.setsamplingfactors.php                     26-Sep-2022 04:10                7103
imagick.setsize.php                                26-Sep-2022 04:10                2675
imagick.setsizeoffset.php                          26-Sep-2022 04:10                3158
imagick.settype.php                                26-Sep-2022 04:10                2356
imagick.setup.php                                  26-Sep-2022 04:10                1646
imagick.shadeimage.php                             26-Sep-2022 04:10                5588
imagick.shadowimage.php                            26-Sep-2022 04:10                5232
imagick.sharpenimage.php                           26-Sep-2022 04:10                5504
imagick.shaveimage.php                             26-Sep-2022 04:10                4669
imagick.shearimage.php                             26-Sep-2022 04:10                6513
imagick.sigmoidalcontrastimage.php                 26-Sep-2022 04:10                7824
imagick.sketchimage.php                            26-Sep-2022 04:10                5766
imagick.smushimages.php                            26-Sep-2022 04:10                5856
imagick.solarizeimage.php                          26-Sep-2022 04:10                4849
imagick.sparsecolorimage.php                       26-Sep-2022 04:10               31292
imagick.spliceimage.php                            26-Sep-2022 04:10                5623
imagick.spreadimage.php                            26-Sep-2022 04:10                4647
imagick.statisticimage.php                         26-Sep-2022 04:10                6678
imagick.steganoimage.php                           26-Sep-2022 04:10                2980
imagick.stereoimage.php                            26-Sep-2022 04:10                2730
imagick.stripimage.php                             26-Sep-2022 04:10                2183
imagick.subimagematch.php                          26-Sep-2022 04:10                7804
imagick.swirlimage.php                             26-Sep-2022 04:10                4700
imagick.textureimage.php                           26-Sep-2022 04:10                6314
imagick.thresholdimage.php                         26-Sep-2022 04:10                5203
imagick.thumbnailimage.php                         26-Sep-2022 04:10                7163
imagick.tintimage.php                              26-Sep-2022 04:10                8035
imagick.tostring.php                               26-Sep-2022 04:10                2960
imagick.transformimage.php                         26-Sep-2022 04:10                6124
imagick.transformimagecolorspace.php               26-Sep-2022 04:10                8281
imagick.transparentpaintimage.php                  26-Sep-2022 04:10                7372
imagick.transposeimage.php                         26-Sep-2022 04:10                4386
imagick.transverseimage.php                        26-Sep-2022 04:10                4374
imagick.trimimage.php                              26-Sep-2022 04:10                5867
imagick.uniqueimagecolors.php                      26-Sep-2022 04:10                5455
imagick.unsharpmaskimage.php                       26-Sep-2022 04:10                6500
imagick.valid.php                                  26-Sep-2022 04:10                1928
imagick.vignetteimage.php                          26-Sep-2022 04:10                6438
imagick.waveimage.php                              26-Sep-2022 04:10                6339
imagick.whitethresholdimage.php                    26-Sep-2022 04:10                5325
imagick.writeimage.php                             26-Sep-2022 04:10                2944
imagick.writeimagefile.php                         26-Sep-2022 04:10                2841
imagick.writeimages.php                            26-Sep-2022 04:10                2658
imagick.writeimagesfile.php                        26-Sep-2022 04:10                2904
imagickdraw.affine.php                             26-Sep-2022 04:10               18731
imagickdraw.annotation.php                         26-Sep-2022 04:10                3084
imagickdraw.arc.php                                26-Sep-2022 04:10                9932
imagickdraw.bezier.php                             26-Sep-2022 04:10               19637
imagickdraw.circle.php                             26-Sep-2022 04:10                9294
imagickdraw.clear.php                              26-Sep-2022 04:10                2315
imagickdraw.clone.php                              26-Sep-2022 04:10                2307
imagickdraw.color.php                              26-Sep-2022 04:10                3141
imagickdraw.comment.php                            26-Sep-2022 04:10                2600
imagickdraw.composite.php                          26-Sep-2022 04:10               12056
imagickdraw.construct.php                          26-Sep-2022 04:10                2226
imagickdraw.destroy.php                            26-Sep-2022 04:10                2275
imagickdraw.ellipse.php                            26-Sep-2022 04:10               12503
imagickdraw.getclippath.php                        26-Sep-2022 04:10                2269
imagickdraw.getcliprule.php                        26-Sep-2022 04:10                2408
imagickdraw.getclipunits.php                       26-Sep-2022 04:10                2308
imagickdraw.getfillcolor.php                       26-Sep-2022 04:10                2413
imagickdraw.getfillopacity.php                     26-Sep-2022 04:10                2291
imagickdraw.getfillrule.php                        26-Sep-2022 04:10                2363
imagickdraw.getfont.php                            26-Sep-2022 04:10                2217
imagickdraw.getfontfamily.php                      26-Sep-2022 04:10                2300
imagickdraw.getfontsize.php                        26-Sep-2022 04:10                2402
imagickdraw.getfontstretch.php                     26-Sep-2022 04:10                2266
imagickdraw.getfontstyle.php                       26-Sep-2022 04:10                2306
imagickdraw.getfontweight.php                      26-Sep-2022 04:10                2319
imagickdraw.getgravity.php                         26-Sep-2022 04:10                2295
imagickdraw.getstrokeantialias.php                 26-Sep-2022 04:10                2657
imagickdraw.getstrokecolor.php                     26-Sep-2022 04:10                2813
imagickdraw.getstrokedasharray.php                 26-Sep-2022 04:10                2431
imagickdraw.getstrokedashoffset.php                26-Sep-2022 04:10                2421
imagickdraw.getstrokelinecap.php                   26-Sep-2022 04:10                2448
imagickdraw.getstrokelinejoin.php                  26-Sep-2022 04:10                2474
imagickdraw.getstrokemiterlimit.php                26-Sep-2022 04:10                2726
imagickdraw.getstrokeopacity.php                   26-Sep-2022 04:10                2295
imagickdraw.getstrokewidth.php                     26-Sep-2022 04:10                2318
imagickdraw.gettextalignment.php                   26-Sep-2022 04:10                2307
imagickdraw.gettextantialias.php                   26-Sep-2022 04:10                2498
imagickdraw.gettextdecoration.php                  26-Sep-2022 04:10                2326
imagickdraw.gettextencoding.php                    26-Sep-2022 04:10                2402
imagickdraw.gettextinterlinespacing.php            26-Sep-2022 04:10                2317
imagickdraw.gettextinterwordspacing.php            26-Sep-2022 04:10                2342
imagickdraw.gettextkerning.php                     26-Sep-2022 04:10                2259
imagickdraw.gettextundercolor.php                  26-Sep-2022 04:10                2510
imagickdraw.getvectorgraphics.php                  26-Sep-2022 04:10                2525
imagickdraw.line.php                               26-Sep-2022 04:10                8473
imagickdraw.matte.php                              26-Sep-2022 04:10                8264
imagickdraw.pathclose.php                          26-Sep-2022 04:10                2386
imagickdraw.pathcurvetoabsolute.php                26-Sep-2022 04:10                4518
imagickdraw.pathcurvetoquadraticbezierabsolute.php 26-Sep-2022 04:10               12267
imagickdraw.pathcurvetoquadraticbezierrelative.php 26-Sep-2022 04:10                3998
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 26-Sep-2022 04:10               10809
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 26-Sep-2022 04:10               10970
imagickdraw.pathcurvetorelative.php                26-Sep-2022 04:10                4528
imagickdraw.pathcurvetosmoothabsolute.php          26-Sep-2022 04:10                4347
imagickdraw.pathcurvetosmoothrelative.php          26-Sep-2022 04:10                4355
imagickdraw.pathellipticarcabsolute.php            26-Sep-2022 04:10                5258
imagickdraw.pathellipticarcrelative.php            26-Sep-2022 04:10                5228
imagickdraw.pathfinish.php                         26-Sep-2022 04:10                2184
imagickdraw.pathlinetoabsolute.php                 26-Sep-2022 04:10                3051
imagickdraw.pathlinetohorizontalabsolute.php       26-Sep-2022 04:10                2947
imagickdraw.pathlinetohorizontalrelative.php       26-Sep-2022 04:10                2937
imagickdraw.pathlinetorelative.php                 26-Sep-2022 04:10                3099
imagickdraw.pathlinetoverticalabsolute.php         26-Sep-2022 04:10                2905
imagickdraw.pathlinetoverticalrelative.php         26-Sep-2022 04:10                2916
imagickdraw.pathmovetoabsolute.php                 26-Sep-2022 04:10                3085
imagickdraw.pathmovetorelative.php                 26-Sep-2022 04:10                3037
imagickdraw.pathstart.php                          26-Sep-2022 04:10               12526
imagickdraw.point.php                              26-Sep-2022 04:10                7088
imagickdraw.polygon.php                            26-Sep-2022 04:10                9544
imagickdraw.polyline.php                           26-Sep-2022 04:10                9551
imagickdraw.pop.php                                26-Sep-2022 04:10                2577
imagickdraw.popclippath.php                        26-Sep-2022 04:10                2177
imagickdraw.popdefs.php                            26-Sep-2022 04:10                8133
imagickdraw.poppattern.php                         26-Sep-2022 04:10                2233
imagickdraw.push.php                               26-Sep-2022 04:10                8768
imagickdraw.pushclippath.php                       26-Sep-2022 04:10                2890
imagickdraw.pushdefs.php                           26-Sep-2022 04:10                2525
imagickdraw.pushpattern.php                        26-Sep-2022 04:10               15336
imagickdraw.rectangle.php                          26-Sep-2022 04:10                8743
imagickdraw.render.php                             26-Sep-2022 04:10                2286
imagickdraw.resetvectorgraphics.php                26-Sep-2022 04:10                2281
imagickdraw.rotate.php                             26-Sep-2022 04:10                8033
imagickdraw.roundrectangle.php                     26-Sep-2022 04:10                9478
imagickdraw.scale.php                              26-Sep-2022 04:10                8328
imagickdraw.setclippath.php                        26-Sep-2022 04:10                8795
imagickdraw.setcliprule.php                        26-Sep-2022 04:10                9728
imagickdraw.setclipunits.php                       26-Sep-2022 04:10                9283
imagickdraw.setfillalpha.php                       26-Sep-2022 04:10                8118
imagickdraw.setfillcolor.php                       26-Sep-2022 04:10                8130
imagickdraw.setfillopacity.php                     26-Sep-2022 04:10                8133
imagickdraw.setfillpatternurl.php                  26-Sep-2022 04:10                3068
imagickdraw.setfillrule.php                        26-Sep-2022 04:10               14675
imagickdraw.setfont.php                            26-Sep-2022 04:10                9674
imagickdraw.setfontfamily.php                      26-Sep-2022 04:10               10346
imagickdraw.setfontsize.php                        26-Sep-2022 04:10                8757
imagickdraw.setfontstretch.php                     26-Sep-2022 04:10               10403
imagickdraw.setfontstyle.php                       26-Sep-2022 04:10                9203
imagickdraw.setfontweight.php                      26-Sep-2022 04:10                9559
imagickdraw.setgravity.php                         26-Sep-2022 04:10               11294
imagickdraw.setresolution.php                      26-Sep-2022 04:10                2651
imagickdraw.setstrokealpha.php                     26-Sep-2022 04:10                8793
imagickdraw.setstrokeantialias.php                 26-Sep-2022 04:10                9381
imagickdraw.setstrokecolor.php                     26-Sep-2022 04:10                8911
imagickdraw.setstrokedasharray.php                 26-Sep-2022 04:10               14088
imagickdraw.setstrokedashoffset.php                26-Sep-2022 04:10               10459
imagickdraw.setstrokelinecap.php                   26-Sep-2022 04:10                8892
imagickdraw.setstrokelinejoin.php                  26-Sep-2022 04:10               12471
imagickdraw.setstrokemiterlimit.php                26-Sep-2022 04:10               12277
imagickdraw.setstrokeopacity.php                   26-Sep-2022 04:10               10732
imagickdraw.setstrokepatternurl.php                26-Sep-2022 04:10                2839
imagickdraw.setstrokewidth.php                     26-Sep-2022 04:10                8821
imagickdraw.settextalignment.php                   26-Sep-2022 04:10                9663
imagickdraw.settextantialias.php                   26-Sep-2022 04:10                9296
imagickdraw.settextdecoration.php                  26-Sep-2022 04:10                7534
imagickdraw.settextencoding.php                    26-Sep-2022 04:10                3152
imagickdraw.settextinterlinespacing.php            26-Sep-2022 04:10                2762
imagickdraw.settextinterwordspacing.php            26-Sep-2022 04:10                2574
imagickdraw.settextkerning.php                     26-Sep-2022 04:10                2696
imagickdraw.settextundercolor.php                  26-Sep-2022 04:10                8147
imagickdraw.setvectorgraphics.php                  26-Sep-2022 04:10                9543
imagickdraw.setviewbox.php                         26-Sep-2022 04:10               10980
imagickdraw.skewx.php                              26-Sep-2022 04:10                8546
imagickdraw.skewy.php                              26-Sep-2022 04:10                8535
imagickdraw.translate.php                          26-Sep-2022 04:10                8838
imagickkernel.addkernel.php                        26-Sep-2022 04:10                7630
imagickkernel.addunitykernel.php                   26-Sep-2022 04:10               15872
imagickkernel.frombuiltin.php                      26-Sep-2022 04:10               29554
imagickkernel.frommatrix.php                       26-Sep-2022 04:10               26175
imagickkernel.getmatrix.php                        26-Sep-2022 04:10                8248
imagickkernel.scale.php                            26-Sep-2022 04:10               15032
imagickkernel.separate.php                         26-Sep-2022 04:10               11768
imagickpixel.clear.php                             26-Sep-2022 04:10                2253
imagickpixel.construct.php                         26-Sep-2022 04:10               13843
imagickpixel.destroy.php                           26-Sep-2022 04:10                2357
imagickpixel.getcolor.php                          26-Sep-2022 04:10                6125
imagickpixel.getcolorasstring.php                  26-Sep-2022 04:10                4784
imagickpixel.getcolorcount.php                     26-Sep-2022 04:10                4816
imagickpixel.getcolorquantum.php                   26-Sep-2022 04:10                2803
imagickpixel.getcolorvalue.php                     26-Sep-2022 04:10                8817
imagickpixel.getcolorvaluequantum.php              26-Sep-2022 04:10                6530
imagickpixel.gethsl.php                            26-Sep-2022 04:10                4097
imagickpixel.getindex.php                          26-Sep-2022 04:10                2180
imagickpixel.ispixelsimilar.php                    26-Sep-2022 04:10                3428
imagickpixel.ispixelsimilarquantum.php             26-Sep-2022 04:10                2986
imagickpixel.issimilar.php                         26-Sep-2022 04:10               22831
imagickpixel.setcolor.php                          26-Sep-2022 04:10                7662
imagickpixel.setcolorcount.php                     26-Sep-2022 04:10                2454
imagickpixel.setcolorvalue.php                     26-Sep-2022 04:10                4927
imagickpixel.setcolorvaluequantum.php              26-Sep-2022 04:10                8600
imagickpixel.sethsl.php                            26-Sep-2022 04:10                7524
imagickpixel.setindex.php                          26-Sep-2022 04:10                2408
imagickpixeliterator.clear.php                     26-Sep-2022 04:10                7204
imagickpixeliterator.construct.php                 26-Sep-2022 04:10                6907
imagickpixeliterator.destroy.php                   26-Sep-2022 04:10                2387
imagickpixeliterator.getcurrentiteratorrow.php     26-Sep-2022 04:10                2539
imagickpixeliterator.getiteratorrow.php            26-Sep-2022 04:10                2501
imagickpixeliterator.getnextiteratorrow.php        26-Sep-2022 04:10                8064
imagickpixeliterator.getpreviousiteratorrow.php    26-Sep-2022 04:10                2643
imagickpixeliterator.newpixeliterator.php          26-Sep-2022 04:10                2655
imagickpixeliterator.newpixelregioniterator.php    26-Sep-2022 04:10                4020
imagickpixeliterator.resetiterator.php             26-Sep-2022 04:10               10484
imagickpixeliterator.setiteratorfirstrow.php       26-Sep-2022 04:10                2495
imagickpixeliterator.setiteratorlastrow.php        26-Sep-2022 04:10                2490
imagickpixeliterator.setiteratorrow.php            26-Sep-2022 04:10                7893
imagickpixeliterator.synciterator.php              26-Sep-2022 04:10                2330
imap.configuration.php                             26-Sep-2022 04:10                3260
imap.constants.php                                 26-Sep-2022 04:10               18016
imap.installation.php                              26-Sep-2022 04:10                2720
imap.requirements.php                              26-Sep-2022 04:10                3135
imap.resources.php                                 26-Sep-2022 04:10                1212
imap.setup.php                                     26-Sep-2022 04:10                1611
index.php                                          26-Sep-2022 04:11               15016
indexes.examples.php                               26-Sep-2022 04:11              696577
indexes.functions.php                              26-Sep-2022 04:11             1192250
indexes.php                                        26-Sep-2022 04:11                1450
infiniteiterator.construct.php                     26-Sep-2022 04:10                5731
infiniteiterator.next.php                          26-Sep-2022 04:10                3277
info.configuration.php                             26-Sep-2022 04:10               18910
info.constants.php                                 26-Sep-2022 04:10               16048
info.installation.php                              26-Sep-2022 04:10                1252
info.requirements.php                              26-Sep-2022 04:10                1208
info.resources.php                                 26-Sep-2022 04:10                1212
info.setup.php                                     26-Sep-2022 04:10                1602
ini.core.php                                       26-Sep-2022 04:11               69982
ini.list.php                                       26-Sep-2022 04:11               85140
ini.php                                            26-Sep-2022 04:11                1610
ini.sections.php                                   26-Sep-2022 04:11                4018
inotify.configuration.php                          26-Sep-2022 04:10                1317
inotify.constants.php                              26-Sep-2022 04:10                8241
inotify.install.php                                26-Sep-2022 04:10                1824
inotify.requirements.php                           26-Sep-2022 04:10                1260
inotify.resources.php                              26-Sep-2022 04:10                1343
inotify.setup.php                                  26-Sep-2022 04:10                1650
install.cloud.azure.php                            26-Sep-2022 04:10                1298
install.cloud.ec2.php                              26-Sep-2022 04:10                1408
install.cloud.php                                  26-Sep-2022 04:10                1639
install.fpm.configuration.php                      26-Sep-2022 04:10               31070
install.fpm.install.php                            26-Sep-2022 04:10                2266
install.fpm.php                                    26-Sep-2022 04:10                3527
install.general.php                                26-Sep-2022 04:10                4990
install.macosx.bundled.php                         26-Sep-2022 04:10               10695
install.macosx.compile.php                         26-Sep-2022 04:10                1291
install.macosx.packages.php                        26-Sep-2022 04:10                2718
install.macosx.php                                 26-Sep-2022 04:10                1871
install.pecl.downloads.php                         26-Sep-2022 04:10                3453
install.pecl.intro.php                             26-Sep-2022 04:10                3097
install.pecl.pear.php                              26-Sep-2022 04:10                3010
install.pecl.php                                   26-Sep-2022 04:10                2034
install.pecl.php-config.php                        26-Sep-2022 04:10                3939
install.pecl.phpize.php                            26-Sep-2022 04:10                3129
install.pecl.static.php                            26-Sep-2022 04:10                3239
install.pecl.windows.php                           26-Sep-2022 04:10                9566
install.php                                        26-Sep-2022 04:10                5880
install.problems.bugs.php                          26-Sep-2022 04:10                2042
install.problems.faq.php                           26-Sep-2022 04:10                1355
install.problems.php                               26-Sep-2022 04:10                1626
install.problems.support.php                       26-Sep-2022 04:10                2426
install.unix.apache2.php                           26-Sep-2022 04:10               13852
install.unix.commandline.php                       26-Sep-2022 04:10                3832
install.unix.debian.php                            26-Sep-2022 04:10                7138
install.unix.lighttpd-14.php                       26-Sep-2022 04:10                6197
install.unix.litespeed.php                         26-Sep-2022 04:10                9569
install.unix.nginx.php                             26-Sep-2022 04:10                9013
install.unix.openbsd.php                           26-Sep-2022 04:10                6715
install.unix.php                                   26-Sep-2022 04:10                7238
install.unix.solaris.php                           26-Sep-2022 04:10                4078
install.windows.apache2.php                        26-Sep-2022 04:10                8096
install.windows.building.php                       26-Sep-2022 04:10                1764
install.windows.commandline.php                    26-Sep-2022 04:10                8827
install.windows.manual.php                         26-Sep-2022 04:10                5571
install.windows.pecl.php                           26-Sep-2022 04:10                1644
install.windows.php                                26-Sep-2022 04:10                3096
install.windows.recommended.php                    26-Sep-2022 04:10                4908
install.windows.requirements.php                   26-Sep-2022 04:10                2254
install.windows.tools.php                          26-Sep-2022 04:10                2088
install.windows.troubleshooting.php                26-Sep-2022 04:10                1774
intl.configuration.php                             26-Sep-2022 04:10                5220
intl.constants.php                                 26-Sep-2022 04:10                7300
intl.examples.basic.php                            26-Sep-2022 04:10                4576
intl.examples.php                                  26-Sep-2022 04:10                1384
intl.installation.php                              26-Sep-2022 04:10                2563
intl.requirements.php                              26-Sep-2022 04:10                1553
intl.resources.php                                 26-Sep-2022 04:10                1212
intl.setup.php                                     26-Sep-2022 04:10                1616
intlbreakiterator.construct.php                    26-Sep-2022 04:10                2427
intlbreakiterator.createcharacterinstance.php      26-Sep-2022 04:10                2984
intlbreakiterator.createcodepointinstance.php      26-Sep-2022 04:10                2732
intlbreakiterator.createlineinstance.php           26-Sep-2022 04:10                2938
intlbreakiterator.createsentenceinstance.php       26-Sep-2022 04:10                2935
intlbreakiterator.createtitleinstance.php          26-Sep-2022 04:10                2918
intlbreakiterator.createwordinstance.php           26-Sep-2022 04:10                2870
intlbreakiterator.current.php                      26-Sep-2022 04:10                2461
intlbreakiterator.first.php                        26-Sep-2022 04:10                2436
intlbreakiterator.following.php                    26-Sep-2022 04:10                2710
intlbreakiterator.geterrorcode.php                 26-Sep-2022 04:10                2990
intlbreakiterator.geterrormessage.php              26-Sep-2022 04:10                3025
intlbreakiterator.getlocale.php                    26-Sep-2022 04:10                2709
intlbreakiterator.getpartsiterator.php             26-Sep-2022 04:10                2807
intlbreakiterator.gettext.php                      26-Sep-2022 04:10                2469
intlbreakiterator.isboundary.php                   26-Sep-2022 04:10                2680
intlbreakiterator.last.php                         26-Sep-2022 04:10                2445
intlbreakiterator.next.php                         26-Sep-2022 04:10                2654
intlbreakiterator.preceding.php                    26-Sep-2022 04:10                2699
intlbreakiterator.previous.php                     26-Sep-2022 04:10                2497
intlbreakiterator.settext.php                      26-Sep-2022 04:10                2644
intlcalendar.add.php                               26-Sep-2022 04:10                8306
intlcalendar.after.php                             26-Sep-2022 04:10                6635
intlcalendar.before.php                            26-Sep-2022 04:10                3867
intlcalendar.clear.php                             26-Sep-2022 04:10               20834
intlcalendar.construct.php                         26-Sep-2022 04:10                2524
intlcalendar.createinstance.php                    26-Sep-2022 04:10               12274
intlcalendar.equals.php                            26-Sep-2022 04:10               10912
intlcalendar.fielddifference.php                   26-Sep-2022 04:10               11060
intlcalendar.fromdatetime.php                      26-Sep-2022 04:10                6919
intlcalendar.get.php                               26-Sep-2022 04:10                8587
intlcalendar.getactualmaximum.php                  26-Sep-2022 04:10                8172
intlcalendar.getactualminimum.php                  26-Sep-2022 04:10                5321
intlcalendar.getavailablelocales.php               26-Sep-2022 04:10                4229
intlcalendar.getdayofweektype.php                  26-Sep-2022 04:10                9608
intlcalendar.geterrorcode.php                      26-Sep-2022 04:10                9013
intlcalendar.geterrormessage.php                   26-Sep-2022 04:10                5776
intlcalendar.getfirstdayofweek.php                 26-Sep-2022 04:10                8255
intlcalendar.getgreatestminimum.php                26-Sep-2022 04:10                4176
intlcalendar.getkeywordvaluesforlocale.php         26-Sep-2022 04:10                7514
intlcalendar.getleastmaximum.php                   26-Sep-2022 04:10                7999
intlcalendar.getlocale.php                         26-Sep-2022 04:10                5756
intlcalendar.getmaximum.php                        26-Sep-2022 04:10                4913
intlcalendar.getminimaldaysinfirstweek.php         26-Sep-2022 04:10                8856
intlcalendar.getminimum.php                        26-Sep-2022 04:10                4114
intlcalendar.getnow.php                            26-Sep-2022 04:10                5376
intlcalendar.getrepeatedwalltimeoption.php         26-Sep-2022 04:10               10343
intlcalendar.getskippedwalltimeoption.php          26-Sep-2022 04:10               12793
intlcalendar.gettime.php                           26-Sep-2022 04:10                6122
intlcalendar.gettimezone.php                       26-Sep-2022 04:10                7133
intlcalendar.gettype.php                           26-Sep-2022 04:10                5548
intlcalendar.getweekendtransition.php              26-Sep-2022 04:10                4518
intlcalendar.indaylighttime.php                    26-Sep-2022 04:10                8844
intlcalendar.isequivalentto.php                    26-Sep-2022 04:10                8516
intlcalendar.islenient.php                         26-Sep-2022 04:10                8278
intlcalendar.isset.php                             26-Sep-2022 04:10                4636
intlcalendar.isweekend.php                         26-Sep-2022 04:10                8564
intlcalendar.roll.php                              26-Sep-2022 04:10                9140
intlcalendar.set.php                               26-Sep-2022 04:10               14210
intlcalendar.setfirstdayofweek.php                 26-Sep-2022 04:10                8058
intlcalendar.setlenient.php                        26-Sep-2022 04:10                4208
intlcalendar.setminimaldaysinfirstweek.php         26-Sep-2022 04:10                4088
intlcalendar.setrepeatedwalltimeoption.php         26-Sep-2022 04:10                5531
intlcalendar.setskippedwalltimeoption.php          26-Sep-2022 04:10                6248
intlcalendar.settime.php                           26-Sep-2022 04:10                8598
intlcalendar.settimezone.php                       26-Sep-2022 04:10               10592
intlcalendar.todatetime.php                        26-Sep-2022 04:10                6902
intlchar.charage.php                               26-Sep-2022 04:10                5533
intlchar.chardigitvalue.php                        26-Sep-2022 04:10                5181
intlchar.chardirection.php                         26-Sep-2022 04:10                8630
intlchar.charfromname.php                          26-Sep-2022 04:10                6855
intlchar.charmirror.php                            26-Sep-2022 04:10                6079
intlchar.charname.php                              26-Sep-2022 04:10                7029
intlchar.chartype.php                              26-Sep-2022 04:10                8742
intlchar.chr.php                                   26-Sep-2022 04:10                5205
intlchar.digit.php                                 26-Sep-2022 04:10                7830
intlchar.enumcharnames.php                         26-Sep-2022 04:10                7875
intlchar.enumchartypes.php                         26-Sep-2022 04:10                5906
intlchar.foldcase.php                              26-Sep-2022 04:10                3549
intlchar.fordigit.php                              26-Sep-2022 04:10                7008
intlchar.getbidipairedbracket.php                  26-Sep-2022 04:10                5607
intlchar.getblockcode.php                          26-Sep-2022 04:10                5235
intlchar.getcombiningclass.php                     26-Sep-2022 04:10                4531
intlchar.getfc-nfkc-closure.php                    26-Sep-2022 04:10                4353
intlchar.getintpropertymaxvalue.php                26-Sep-2022 04:10                6433
intlchar.getintpropertyminvalue.php                26-Sep-2022 04:10                6426
intlchar.getintpropertyvalue.php                   26-Sep-2022 04:10                7749
intlchar.getnumericvalue.php                       26-Sep-2022 04:10                4935
intlchar.getpropertyenum.php                       26-Sep-2022 04:10                6653
intlchar.getpropertyname.php                       26-Sep-2022 04:10                8279
intlchar.getpropertyvalueenum.php                  26-Sep-2022 04:10                7935
intlchar.getpropertyvaluename.php                  26-Sep-2022 04:10                9959
intlchar.getunicodeversion.php                     26-Sep-2022 04:10                3944
intlchar.hasbinaryproperty.php                     26-Sep-2022 04:10                8694
intlchar.isalnum.php                               26-Sep-2022 04:10                5320
intlchar.isalpha.php                               26-Sep-2022 04:10                5222
intlchar.isbase.php                                26-Sep-2022 04:10                5701
intlchar.isblank.php                               26-Sep-2022 04:10                6424
intlchar.iscntrl.php                               26-Sep-2022 04:10                5984
intlchar.isdefined.php                             26-Sep-2022 04:10                6571
intlchar.isdigit.php                               26-Sep-2022 04:10                5572
intlchar.isgraph.php                               26-Sep-2022 04:10                5188
intlchar.isidignorable.php                         26-Sep-2022 04:10                5865
intlchar.isidpart.php                              26-Sep-2022 04:10                6394
intlchar.isidstart.php                             26-Sep-2022 04:10                5907
intlchar.isisocontrol.php                          26-Sep-2022 04:10                5152
intlchar.isjavaidpart.php                          26-Sep-2022 04:10                6596
intlchar.isjavaidstart.php                         26-Sep-2022 04:10                6240
intlchar.isjavaspacechar.php                       26-Sep-2022 04:10                6476
intlchar.islower.php                               26-Sep-2022 04:10                6765
intlchar.ismirrored.php                            26-Sep-2022 04:10                5254
intlchar.isprint.php                               26-Sep-2022 04:10                5492
intlchar.ispunct.php                               26-Sep-2022 04:10                4930
intlchar.isspace.php                               26-Sep-2022 04:10                6123
intlchar.istitle.php                               26-Sep-2022 04:10                6159
intlchar.isualphabetic.php                         26-Sep-2022 04:10                5508
intlchar.isulowercase.php                          26-Sep-2022 04:10                6491
intlchar.isupper.php                               26-Sep-2022 04:10                6757
intlchar.isuuppercase.php                          26-Sep-2022 04:10                6536
intlchar.isuwhitespace.php                         26-Sep-2022 04:10                7103
intlchar.iswhitespace.php                          26-Sep-2022 04:10                7184
intlchar.isxdigit.php                              26-Sep-2022 04:10                6594
intlchar.ord.php                                   26-Sep-2022 04:10                5295
intlchar.tolower.php                               26-Sep-2022 04:10                7216
intlchar.totitle.php                               26-Sep-2022 04:10                7263
intlchar.toupper.php                               26-Sep-2022 04:10                7212
intlcodepointbreakiterator.getlastcodepoint.php    26-Sep-2022 04:10                2707
intldateformatter.create.php                       26-Sep-2022 04:10               25907
intldateformatter.format.php                       26-Sep-2022 04:10               27083
intldateformatter.formatobject.php                 26-Sep-2022 04:10               13287
intldateformatter.getcalendar.php                  26-Sep-2022 04:10                9219
intldateformatter.getcalendarobject.php            26-Sep-2022 04:10                7110
intldateformatter.getdatetype.php                  26-Sep-2022 04:10               12173
intldateformatter.geterrorcode.php                 26-Sep-2022 04:10                9338
intldateformatter.geterrormessage.php              26-Sep-2022 04:10                9241
intldateformatter.getlocale.php                    26-Sep-2022 04:10               12516
intldateformatter.getpattern.php                   26-Sep-2022 04:10               10715
intldateformatter.gettimetype.php                  26-Sep-2022 04:10               12171
intldateformatter.gettimezone.php                  26-Sep-2022 04:10                8430
intldateformatter.gettimezoneid.php                26-Sep-2022 04:10                8819
intldateformatter.islenient.php                    26-Sep-2022 04:10               16070
intldateformatter.localtime.php                    26-Sep-2022 04:10               11686
intldateformatter.parse.php                        26-Sep-2022 04:10               12708
intldateformatter.setcalendar.php                  26-Sep-2022 04:10               14521
intldateformatter.setlenient.php                   26-Sep-2022 04:10               15583
intldateformatter.setpattern.php                   26-Sep-2022 04:10               11439
intldateformatter.settimezone.php                  26-Sep-2022 04:10               10946
intliterator.current.php                           26-Sep-2022 04:10                2324
intliterator.key.php                               26-Sep-2022 04:10                2294
intliterator.next.php                              26-Sep-2022 04:10                2313
intliterator.rewind.php                            26-Sep-2022 04:10                2333
intliterator.valid.php                             26-Sep-2022 04:10                2334
intlpartsiterator.getbreakiterator.php             26-Sep-2022 04:10                2532
intlrulebasedbreakiterator.construct.php           26-Sep-2022 04:10                3047
intlrulebasedbreakiterator.getbinaryrules.php      26-Sep-2022 04:10                2694
intlrulebasedbreakiterator.getrules.php            26-Sep-2022 04:10                2664
intlrulebasedbreakiterator.getrulestatus.php       26-Sep-2022 04:10                2752
intlrulebasedbreakiterator.getrulestatusvec.php    26-Sep-2022 04:10                2760
intltimezone.construct.php                         26-Sep-2022 04:10                1941
intltimezone.countequivalentids.php                26-Sep-2022 04:10                2715
intltimezone.createdefault.php                     26-Sep-2022 04:10                2574
intltimezone.createenumeration.php                 26-Sep-2022 04:10                2954
intltimezone.createtimezone.php                    26-Sep-2022 04:10                2762
intltimezone.createtimezoneidenumeration.php       26-Sep-2022 04:10                5075
intltimezone.fromdatetimezone.php                  26-Sep-2022 04:10                2933
intltimezone.getcanonicalid.php                    26-Sep-2022 04:10                3038
intltimezone.getdisplayname.php                    26-Sep-2022 04:10                3221
intltimezone.getdstsavings.php                     26-Sep-2022 04:10                2486
intltimezone.getequivalentid.php                   26-Sep-2022 04:10                2907
intltimezone.geterrorcode.php                      26-Sep-2022 04:10                2813
intltimezone.geterrormessage.php                   26-Sep-2022 04:10                2826
intltimezone.getgmt.php                            26-Sep-2022 04:10                2436
intltimezone.getid.php                             26-Sep-2022 04:10                2326
intltimezone.getidforwindowsid.php                 26-Sep-2022 04:10                5253
intltimezone.getoffset.php                         26-Sep-2022 04:10                3423
intltimezone.getrawoffset.php                      26-Sep-2022 04:10                2436
intltimezone.getregion.php                         26-Sep-2022 04:10                3344
intltimezone.gettzdataversion.php                  26-Sep-2022 04:10                2509
intltimezone.getunknown.php                        26-Sep-2022 04:10                3075
intltimezone.getwindowsid.php                      26-Sep-2022 04:10                4100
intltimezone.hassamerules.php                      26-Sep-2022 04:10                2708
intltimezone.todatetimezone.php                    26-Sep-2022 04:10                2580
intltimezone.usedaylighttime.php                   26-Sep-2022 04:10                2446
intro-whatcando.php                                26-Sep-2022 04:10                8240
intro-whatis.php                                   26-Sep-2022 04:10                4388
intro.apache.php                                   26-Sep-2022 04:10                1174
intro.apcu.php                                     26-Sep-2022 04:10                1557
intro.array.php                                    26-Sep-2022 04:10                1959
intro.bc.php                                       26-Sep-2022 04:10                1242
intro.bzip2.php                                    26-Sep-2022 04:10                1198
intro.calendar.php                                 26-Sep-2022 04:10                2103
intro.classobj.php                                 26-Sep-2022 04:10                1757
intro.cmark.php                                    26-Sep-2022 04:10                6439
intro.com.php                                      26-Sep-2022 04:11                3297
intro.componere.php                                26-Sep-2022 04:10                6246
intro.csprng.php                                   26-Sep-2022 04:10                1740
intro.ctype.php                                    26-Sep-2022 04:10                3415
intro.cubrid.php                                   26-Sep-2022 04:10                1486
intro.curl.php                                     26-Sep-2022 04:10                1596
intro.datetime.php                                 26-Sep-2022 04:10                2459
intro.dba.php                                      26-Sep-2022 04:10                1534
intro.dbase.php                                    26-Sep-2022 04:10                4698
intro.dio.php                                      26-Sep-2022 04:10                2048
intro.dom.php                                      26-Sep-2022 04:11                1683
intro.ds.php                                       26-Sep-2022 04:10                1377
intro.eio.php                                      26-Sep-2022 04:10               16313
intro.enchant.php                                  26-Sep-2022 04:10                2686
intro.errorfunc.php                                26-Sep-2022 04:10                1986
intro.ev.php                                       26-Sep-2022 04:10                2357
intro.event.php                                    26-Sep-2022 04:10                2074
intro.exec.php                                     26-Sep-2022 04:10                1793
intro.exif.php                                     26-Sep-2022 04:10                1508
intro.expect.php                                   26-Sep-2022 04:10                1439
intro.fann.php                                     26-Sep-2022 04:10                1470
intro.fdf.php                                      26-Sep-2022 04:10                4017
intro.ffi.php                                      26-Sep-2022 04:10                2835
intro.fileinfo.php                                 26-Sep-2022 04:10                1452
intro.filesystem.php                               26-Sep-2022 04:10                1467
intro.filter.php                                   26-Sep-2022 04:10                2784
intro.fpm.php                                      26-Sep-2022 04:10                1297
intro.ftp.php                                      26-Sep-2022 04:10                1874
intro.funchand.php                                 26-Sep-2022 04:10                1218
intro.gearman.php                                  26-Sep-2022 04:10                1708
intro.gender.php                                   26-Sep-2022 04:10                1328
intro.geoip.php                                    26-Sep-2022 04:10                1306
intro.gettext.php                                  26-Sep-2022 04:10                1630
intro.gmagick.php                                  26-Sep-2022 04:10                1720
intro.gmp.php                                      26-Sep-2022 04:10                3255
intro.gnupg.php                                    26-Sep-2022 04:10                1193
intro.hash.php                                     26-Sep-2022 04:10                1228
intro.hrtime.php                                   26-Sep-2022 04:10                1403
intro.ibase.php                                    26-Sep-2022 04:10                3082
intro.ibm-db2.php                                  26-Sep-2022 04:10                1248
intro.iconv.php                                    26-Sep-2022 04:10                2059
intro.igbinary.php                                 26-Sep-2022 04:10                1651
intro.image.php                                    26-Sep-2022 04:10                5916
intro.imagick.php                                  26-Sep-2022 04:10                1767
intro.imap.php                                     26-Sep-2022 04:10                1511
intro.info.php                                     26-Sep-2022 04:10                1518
intro.inotify.php                                  26-Sep-2022 04:10                2349
intro.intl.php                                     26-Sep-2022 04:10                5506
intro.json.php                                     26-Sep-2022 04:10                1659
intro.ldap.php                                     26-Sep-2022 04:10                4444
intro.libxml.php                                   26-Sep-2022 04:11                1767
intro.lua.php                                      26-Sep-2022 04:10                1282
intro.luasandbox.php                               26-Sep-2022 04:10                2341
intro.lzf.php                                      26-Sep-2022 04:10                1429
intro.mail.php                                     26-Sep-2022 04:10                1191
intro.mailparse.php                                26-Sep-2022 04:10                1976
intro.math.php                                     26-Sep-2022 04:10                1657
intro.mbstring.php                                 26-Sep-2022 04:10                3034
intro.mcrypt.php                                   26-Sep-2022 04:10                1676
intro.memcache.php                                 26-Sep-2022 04:10                1724
intro.memcached.php                                26-Sep-2022 04:10                1952
intro.mhash.php                                    26-Sep-2022 04:10                2123
intro.misc.php                                     26-Sep-2022 04:10                1187
intro.mqseries.php                                 26-Sep-2022 04:10                1720
intro.mysql-xdevapi.php                            26-Sep-2022 04:10                1856
intro.mysql.php                                    26-Sep-2022 04:10                1972
intro.mysqli.php                                   26-Sep-2022 04:10                2241
intro.mysqlnd.php                                  26-Sep-2022 04:10                2121
intro.network.php                                  26-Sep-2022 04:10                1130
intro.oauth.php                                    26-Sep-2022 04:11                1314
intro.oci8.php                                     26-Sep-2022 04:10                1708
intro.opcache.php                                  26-Sep-2022 04:10                1564
intro.openal.php                                   26-Sep-2022 04:10                1250
intro.openssl.php                                  26-Sep-2022 04:10                1451
intro.outcontrol.php                               26-Sep-2022 04:10                2431
intro.parallel.php                                 26-Sep-2022 04:10                6823
intro.parle.php                                    26-Sep-2022 04:10                3415
intro.password.php                                 26-Sep-2022 04:10                1665
intro.pcntl.php                                    26-Sep-2022 04:10                3174
intro.pcre.php                                     26-Sep-2022 04:10                2847
intro.pdo.php                                      26-Sep-2022 04:10                2537
intro.pgsql.php                                    26-Sep-2022 04:10                1680
intro.phar.php                                     26-Sep-2022 04:10               10778
intro.phpdbg.php                                   26-Sep-2022 04:10                6017
intro.posix.php                                    26-Sep-2022 04:10                1721
intro.ps.php                                       26-Sep-2022 04:10                1844
intro.pspell.php                                   26-Sep-2022 04:10                1188
intro.pthreads.php                                 26-Sep-2022 04:10                6954
intro.quickhash.php                                26-Sep-2022 04:10                1243
intro.radius.php                                   26-Sep-2022 04:10                2213
intro.rar.php                                      26-Sep-2022 04:10                1524
intro.readline.php                                 26-Sep-2022 04:10                2057
intro.recode.php                                   26-Sep-2022 04:10                1852
intro.reflection.php                               26-Sep-2022 04:10                1885
intro.rpminfo.php                                  26-Sep-2022 04:10                1202
intro.rrd.php                                      26-Sep-2022 04:10                1483
intro.runkit.php                                   26-Sep-2022 04:10                1799
intro.scoutapm.php                                 26-Sep-2022 04:10                1447
intro.seaslog.php                                  26-Sep-2022 04:10                4149
intro.sem.php                                      26-Sep-2022 04:10                3209
intro.session.php                                  26-Sep-2022 04:10                5607
intro.shmop.php                                    26-Sep-2022 04:10                1255
intro.simplexml.php                                26-Sep-2022 04:11                1330
intro.snmp.php                                     26-Sep-2022 04:10                1635
intro.soap.php                                     26-Sep-2022 04:11                1457
intro.sockets.php                                  26-Sep-2022 04:10                2734
intro.sodium.php                                   26-Sep-2022 04:10                1306
intro.solr.php                                     26-Sep-2022 04:10                1880
intro.spl.php                                      26-Sep-2022 04:10                1808
intro.sqlite3.php                                  26-Sep-2022 04:10                1143
intro.sqlsrv.php                                   26-Sep-2022 04:10                2205
intro.ssdeep.php                                   26-Sep-2022 04:10                1735
intro.ssh2.php                                     26-Sep-2022 04:10                1358
intro.stats.php                                    26-Sep-2022 04:10                1487
intro.stomp.php                                    26-Sep-2022 04:10                1358
intro.stream.php                                   26-Sep-2022 04:10                4142
intro.strings.php                                  26-Sep-2022 04:10                1666
intro.svm.php                                      26-Sep-2022 04:10                1264
intro.svn.php                                      26-Sep-2022 04:10                1838
intro.swoole.php                                   26-Sep-2022 04:10                1626
intro.sync.php                                     26-Sep-2022 04:10                2328
intro.taint.php                                    26-Sep-2022 04:10                4589
intro.tcpwrap.php                                  26-Sep-2022 04:10                1264
intro.tidy.php                                     26-Sep-2022 04:10                1277
intro.tokenizer.php                                26-Sep-2022 04:10                1571
intro.trader.php                                   26-Sep-2022 04:10                2511
intro.ui.php                                       26-Sep-2022 04:11                1187
intro.uodbc.php                                    26-Sep-2022 04:10                2855
intro.uopz.php                                     26-Sep-2022 04:10                2382
intro.url.php                                      26-Sep-2022 04:10                1132
intro.v8js.php                                     26-Sep-2022 04:10                1204
intro.var.php                                      26-Sep-2022 04:11                1333
intro.var_representation.php                       26-Sep-2022 04:10                1405
intro.varnish.php                                  26-Sep-2022 04:10                1325
intro.wddx.php                                     26-Sep-2022 04:11                1200
intro.win32service.php                             26-Sep-2022 04:11                1426
intro.wincache.php                                 26-Sep-2022 04:10                5662
intro.wkhtmltox.php                                26-Sep-2022 04:10                1272
intro.xattr.php                                    26-Sep-2022 04:10                1178
intro.xdiff.php                                    26-Sep-2022 04:10                2715
intro.xhprof.php                                   26-Sep-2022 04:10                3043
intro.xlswriter.php                                26-Sep-2022 04:10                1185
intro.xml.php                                      26-Sep-2022 04:11                2362
intro.xmldiff.php                                  26-Sep-2022 04:11                1443
intro.xmlreader.php                                26-Sep-2022 04:11                1617
intro.xmlrpc.php                                   26-Sep-2022 04:11                1926
intro.xmlwriter.php                                26-Sep-2022 04:11                1564
intro.xsl.php                                      26-Sep-2022 04:11                1318
intro.yac.php                                      26-Sep-2022 04:10                1209
intro.yaconf.php                                   26-Sep-2022 04:10                2643
intro.yaf.php                                      26-Sep-2022 04:10                1698
intro.yaml.php                                     26-Sep-2022 04:10                1404
intro.yar.php                                      26-Sep-2022 04:11                1275
intro.yaz.php                                      26-Sep-2022 04:10                2619
intro.zip.php                                      26-Sep-2022 04:10                1184
intro.zlib.php                                     26-Sep-2022 04:10                2754
intro.zmq.php                                      26-Sep-2022 04:10                1411
intro.zookeeper.php                                26-Sep-2022 04:10                1466
introduction.php                                   26-Sep-2022 04:10                1479
iterator.current.php                               26-Sep-2022 04:10                2200
iterator.key.php                                   26-Sep-2022 04:10                2459
iterator.next.php                                  26-Sep-2022 04:10                2392
iterator.rewind.php                                26-Sep-2022 04:10                2620
iterator.valid.php                                 26-Sep-2022 04:10                2572
iteratoraggregate.getiterator.php                  26-Sep-2022 04:10                2841
iteratoriterator.construct.php                     26-Sep-2022 04:10                2890
iteratoriterator.current.php                       26-Sep-2022 04:10                2739
iteratoriterator.getinneriterator.php              26-Sep-2022 04:10                2958
iteratoriterator.key.php                           26-Sep-2022 04:10                2696
iteratoriterator.next.php                          26-Sep-2022 04:10                2805
iteratoriterator.rewind.php                        26-Sep-2022 04:10                2823
iteratoriterator.valid.php                         26-Sep-2022 04:10                2866
json.configuration.php                             26-Sep-2022 04:10                1280
json.constants.php                                 26-Sep-2022 04:10                9532
json.installation.php                              26-Sep-2022 04:10                1739
json.requirements.php                              26-Sep-2022 04:10                1235
json.resources.php                                 26-Sep-2022 04:10                1212
json.setup.php                                     26-Sep-2022 04:10                1579
jsonserializable.jsonserialize.php                 26-Sep-2022 04:10               12917
langref.php                                        26-Sep-2022 04:10               18756
language.attributes.classes.php                    26-Sep-2022 04:10                5460
language.attributes.overview.php                   26-Sep-2022 04:10               11503
language.attributes.php                            26-Sep-2022 04:10                1701
language.attributes.reflection.php                 26-Sep-2022 04:10                8536
language.attributes.syntax.php                     26-Sep-2022 04:10                5074
language.basic-syntax.comments.php                 26-Sep-2022 04:10                4784
language.basic-syntax.instruction-separation.php   26-Sep-2022 04:10                3324
language.basic-syntax.php                          26-Sep-2022 04:10                1651
language.basic-syntax.phpmode.php                  26-Sep-2022 04:10               10913
language.basic-syntax.phptags.php                  26-Sep-2022 04:10                4074
language.constants.php                             26-Sep-2022 04:10                5433
language.constants.predefined.php                  26-Sep-2022 04:10                7136
language.constants.syntax.php                      26-Sep-2022 04:10               10807
language.control-structures.php                    26-Sep-2022 04:10                2771
language.enumerations.backed.php                   26-Sep-2022 04:10               10132
language.enumerations.basics.php                   26-Sep-2022 04:10                7504
language.enumerations.constants.php                26-Sep-2022 04:10                2371
language.enumerations.examples.php                 26-Sep-2022 04:10                7797
language.enumerations.expressions.php              26-Sep-2022 04:10                5804
language.enumerations.listing.php                  26-Sep-2022 04:10                2168
language.enumerations.methods.php                  26-Sep-2022 04:10               15832
language.enumerations.object-differences.php       26-Sep-2022 04:10                4851
language.enumerations.overview.php                 26-Sep-2022 04:10                2176
language.enumerations.php                          26-Sep-2022 04:10                2348
language.enumerations.serialization.php            26-Sep-2022 04:10                4878
language.enumerations.static-methods.php           26-Sep-2022 04:10                3661
language.enumerations.traits.php                   26-Sep-2022 04:10                4953
language.errors.basics.php                         26-Sep-2022 04:10                5013
language.errors.php                                26-Sep-2022 04:10                1900
language.errors.php7.php                           26-Sep-2022 04:10                5293
language.exceptions.extending.php                  26-Sep-2022 04:10               28846
language.exceptions.php                            26-Sep-2022 04:10               16009
language.expressions.php                           26-Sep-2022 04:10               17224
language.fibers.php                                26-Sep-2022 04:10                5994
language.functions.php                             26-Sep-2022 04:10                1833
language.generators.comparison.php                 26-Sep-2022 04:10               10250
language.generators.overview.php                   26-Sep-2022 04:10               10443
language.generators.php                            26-Sep-2022 04:10                1616
language.generators.syntax.php                     26-Sep-2022 04:10               27904
language.namespaces.basics.php                     26-Sep-2022 04:10               13539
language.namespaces.definition.php                 26-Sep-2022 04:10                4318
language.namespaces.definitionmultiple.php         26-Sep-2022 04:10               10117
language.namespaces.dynamic.php                    26-Sep-2022 04:10                9299
language.namespaces.fallback.php                   26-Sep-2022 04:10                6872
language.namespaces.faq.php                        26-Sep-2022 04:10               37903
language.namespaces.global.php                     26-Sep-2022 04:10                3130
language.namespaces.importing.php                  26-Sep-2022 04:10               20635
language.namespaces.nested.php                     26-Sep-2022 04:10                3093
language.namespaces.nsconstants.php                26-Sep-2022 04:10               10278
language.namespaces.php                            26-Sep-2022 04:10                2627
language.namespaces.rationale.php                  26-Sep-2022 04:10                7687
language.namespaces.rules.php                      26-Sep-2022 04:10               16603
language.oop5.abstract.php                         26-Sep-2022 04:10               13234
language.oop5.anonymous.php                        26-Sep-2022 04:10               12182
language.oop5.autoload.php                         26-Sep-2022 04:10               12112
language.oop5.basic.php                            26-Sep-2022 04:10               45348
language.oop5.changelog.php                        26-Sep-2022 04:10                7931
language.oop5.cloning.php                          26-Sep-2022 04:10                9667
language.oop5.constants.php                        26-Sep-2022 04:10               11961
language.oop5.decon.php                            26-Sep-2022 04:10               25532
language.oop5.final.php                            26-Sep-2022 04:10                5405
language.oop5.inheritance.php                      26-Sep-2022 04:10               14224
language.oop5.interfaces.php                       26-Sep-2022 04:10               16112
language.oop5.iterations.php                       26-Sep-2022 04:10               20298
language.oop5.late-static-bindings.php             26-Sep-2022 04:10               16717
language.oop5.magic.php                            26-Sep-2022 04:10               40296
language.oop5.object-comparison.php                26-Sep-2022 04:10                9781
language.oop5.overloading.php                      26-Sep-2022 04:10               27331
language.oop5.paamayim-nekudotayim.php             26-Sep-2022 04:10                9405
language.oop5.php                                  26-Sep-2022 04:10                3410
language.oop5.properties.php                       26-Sep-2022 04:10               28598
language.oop5.references.php                       26-Sep-2022 04:10                6266
language.oop5.serialization.php                    26-Sep-2022 04:10                8187
language.oop5.static.php                           26-Sep-2022 04:10               10386
language.oop5.traits.php                           26-Sep-2022 04:10               34358
language.oop5.variance.php                         26-Sep-2022 04:10               16169
language.oop5.visibility.php                       26-Sep-2022 04:10               29326
language.operators.arithmetic.php                  26-Sep-2022 04:10                5700
language.operators.array.php                       26-Sep-2022 04:10                9084
language.operators.assignment.php                  26-Sep-2022 04:10                9222
language.operators.bitwise.php                     26-Sep-2022 04:10               48431
language.operators.comparison.php                  26-Sep-2022 04:10               37626
language.operators.errorcontrol.php                26-Sep-2022 04:10                5626
language.operators.execution.php                   26-Sep-2022 04:10                3321
language.operators.increment.php                   26-Sep-2022 04:10               11425
language.operators.logical.php                     26-Sep-2022 04:10                7866
language.operators.php                             26-Sep-2022 04:10                4015
language.operators.precedence.php                  26-Sep-2022 04:10               16836
language.operators.string.php                      26-Sep-2022 04:10                3217
language.operators.type.php                        26-Sep-2022 04:10               16403
language.references.arent.php                      26-Sep-2022 04:10                3249
language.references.pass.php                       26-Sep-2022 04:10                7931
language.references.php                            26-Sep-2022 04:10                1999
language.references.return.php                     26-Sep-2022 04:10                7739
language.references.spot.php                       26-Sep-2022 04:10                2771
language.references.unset.php                      26-Sep-2022 04:10                2292
language.references.whatare.php                    26-Sep-2022 04:10                2160
language.references.whatdo.php                     26-Sep-2022 04:10               20070
language.types.array.php                           26-Sep-2022 04:10               83430
language.types.boolean.php                         26-Sep-2022 04:10                9147
language.types.callable.php                        26-Sep-2022 04:10               13128
language.types.declarations.php                    26-Sep-2022 04:10               54000
language.types.float.php                           26-Sep-2022 04:10                9070
language.types.integer.php                         26-Sep-2022 04:10               17472
language.types.intro.php                           26-Sep-2022 04:10                7928
language.types.iterable.php                        26-Sep-2022 04:10                9121
language.types.null.php                            26-Sep-2022 04:10                3488
language.types.numeric-strings.php                 26-Sep-2022 04:10               10712
language.types.object.php                          26-Sep-2022 04:10                5387
language.types.php                                 26-Sep-2022 04:10                2372
language.types.resource.php                        26-Sep-2022 04:10                2880
language.types.string.php                          26-Sep-2022 04:10               80059
language.types.type-juggling.php                   26-Sep-2022 04:10               14399
language.variables.basics.php                      26-Sep-2022 04:10               14889
language.variables.external.php                    26-Sep-2022 04:10               18310
language.variables.php                             26-Sep-2022 04:10                1740
language.variables.predefined.php                  26-Sep-2022 04:10                3394
language.variables.scope.php                       26-Sep-2022 04:10               26657
language.variables.superglobals.php                26-Sep-2022 04:10                4473
language.variables.variable.php                    26-Sep-2022 04:10               11367
ldap.configuration.php                             26-Sep-2022 04:10                2432
ldap.constants.php                                 26-Sep-2022 04:10               14392
ldap.controls.php                                  26-Sep-2022 04:10                8748
ldap.examples-basic.php                            26-Sep-2022 04:10                9803
ldap.examples.php                                  26-Sep-2022 04:10                1324
ldap.installation.php                              26-Sep-2022 04:10                3050
ldap.requirements.php                              26-Sep-2022 04:10                1531
ldap.resources.php                                 26-Sep-2022 04:10                1440
ldap.setup.php                                     26-Sep-2022 04:10                1615
ldap.using.php                                     26-Sep-2022 04:10                2313
libxml.configuration.php                           26-Sep-2022 04:11                1294
libxml.constants.php                               26-Sep-2022 04:11                9769
libxml.installation.php                            26-Sep-2022 04:11                2606
libxml.requirements.php                            26-Sep-2022 04:11                1274
libxml.resources.php                               26-Sep-2022 04:11                1226
libxml.setup.php                                   26-Sep-2022 04:11                1621
limititerator.construct.php                        26-Sep-2022 04:10                6386
limititerator.current.php                          26-Sep-2022 04:10                3661
limititerator.getinneriterator.php                 26-Sep-2022 04:10                3141
limititerator.getposition.php                      26-Sep-2022 04:10                5938
limititerator.key.php                              26-Sep-2022 04:10                3784
limititerator.next.php                             26-Sep-2022 04:10                3379
limititerator.rewind.php                           26-Sep-2022 04:10                3536
limititerator.seek.php                             26-Sep-2022 04:10                4181
limititerator.valid.php                            26-Sep-2022 04:10                3448
locale.acceptfromhttp.php                          26-Sep-2022 04:10                5572
locale.canonicalize.php                            26-Sep-2022 04:10                2650
locale.composelocale.php                           26-Sep-2022 04:10                9201
locale.filtermatches.php                           26-Sep-2022 04:10                8219
locale.getallvariants.php                          26-Sep-2022 04:10                6127
locale.getdefault.php                              26-Sep-2022 04:10                5968
locale.getdisplaylanguage.php                      26-Sep-2022 04:10                8647
locale.getdisplayname.php                          26-Sep-2022 04:10                8607
locale.getdisplayregion.php                        26-Sep-2022 04:10                8602
locale.getdisplayscript.php                        26-Sep-2022 04:10                8624
locale.getdisplayvariant.php                       26-Sep-2022 04:10                8653
locale.getkeywords.php                             26-Sep-2022 04:10                6834
locale.getprimarylanguage.php                      26-Sep-2022 04:10                5614
locale.getregion.php                               26-Sep-2022 04:10                5465
locale.getscript.php                               26-Sep-2022 04:10                5458
locale.lookup.php                                  26-Sep-2022 04:10                8409
locale.parselocale.php                             26-Sep-2022 04:10                7175
locale.setdefault.php                              26-Sep-2022 04:10                5323
lua.assign.php                                     26-Sep-2022 04:10                4572
lua.call.php                                       26-Sep-2022 04:10                7043
lua.configuration.php                              26-Sep-2022 04:10                1273
lua.construct.php                                  26-Sep-2022 04:10                2342
lua.eval.php                                       26-Sep-2022 04:10                3771
lua.getversion.php                                 26-Sep-2022 04:10                2205
lua.include.php                                    26-Sep-2022 04:10                2644
lua.installation.php                               26-Sep-2022 04:10                2075
lua.registercallback.php                           26-Sep-2022 04:10                4550
lua.requirements.php                               26-Sep-2022 04:10                1313
lua.resources.php                                  26-Sep-2022 04:10                1207
lua.setup.php                                      26-Sep-2022 04:10                1566
luaclosure.invoke.php                              26-Sep-2022 04:10                4367
luasandbox.callfunction.php                        26-Sep-2022 04:10                4879
luasandbox.configuration.php                       26-Sep-2022 04:10                1322
luasandbox.disableprofiler.php                     26-Sep-2022 04:10                2842
luasandbox.enableprofiler.php                      26-Sep-2022 04:10                3392
luasandbox.examples-basic.php                      26-Sep-2022 04:10                7405
luasandbox.examples.php                            26-Sep-2022 04:10                1432
luasandbox.getcpuusage.php                         26-Sep-2022 04:10                3572
luasandbox.getmemoryusage.php                      26-Sep-2022 04:10                3152
luasandbox.getpeakmemoryusage.php                  26-Sep-2022 04:10                3202
luasandbox.getprofilerfunctionreport.php           26-Sep-2022 04:10                5645
luasandbox.getversioninfo.php                      26-Sep-2022 04:10                2898
luasandbox.installation.php                        26-Sep-2022 04:10                2166
luasandbox.loadbinary.php                          26-Sep-2022 04:10                3507
luasandbox.loadstring.php                          26-Sep-2022 04:10                5619
luasandbox.pauseusagetimer.php                     26-Sep-2022 04:10               10276
luasandbox.registerlibrary.php                     26-Sep-2022 04:10                6882
luasandbox.requirements.php                        26-Sep-2022 04:10                1769
luasandbox.resources.php                           26-Sep-2022 04:10                1272
luasandbox.setcpulimit.php                         26-Sep-2022 04:10                5983
luasandbox.setmemorylimit.php                      26-Sep-2022 04:10                5638
luasandbox.setup.php                               26-Sep-2022 04:10                1657
luasandbox.unpauseusagetimer.php                   26-Sep-2022 04:10                3138
luasandbox.wrapphpfunction.php                     26-Sep-2022 04:10                4325
luasandboxfunction.call.php                        26-Sep-2022 04:10                6850
luasandboxfunction.construct.php                   26-Sep-2022 04:10                2653
luasandboxfunction.dump.php                        26-Sep-2022 04:10                2357
lzf.configuration.php                              26-Sep-2022 04:10                1273
lzf.constants.php                                  26-Sep-2022 04:10                1110
lzf.installation.php                               26-Sep-2022 04:10                2565
lzf.requirements.php                               26-Sep-2022 04:10                1201
lzf.resources.php                                  26-Sep-2022 04:10                1205
lzf.setup.php                                      26-Sep-2022 04:10                1588
mail.configuration.php                             26-Sep-2022 04:10                7846
mail.constants.php                                 26-Sep-2022 04:10                1122
mail.installation.php                              26-Sep-2022 04:10                1252
mail.requirements.php                              26-Sep-2022 04:10                1870
mail.resources.php                                 26-Sep-2022 04:10                1212
mail.setup.php                                     26-Sep-2022 04:10                1602
mailparse.configuration.php                        26-Sep-2022 04:10                2542
mailparse.constants.php                            26-Sep-2022 04:10                1975
mailparse.installation.php                         26-Sep-2022 04:10                2660
mailparse.requirements.php                         26-Sep-2022 04:10                1243
mailparse.resources.php                            26-Sep-2022 04:10                1551
mailparse.setup.php                                26-Sep-2022 04:10                1666
manual.php                                         26-Sep-2022 04:10                1235
math.configuration.php                             26-Sep-2022 04:10                1280
math.constants.php                                 26-Sep-2022 04:10                6122
math.installation.php                              26-Sep-2022 04:10                1252
math.requirements.php                              26-Sep-2022 04:10                1208
math.resources.php                                 26-Sep-2022 04:10                1212
math.setup.php                                     26-Sep-2022 04:10                1595
mbstring.configuration.php                         26-Sep-2022 04:10               15262
mbstring.constants.php                             26-Sep-2022 04:10                5636
mbstring.encodings.php                             26-Sep-2022 04:10               15981
mbstring.http.php                                  26-Sep-2022 04:10                6442
mbstring.installation.php                          26-Sep-2022 04:10                5302
mbstring.ja-basic.php                              26-Sep-2022 04:10                4082
mbstring.overload.php                              26-Sep-2022 04:10                8263
mbstring.php4.req.php                              26-Sep-2022 04:10                4283
mbstring.requirements.php                          26-Sep-2022 04:10                1236
mbstring.resources.php                             26-Sep-2022 04:10                1240
mbstring.setup.php                                 26-Sep-2022 04:10                1690
mbstring.supported-encodings.php                   26-Sep-2022 04:10                8434
mcrypt.ciphers.php                                 26-Sep-2022 04:10                6326
mcrypt.configuration.php                           26-Sep-2022 04:10                3570
mcrypt.constants.php                               26-Sep-2022 04:10                5171
mcrypt.installation.php                            26-Sep-2022 04:10                1470
mcrypt.requirements.php                            26-Sep-2022 04:10                2244
mcrypt.resources.php                               26-Sep-2022 04:10                1323
mcrypt.setup.php                                   26-Sep-2022 04:10                1637
memcache.add.php                                   26-Sep-2022 04:10                6970
memcache.addserver.php                             26-Sep-2022 04:10               13671
memcache.close.php                                 26-Sep-2022 04:10                4959
memcache.connect.php                               26-Sep-2022 04:10                7316
memcache.constants.php                             26-Sep-2022 04:10                4266
memcache.decrement.php                             26-Sep-2022 04:10                7125
memcache.delete.php                                26-Sep-2022 04:10                6475
memcache.examples-overview.php                     26-Sep-2022 04:10                6786
memcache.examples.php                              26-Sep-2022 04:10                1376
memcache.flush.php                                 26-Sep-2022 04:10                4356
memcache.get.php                                   26-Sep-2022 04:10                8792
memcache.getextendedstats.php                      26-Sep-2022 04:10                8230
memcache.getserverstatus.php                       26-Sep-2022 04:10                6231
memcache.getstats.php                              26-Sep-2022 04:10                4631
memcache.getversion.php                            26-Sep-2022 04:10                4813
memcache.increment.php                             26-Sep-2022 04:10                6891
memcache.ini.php                                   26-Sep-2022 04:10                9577
memcache.installation.php                          26-Sep-2022 04:10                2211
memcache.pconnect.php                              26-Sep-2022 04:10                6261
memcache.replace.php                               26-Sep-2022 04:10                7148
memcache.requirements.php                          26-Sep-2022 04:10                1473
memcache.resources.php                             26-Sep-2022 04:10                1300
memcache.set.php                                   26-Sep-2022 04:10                9799
memcache.setcompressthreshold.php                  26-Sep-2022 04:10                5859
memcache.setserverparams.php                       26-Sep-2022 04:10               11116
memcache.setup.php                                 26-Sep-2022 04:10                1651
memcached.add.php                                  26-Sep-2022 04:10                4462
memcached.addbykey.php                             26-Sep-2022 04:10                5442
memcached.addserver.php                            26-Sep-2022 04:10                7656
memcached.addservers.php                           26-Sep-2022 04:10                5554
memcached.append.php                               26-Sep-2022 04:10                6829
memcached.appendbykey.php                          26-Sep-2022 04:10                4555
memcached.callbacks.php                            26-Sep-2022 04:10                1539
memcached.callbacks.read-through.php               26-Sep-2022 04:10                4683
memcached.callbacks.result.php                     26-Sep-2022 04:10                5102
memcached.cas.php                                  26-Sep-2022 04:10                9922
memcached.casbykey.php                             26-Sep-2022 04:10                5436
memcached.configuration.php                        26-Sep-2022 04:10               10577
memcached.constants.php                            26-Sep-2022 04:10               20052
memcached.construct.php                            26-Sep-2022 04:10                4565
memcached.decrement.php                            26-Sep-2022 04:10                8977
memcached.decrementbykey.php                       26-Sep-2022 04:10                5694
memcached.delete.php                               26-Sep-2022 04:10                5960
memcached.deletebykey.php                          26-Sep-2022 04:10                4826
memcached.deletemulti.php                          26-Sep-2022 04:10                4991
memcached.deletemultibykey.php                     26-Sep-2022 04:10                4889
memcached.expiration.php                           26-Sep-2022 04:10                2010
memcached.fetch.php                                26-Sep-2022 04:10                6610
memcached.fetchall.php                             26-Sep-2022 04:10                6411
memcached.flush.php                                26-Sep-2022 04:10                4668
memcached.get.php                                  26-Sep-2022 04:10                9222
memcached.getallkeys.php                           26-Sep-2022 04:10                2681
memcached.getbykey.php                             26-Sep-2022 04:10                5341
memcached.getdelayed.php                           26-Sep-2022 04:10                8437
memcached.getdelayedbykey.php                      26-Sep-2022 04:10                5306
memcached.getmulti.php                             26-Sep-2022 04:10               13283
memcached.getmultibykey.php                        26-Sep-2022 04:10                5182
memcached.getoption.php                            26-Sep-2022 04:10                5203
memcached.getresultcode.php                        26-Sep-2022 04:10                4306
memcached.getresultmessage.php                     26-Sep-2022 04:10                4695
memcached.getserverbykey.php                       26-Sep-2022 04:10                7294
memcached.getserverlist.php                        26-Sep-2022 04:10                4638
memcached.getstats.php                             26-Sep-2022 04:10                4999
memcached.getversion.php                           26-Sep-2022 04:10                3893
memcached.increment.php                            26-Sep-2022 04:10                8288
memcached.incrementbykey.php                       26-Sep-2022 04:10                5585
memcached.installation.php                         26-Sep-2022 04:10                2821
memcached.ispersistent.php                         26-Sep-2022 04:10                2837
memcached.ispristine.php                           26-Sep-2022 04:10                2768
memcached.prepend.php                              26-Sep-2022 04:10                6858
memcached.prependbykey.php                         26-Sep-2022 04:10                4584
memcached.quit.php                                 26-Sep-2022 04:10                2286
memcached.replace.php                              26-Sep-2022 04:10                4544
memcached.replacebykey.php                         26-Sep-2022 04:10                5520
memcached.requirements.php                         26-Sep-2022 04:10                1573
memcached.resetserverlist.php                      26-Sep-2022 04:10                3105
memcached.resources.php                            26-Sep-2022 04:10                1247
memcached.sessions.php                             26-Sep-2022 04:10                2469
memcached.set.php                                  26-Sep-2022 04:10                9175
memcached.setbykey.php                             26-Sep-2022 04:10                6977
memcached.setmulti.php                             26-Sep-2022 04:10                6232
memcached.setmultibykey.php                        26-Sep-2022 04:10                4768
memcached.setoption.php                            26-Sep-2022 04:10                6853
memcached.setoptions.php                           26-Sep-2022 04:10                6953
memcached.setsaslauthdata.php                      26-Sep-2022 04:10                3258
memcached.setup.php                                26-Sep-2022 04:10                1674
memcached.touch.php                                26-Sep-2022 04:10                3540
memcached.touchbykey.php                           26-Sep-2022 04:10                4448
messageformatter.create.php                        26-Sep-2022 04:10               10563
messageformatter.format.php                        26-Sep-2022 04:10                9737
messageformatter.formatmessage.php                 26-Sep-2022 04:10                9987
messageformatter.geterrorcode.php                  26-Sep-2022 04:10                7893
messageformatter.geterrormessage.php               26-Sep-2022 04:10                7895
messageformatter.getlocale.php                     26-Sep-2022 04:10                5514
messageformatter.getpattern.php                    26-Sep-2022 04:10               10236
messageformatter.parse.php                         26-Sep-2022 04:10                9679
messageformatter.parsemessage.php                  26-Sep-2022 04:10               10345
messageformatter.setpattern.php                    26-Sep-2022 04:10               10988
mhash.configuration.php                            26-Sep-2022 04:10                1287
mhash.constants.php                                26-Sep-2022 04:10                4944
mhash.examples.php                                 26-Sep-2022 04:10                3418
mhash.installation.php                             26-Sep-2022 04:10                1660
mhash.requirements.php                             26-Sep-2022 04:10                1360
mhash.resources.php                                26-Sep-2022 04:10                1219
mhash.setup.php                                    26-Sep-2022 04:10                1616
migration56.changed-functions.php                  26-Sep-2022 04:11                6745
migration56.constants.php                          26-Sep-2022 04:11                5237
migration56.deprecated.php                         26-Sep-2022 04:11                6389
migration56.extensions.php                         26-Sep-2022 04:11                4514
migration56.incompatible.php                       26-Sep-2022 04:11                9034
migration56.new-features.php                       26-Sep-2022 04:11               32039
migration56.new-functions.php                      26-Sep-2022 04:11                7542
migration56.openssl.php                            26-Sep-2022 04:11               27123
migration56.php                                    26-Sep-2022 04:11                2538
migration70.changed-functions.php                  26-Sep-2022 04:11                5251
migration70.classes.php                            26-Sep-2022 04:11                3909
migration70.constants.php                          26-Sep-2022 04:11                7114
migration70.deprecated.php                         26-Sep-2022 04:11                6049
migration70.incompatible.php                       26-Sep-2022 04:11               62950
migration70.new-features.php                       26-Sep-2022 04:11               46049
migration70.new-functions.php                      26-Sep-2022 04:11                7431
migration70.other-changes.php                      26-Sep-2022 04:11                3698
migration70.php                                    26-Sep-2022 04:11                2953
migration70.removed-exts-sapis.php                 26-Sep-2022 04:11                3158
migration70.sapi-changes.php                       26-Sep-2022 04:11                2056
migration71.changed-functions.php                  26-Sep-2022 04:11                6802
migration71.constants.php                          26-Sep-2022 04:11                7246
migration71.deprecated.php                         26-Sep-2022 04:11                2287
migration71.incompatible.php                       26-Sep-2022 04:11               30498
migration71.new-features.php                       26-Sep-2022 04:11               29103
migration71.new-functions.php                      26-Sep-2022 04:11                5090
migration71.other-changes.php                      26-Sep-2022 04:11                8444
migration71.php                                    26-Sep-2022 04:11                2588
migration71.windows-support.php                    26-Sep-2022 04:11                1700
migration72.constants.php                          26-Sep-2022 04:11               24730
migration72.deprecated.php                         26-Sep-2022 04:11               10479
migration72.incompatible.php                       26-Sep-2022 04:11               19995
migration72.new-features.php                       26-Sep-2022 04:11               18553
migration72.new-functions.php                      26-Sep-2022 04:11               24393
migration72.other-changes.php                      26-Sep-2022 04:11                5782
migration72.php                                    26-Sep-2022 04:11                2449
migration73.constants.php                          26-Sep-2022 04:11               17727
migration73.deprecated.php                         26-Sep-2022 04:11                8586
migration73.incompatible.php                       26-Sep-2022 04:11               19000
migration73.new-features.php                       26-Sep-2022 04:11               16723
migration73.new-functions.php                      26-Sep-2022 04:11                7401
migration73.other-changes.php                      26-Sep-2022 04:11               15457
migration73.php                                    26-Sep-2022 04:11                2613
migration73.windows-support.php                    26-Sep-2022 04:11                1917
migration74.constants.php                          26-Sep-2022 04:11                5895
migration74.deprecated.php                         26-Sep-2022 04:11               15250
migration74.incompatible.php                       26-Sep-2022 04:11               16730
migration74.new-classes.php                        26-Sep-2022 04:11                1505
migration74.new-features.php                       26-Sep-2022 04:11               22461
migration74.new-functions.php                      26-Sep-2022 04:11                3387
migration74.other-changes.php                      26-Sep-2022 04:11               21020
migration74.php                                    26-Sep-2022 04:11                2844
migration74.removed-extensions.php                 26-Sep-2022 04:11                1931
migration74.windows-support.php                    26-Sep-2022 04:11                3959
migration80.deprecated.php                         26-Sep-2022 04:11               18885
migration80.incompatible.php                       26-Sep-2022 04:11               94052
migration80.new-features.php                       26-Sep-2022 04:11               32691
migration80.other-changes.php                      26-Sep-2022 04:11               14268
migration80.php                                    26-Sep-2022 04:11                2460
migration81.constants.php                          26-Sep-2022 04:11                2520
migration81.deprecated.php                         26-Sep-2022 04:11               17195
migration81.incompatible.php                       26-Sep-2022 04:11               18214
migration81.new-classes.php                        26-Sep-2022 04:11                1451
migration81.new-features.php                       26-Sep-2022 04:11               21902
migration81.new-functions.php                      26-Sep-2022 04:11                7435
migration81.other-changes.php                      26-Sep-2022 04:11                9559
migration81.php                                    26-Sep-2022 04:11                2651
misc.configuration.php                             26-Sep-2022 04:10                5647
misc.constants.php                                 26-Sep-2022 04:10                2141
misc.installation.php                              26-Sep-2022 04:10                1252
misc.requirements.php                              26-Sep-2022 04:10                1208
misc.resources.php                                 26-Sep-2022 04:10                1212
misc.setup.php                                     26-Sep-2022 04:10                1588
mongodb-bson-binary.construct.php                  26-Sep-2022 04:10                7095
mongodb-bson-binary.getdata.php                    26-Sep-2022 04:10                4663
mongodb-bson-binary.gettype.php                    26-Sep-2022 04:10                4647
mongodb-bson-binary.jsonserialize.php              26-Sep-2022 04:10                5537
mongodb-bson-binary.serialize.php                  26-Sep-2022 04:10                3503
mongodb-bson-binary.tostring.php                   26-Sep-2022 04:10                4426
mongodb-bson-binary.unserialize.php                26-Sep-2022 04:10                4347
mongodb-bson-binaryinterface.getdata.php           26-Sep-2022 04:10                2773
mongodb-bson-binaryinterface.gettype.php           26-Sep-2022 04:10                2785
mongodb-bson-binaryinterface.tostring.php          26-Sep-2022 04:10                3252
mongodb-bson-dbpointer.construct.php               26-Sep-2022 04:10                2656
mongodb-bson-dbpointer.jsonserialize.php           26-Sep-2022 04:10                5606
mongodb-bson-dbpointer.serialize.php               26-Sep-2022 04:10                3578
mongodb-bson-dbpointer.tostring.php                26-Sep-2022 04:10                2615
mongodb-bson-dbpointer.unserialize.php             26-Sep-2022 04:10                3816
mongodb-bson-decimal128.construct.php              26-Sep-2022 04:10                6120
mongodb-bson-decimal128.jsonserialize.php          26-Sep-2022 04:10                5627
mongodb-bson-decimal128.serialize.php              26-Sep-2022 04:10                3603
mongodb-bson-decimal128.tostring.php               26-Sep-2022 04:10                4933
mongodb-bson-decimal128.unserialize.php            26-Sep-2022 04:10                4439
mongodb-bson-decimal128interface.tostring.php      26-Sep-2022 04:10                2936
mongodb-bson-int64.construct.php                   26-Sep-2022 04:10                2604
mongodb-bson-int64.jsonserialize.php               26-Sep-2022 04:10                5283
mongodb-bson-int64.serialize.php                   26-Sep-2022 04:10                3480
mongodb-bson-int64.tostring.php                    26-Sep-2022 04:10                3837
mongodb-bson-int64.unserialize.php                 26-Sep-2022 04:10                4318
mongodb-bson-javascript.construct.php              26-Sep-2022 04:10                7195
mongodb-bson-javascript.getcode.php                26-Sep-2022 04:10                4511
mongodb-bson-javascript.getscope.php               26-Sep-2022 04:10                5579
mongodb-bson-javascript.jsonserialize.php          26-Sep-2022 04:10                5623
mongodb-bson-javascript.serialize.php              26-Sep-2022 04:10                3603
mongodb-bson-javascript.tostring.php               26-Sep-2022 04:10                4296
mongodb-bson-javascript.unserialize.php            26-Sep-2022 04:10                4431
mongodb-bson-javascriptinterface.getcode.php       26-Sep-2022 04:10                2867
mongodb-bson-javascriptinterface.getscope.php      26-Sep-2022 04:10                2976
mongodb-bson-javascriptinterface.tostring.php      26-Sep-2022 04:10                3350
mongodb-bson-maxkey.construct.php                  26-Sep-2022 04:10                3789
mongodb-bson-maxkey.jsonserialize.php              26-Sep-2022 04:10                5543
mongodb-bson-maxkey.serialize.php                  26-Sep-2022 04:10                3507
mongodb-bson-maxkey.unserialize.php                26-Sep-2022 04:10                3749
mongodb-bson-minkey.construct.php                  26-Sep-2022 04:10                3789
mongodb-bson-minkey.jsonserialize.php              26-Sep-2022 04:10                5543
mongodb-bson-minkey.serialize.php                  26-Sep-2022 04:10                3507
mongodb-bson-minkey.unserialize.php                26-Sep-2022 04:10                3753
mongodb-bson-objectid.construct.php                26-Sep-2022 04:10                5401
mongodb-bson-objectid.gettimestamp.php             26-Sep-2022 04:10                5768
mongodb-bson-objectid.jsonserialize.php            26-Sep-2022 04:10                5589
mongodb-bson-objectid.serialize.php                26-Sep-2022 04:10                3555
mongodb-bson-objectid.tostring.php                 26-Sep-2022 04:10                4425
mongodb-bson-objectid.unserialize.php              26-Sep-2022 04:10                4385
mongodb-bson-objectidinterface.gettimestamp.php    26-Sep-2022 04:10                2938
mongodb-bson-objectidinterface.tostring.php        26-Sep-2022 04:10                2920
mongodb-bson-regex.construct.php                   26-Sep-2022 04:10                6985
mongodb-bson-regex.getflags.php                    26-Sep-2022 04:10                4622
mongodb-bson-regex.getpattern.php                  26-Sep-2022 04:10                4469
mongodb-bson-regex.jsonserialize.php               26-Sep-2022 04:10                5522
mongodb-bson-regex.serialize.php                   26-Sep-2022 04:10                3478
mongodb-bson-regex.tostring.php                    26-Sep-2022 04:10                3973
mongodb-bson-regex.unserialize.php                 26-Sep-2022 04:10                4322
mongodb-bson-regexinterface.getflags.php           26-Sep-2022 04:10                2772
mongodb-bson-regexinterface.getpattern.php         26-Sep-2022 04:10                2815
mongodb-bson-regexinterface.tostring.php           26-Sep-2022 04:10                2846
mongodb-bson-serializable.bsonserialize.php        26-Sep-2022 04:10               16204
mongodb-bson-symbol.construct.php                  26-Sep-2022 04:10                2596
mongodb-bson-symbol.jsonserialize.php              26-Sep-2022 04:10                5543
mongodb-bson-symbol.serialize.php                  26-Sep-2022 04:10                3503
mongodb-bson-symbol.tostring.php                   26-Sep-2022 04:10                2593
mongodb-bson-symbol.unserialize.php                26-Sep-2022 04:10                3755
mongodb-bson-timestamp.construct.php               26-Sep-2022 04:10                4762
mongodb-bson-timestamp.getincrement.php            26-Sep-2022 04:10                4299
mongodb-bson-timestamp.gettimestamp.php            26-Sep-2022 04:10                4284
mongodb-bson-timestamp.jsonserialize.php           26-Sep-2022 04:10                5610
mongodb-bson-timestamp.serialize.php               26-Sep-2022 04:10                3578
mongodb-bson-timestamp.tostring.php                26-Sep-2022 04:10                4113
mongodb-bson-timestamp.unserialize.php             26-Sep-2022 04:10                4418
mongodb-bson-timestampinterface.getincrement.php   26-Sep-2022 04:10                3306
mongodb-bson-timestampinterface.gettimestamp.php   26-Sep-2022 04:10                3321
mongodb-bson-timestampinterface.tostring.php       26-Sep-2022 04:10                2938
mongodb-bson-undefined.construct.php               26-Sep-2022 04:10                2656
mongodb-bson-undefined.jsonserialize.php           26-Sep-2022 04:10                5606
mongodb-bson-undefined.serialize.php               26-Sep-2022 04:10                3578
mongodb-bson-undefined.tostring.php                26-Sep-2022 04:10                2615
mongodb-bson-undefined.unserialize.php             26-Sep-2022 04:10                3817
mongodb-bson-unserializable.bsonunserialize.php    26-Sep-2022 04:10                7556
mongodb-bson-utcdatetime.construct.php             26-Sep-2022 04:10                8139
mongodb-bson-utcdatetime.jsonserialize.php         26-Sep-2022 04:10                5648
mongodb-bson-utcdatetime.serialize.php             26-Sep-2022 04:10                3630
mongodb-bson-utcdatetime.todatetime.php            26-Sep-2022 04:10                6003
mongodb-bson-utcdatetime.tostring.php              26-Sep-2022 04:10                4066
mongodb-bson-utcdatetime.unserialize.php           26-Sep-2022 04:10                4450
mongodb-bson-utcdatetimeinterface.todatetime.php   26-Sep-2022 04:10                3275
mongodb-bson-utcdatetimeinterface.tostring.php     26-Sep-2022 04:10                2954
mongodb-driver-bulkwrite.construct.php             26-Sep-2022 04:10               18649
mongodb-driver-bulkwrite.count.php                 26-Sep-2022 04:10                7125
mongodb-driver-bulkwrite.delete.php                26-Sep-2022 04:10               11480
mongodb-driver-bulkwrite.insert.php                26-Sep-2022 04:10               10091
mongodb-driver-bulkwrite.update.php                26-Sep-2022 04:10               14737
mongodb-driver-clientencryption.createdatakey.php  26-Sep-2022 04:10               10127
mongodb-driver-clientencryption.decrypt.php        26-Sep-2022 04:10                4282
mongodb-driver-clientencryption.encrypt.php        26-Sep-2022 04:10                6158
mongodb-driver-command.construct.php               26-Sep-2022 04:10               15320
mongodb-driver-commandexception.getresultdocume..> 26-Sep-2022 04:10                3188
mongodb-driver-cursor.construct.php                26-Sep-2022 04:10                3375
mongodb-driver-cursor.current.php                  26-Sep-2022 04:10                2841
mongodb-driver-cursor.getid.php                    26-Sep-2022 04:10                8357
mongodb-driver-cursor.getserver.php                26-Sep-2022 04:10                8005
mongodb-driver-cursor.isdead.php                   26-Sep-2022 04:10               11128
mongodb-driver-cursor.key.php                      26-Sep-2022 04:10                2591
mongodb-driver-cursor.next.php                     26-Sep-2022 04:10                3549
mongodb-driver-cursor.rewind.php                   26-Sep-2022 04:10                3968
mongodb-driver-cursor.settypemap.php               26-Sep-2022 04:10                8419
mongodb-driver-cursor.toarray.php                  26-Sep-2022 04:10                8102
mongodb-driver-cursor.valid.php                    26-Sep-2022 04:10                2695
mongodb-driver-cursorid.construct.php              26-Sep-2022 04:10                2818
mongodb-driver-cursorid.serialize.php              26-Sep-2022 04:10                3601
mongodb-driver-cursorid.tostring.php               26-Sep-2022 04:10                7520
mongodb-driver-cursorid.unserialize.php            26-Sep-2022 04:10                4457
mongodb-driver-cursorinterface.getid.php           26-Sep-2022 04:10                4069
mongodb-driver-cursorinterface.getserver.php       26-Sep-2022 04:10                4155
mongodb-driver-cursorinterface.isdead.php          26-Sep-2022 04:10                4001
mongodb-driver-cursorinterface.settypemap.php      26-Sep-2022 04:10                4010
mongodb-driver-cursorinterface.toarray.php         26-Sep-2022 04:10                3901
mongodb-driver-manager.addsubscriber.php           26-Sep-2022 04:10                5138
mongodb-driver-manager.construct.php               26-Sep-2022 04:10               65745
mongodb-driver-manager.createclientencryption.php  26-Sep-2022 04:10               10201
mongodb-driver-manager.executebulkwrite.php        26-Sep-2022 04:10               23709
mongodb-driver-manager.executecommand.php          26-Sep-2022 04:10               25827
mongodb-driver-manager.executequery.php            26-Sep-2022 04:10               16849
mongodb-driver-manager.executereadcommand.php      26-Sep-2022 04:10                9760
mongodb-driver-manager.executereadwritecommand.php 26-Sep-2022 04:10               10743
mongodb-driver-manager.executewritecommand.php     26-Sep-2022 04:10               10905
mongodb-driver-manager.getencryptedfieldsmap.php   26-Sep-2022 04:10                3712
mongodb-driver-manager.getreadconcern.php          26-Sep-2022 04:10                6235
mongodb-driver-manager.getreadpreference.php       26-Sep-2022 04:10                6830
mongodb-driver-manager.getservers.php              26-Sep-2022 04:10                8144
mongodb-driver-manager.getwriteconcern.php         26-Sep-2022 04:10                6288
mongodb-driver-manager.removesubscriber.php        26-Sep-2022 04:10                4998
mongodb-driver-manager.selectserver.php            26-Sep-2022 04:10                7099
mongodb-driver-manager.startsession.php            26-Sep-2022 04:10               11569
mongodb-driver-monitoring-commandfailedevent.ge..> 26-Sep-2022 04:10                3681
mongodb-driver-monitoring-commandfailedevent.ge..> 26-Sep-2022 04:10                3776
mongodb-driver-monitoring-commandfailedevent.ge..> 26-Sep-2022 04:10                3665
mongodb-driver-monitoring-commandfailedevent.ge..> 26-Sep-2022 04:10                4833
mongodb-driver-monitoring-commandfailedevent.ge..> 26-Sep-2022 04:10                3981
mongodb-driver-monitoring-commandfailedevent.ge..> 26-Sep-2022 04:10                4247
mongodb-driver-monitoring-commandfailedevent.ge..> 26-Sep-2022 04:10                4215
mongodb-driver-monitoring-commandfailedevent.ge..> 26-Sep-2022 04:10                3697
mongodb-driver-monitoring-commandstartedevent.g..> 26-Sep-2022 04:10                3988
mongodb-driver-monitoring-commandstartedevent.g..> 26-Sep-2022 04:10                3713
mongodb-driver-monitoring-commandstartedevent.g..> 26-Sep-2022 04:10                3615
mongodb-driver-monitoring-commandstartedevent.g..> 26-Sep-2022 04:10                5157
mongodb-driver-monitoring-commandstartedevent.g..> 26-Sep-2022 04:10                4723
mongodb-driver-monitoring-commandstartedevent.g..> 26-Sep-2022 04:10                4539
mongodb-driver-monitoring-commandstartedevent.g..> 26-Sep-2022 04:10                3899
mongodb-driver-monitoring-commandstartedevent.g..> 26-Sep-2022 04:10                3741
mongodb-driver-monitoring-commandsubscriber.com..> 26-Sep-2022 04:10                4965
mongodb-driver-monitoring-commandsubscriber.com..> 26-Sep-2022 04:10                5015
mongodb-driver-monitoring-commandsubscriber.com..> 26-Sep-2022 04:10                5030
mongodb-driver-monitoring-commandsucceededevent..> 26-Sep-2022 04:10                3738
mongodb-driver-monitoring-commandsucceededevent..> 26-Sep-2022 04:10                3845
mongodb-driver-monitoring-commandsucceededevent..> 26-Sep-2022 04:10                4920
mongodb-driver-monitoring-commandsucceededevent..> 26-Sep-2022 04:10                4038
mongodb-driver-monitoring-commandsucceededevent..> 26-Sep-2022 04:10                4310
mongodb-driver-monitoring-commandsucceededevent..> 26-Sep-2022 04:10                4768
mongodb-driver-monitoring-commandsucceededevent..> 26-Sep-2022 04:10                3939
mongodb-driver-monitoring-commandsucceededevent..> 26-Sep-2022 04:10                3767
mongodb-driver-monitoring-sdamsubscriber.server..> 26-Sep-2022 04:10                4833
mongodb-driver-monitoring-sdamsubscriber.server..> 26-Sep-2022 04:10                4803
mongodb-driver-monitoring-sdamsubscriber.server..> 26-Sep-2022 04:10                5370
mongodb-driver-monitoring-sdamsubscriber.server..> 26-Sep-2022 04:10                5415
mongodb-driver-monitoring-sdamsubscriber.server..> 26-Sep-2022 04:10                5446
mongodb-driver-monitoring-sdamsubscriber.server..> 26-Sep-2022 04:10                4833
mongodb-driver-monitoring-sdamsubscriber.topolo..> 26-Sep-2022 04:10                4908
mongodb-driver-monitoring-sdamsubscriber.topolo..> 26-Sep-2022 04:10                4845
mongodb-driver-monitoring-sdamsubscriber.topolo..> 26-Sep-2022 04:10                4828
mongodb-driver-monitoring-serverchangedevent.ge..> 26-Sep-2022 04:10                3133
mongodb-driver-monitoring-serverchangedevent.ge..> 26-Sep-2022 04:10                3509
mongodb-driver-monitoring-serverchangedevent.ge..> 26-Sep-2022 04:10                3203
mongodb-driver-monitoring-serverchangedevent.ge..> 26-Sep-2022 04:10                3586
mongodb-driver-monitoring-serverchangedevent.ge..> 26-Sep-2022 04:10                3309
mongodb-driver-monitoring-serverclosedevent.get..> 26-Sep-2022 04:10                3095
mongodb-driver-monitoring-serverclosedevent.get..> 26-Sep-2022 04:10                3147
mongodb-driver-monitoring-serverclosedevent.get..> 26-Sep-2022 04:10                3265
mongodb-driver-monitoring-serverheartbeatfailed..> 26-Sep-2022 04:10                3583
mongodb-driver-monitoring-serverheartbeatfailed..> 26-Sep-2022 04:10                3493
mongodb-driver-monitoring-serverheartbeatfailed..> 26-Sep-2022 04:10                3270
mongodb-driver-monitoring-serverheartbeatfailed..> 26-Sep-2022 04:10                3301
mongodb-driver-monitoring-serverheartbeatfailed..> 26-Sep-2022 04:10                3552
mongodb-driver-monitoring-serverheartbeatstarte..> 26-Sep-2022 04:10                3275
mongodb-driver-monitoring-serverheartbeatstarte..> 26-Sep-2022 04:10                3319
mongodb-driver-monitoring-serverheartbeatstarte..> 26-Sep-2022 04:10                3572
mongodb-driver-monitoring-serverheartbeatsuccee..> 26-Sep-2022 04:10                3635
mongodb-driver-monitoring-serverheartbeatsuccee..> 26-Sep-2022 04:10                3342
mongodb-driver-monitoring-serverheartbeatsuccee..> 26-Sep-2022 04:10                3353
mongodb-driver-monitoring-serverheartbeatsuccee..> 26-Sep-2022 04:10                4175
mongodb-driver-monitoring-serverheartbeatsuccee..> 26-Sep-2022 04:10                3588
mongodb-driver-monitoring-serveropeningevent.ge..> 26-Sep-2022 04:10                3113
mongodb-driver-monitoring-serveropeningevent.ge..> 26-Sep-2022 04:10                3165
mongodb-driver-monitoring-serveropeningevent.ge..> 26-Sep-2022 04:10                3297
mongodb-driver-monitoring-topologychangedevent...> 26-Sep-2022 04:10                3578
mongodb-driver-monitoring-topologychangedevent...> 26-Sep-2022 04:10                3656
mongodb-driver-monitoring-topologychangedevent...> 26-Sep-2022 04:10                3317
mongodb-driver-monitoring-topologyclosedevent.g..> 26-Sep-2022 04:10                3262
mongodb-driver-monitoring-topologyopeningevent...> 26-Sep-2022 04:10                3272
mongodb-driver-query.construct.php                 26-Sep-2022 04:10               30133
mongodb-driver-readconcern.bsonserialize.php       26-Sep-2022 04:10                7768
mongodb-driver-readconcern.construct.php           26-Sep-2022 04:10                6425
mongodb-driver-readconcern.getlevel.php            26-Sep-2022 04:10                6441
mongodb-driver-readconcern.isdefault.php           26-Sep-2022 04:10                8719
mongodb-driver-readconcern.serialize.php           26-Sep-2022 04:10                3678
mongodb-driver-readconcern.unserialize.php         26-Sep-2022 04:10                4508
mongodb-driver-readpreference.bsonserialize.php    26-Sep-2022 04:10               12409
mongodb-driver-readpreference.construct.php        26-Sep-2022 04:10               18110
mongodb-driver-readpreference.gethedge.php         26-Sep-2022 04:10                3333
mongodb-driver-readpreference.getmaxstalenessse..> 26-Sep-2022 04:10                9615
mongodb-driver-readpreference.getmode.php          26-Sep-2022 04:10                8960
mongodb-driver-readpreference.getmodestring.php    26-Sep-2022 04:10                9164
mongodb-driver-readpreference.gettagsets.php       26-Sep-2022 04:10                9161
mongodb-driver-readpreference.serialize.php        26-Sep-2022 04:10                3755
mongodb-driver-readpreference.unserialize.php      26-Sep-2022 04:10                4587
mongodb-driver-runtimeexception.haserrorlabel.php  26-Sep-2022 04:10                4172
mongodb-driver-server.construct.php                26-Sep-2022 04:10                3377
mongodb-driver-server.executebulkwrite.php         26-Sep-2022 04:10               10693
mongodb-driver-server.executecommand.php           26-Sep-2022 04:10               12492
mongodb-driver-server.executequery.php             26-Sep-2022 04:10                7952
mongodb-driver-server.executereadcommand.php       26-Sep-2022 04:10               10110
mongodb-driver-server.executereadwritecommand.php  26-Sep-2022 04:10               11256
mongodb-driver-server.executewritecommand.php      26-Sep-2022 04:10               11384
mongodb-driver-server.gethost.php                  26-Sep-2022 04:10                5882
mongodb-driver-server.getinfo.php                  26-Sep-2022 04:10               10915
mongodb-driver-server.getlatency.php               26-Sep-2022 04:10                7412
mongodb-driver-server.getport.php                  26-Sep-2022 04:10                5926
mongodb-driver-server.getserverdescription.php     26-Sep-2022 04:10                3433
mongodb-driver-server.gettags.php                  26-Sep-2022 04:10                3576
mongodb-driver-server.gettype.php                  26-Sep-2022 04:10                3687
mongodb-driver-server.isarbiter.php                26-Sep-2022 04:10                3501
mongodb-driver-server.ishidden.php                 26-Sep-2022 04:10                3495
mongodb-driver-server.ispassive.php                26-Sep-2022 04:10                3563
mongodb-driver-server.isprimary.php                26-Sep-2022 04:10                3508
mongodb-driver-server.issecondary.php              26-Sep-2022 04:10                3543
mongodb-driver-serverapi.bsonserialize.php         26-Sep-2022 04:10                3275
mongodb-driver-serverapi.construct.php             26-Sep-2022 04:10                2953
mongodb-driver-serverapi.serialize.php             26-Sep-2022 04:10                3631
mongodb-driver-serverapi.unserialize.php           26-Sep-2022 04:10                4475
mongodb-driver-serverdescription.gethellorespon..> 26-Sep-2022 04:10                5193
mongodb-driver-serverdescription.gethost.php       26-Sep-2022 04:10                3412
mongodb-driver-serverdescription.getlastupdatet..> 26-Sep-2022 04:10                3550
mongodb-driver-serverdescription.getport.php       26-Sep-2022 04:10                3469
mongodb-driver-serverdescription.getroundtripti..> 26-Sep-2022 04:10                3759
mongodb-driver-serverdescription.gettype.php       26-Sep-2022 04:10                3682
mongodb-driver-session.aborttransaction.php        26-Sep-2022 04:10                4249
mongodb-driver-session.advanceclustertime.php      26-Sep-2022 04:10                4784
mongodb-driver-session.advanceoperationtime.php    26-Sep-2022 04:10                4842
mongodb-driver-session.committransaction.php       26-Sep-2022 04:10                5657
mongodb-driver-session.construct.php               26-Sep-2022 04:10                2885
mongodb-driver-session.endsession.php              26-Sep-2022 04:10                4381
mongodb-driver-session.getclustertime.php          26-Sep-2022 04:10                3782
mongodb-driver-session.getlogicalsessionid.php     26-Sep-2022 04:10                3083
mongodb-driver-session.getoperationtime.php        26-Sep-2022 04:10                3922
mongodb-driver-session.getserver.php               26-Sep-2022 04:10                3800
mongodb-driver-session.gettransactionoptions.php   26-Sep-2022 04:10                3632
mongodb-driver-session.gettransactionstate.php     26-Sep-2022 04:10                3714
mongodb-driver-session.isdirty.php                 26-Sep-2022 04:10                2969
mongodb-driver-session.isintransaction.php         26-Sep-2022 04:10                3659
mongodb-driver-session.starttransaction.php        26-Sep-2022 04:10                8682
mongodb-driver-topologydescription.getservers.php  26-Sep-2022 04:10                3412
mongodb-driver-topologydescription.gettype.php     26-Sep-2022 04:10                3338
mongodb-driver-topologydescription.hasreadables..> 26-Sep-2022 04:10                3817
mongodb-driver-topologydescription.haswritables..> 26-Sep-2022 04:10                3179
mongodb-driver-writeconcern.bsonserialize.php      26-Sep-2022 04:10                8223
mongodb-driver-writeconcern.construct.php          26-Sep-2022 04:10               10457
mongodb-driver-writeconcern.getjournal.php         26-Sep-2022 04:10                6360
mongodb-driver-writeconcern.getw.php               26-Sep-2022 04:10                5556
mongodb-driver-writeconcern.getwtimeout.php        26-Sep-2022 04:10                6640
mongodb-driver-writeconcern.isdefault.php          26-Sep-2022 04:10                8218
mongodb-driver-writeconcern.serialize.php          26-Sep-2022 04:10                3703
mongodb-driver-writeconcern.unserialize.php        26-Sep-2022 04:10                4547
mongodb-driver-writeconcernerror.getcode.php       26-Sep-2022 04:10                7032
mongodb-driver-writeconcernerror.getinfo.php       26-Sep-2022 04:10                7249
mongodb-driver-writeconcernerror.getmessage.php    26-Sep-2022 04:10                7121
mongodb-driver-writeerror.getcode.php              26-Sep-2022 04:10                6201
mongodb-driver-writeerror.getindex.php             26-Sep-2022 04:10                6744
mongodb-driver-writeerror.getinfo.php              26-Sep-2022 04:10                2973
mongodb-driver-writeerror.getmessage.php           26-Sep-2022 04:10                6335
mongodb-driver-writeexception.getwriteresult.php   26-Sep-2022 04:10                8732
mongodb-driver-writeresult.getdeletedcount.php     26-Sep-2022 04:10                8470
mongodb-driver-writeresult.getinsertedcount.php    26-Sep-2022 04:10                8552
mongodb-driver-writeresult.getmatchedcount.php     26-Sep-2022 04:10                9130
mongodb-driver-writeresult.getmodifiedcount.php    26-Sep-2022 04:10                9377
mongodb-driver-writeresult.getserver.php           26-Sep-2022 04:10                7178
mongodb-driver-writeresult.getupsertedcount.php    26-Sep-2022 04:10                8707
mongodb-driver-writeresult.getupsertedids.php      26-Sep-2022 04:10                9245
mongodb-driver-writeresult.getwriteconcernerror..> 26-Sep-2022 04:10                7876
mongodb-driver-writeresult.getwriteerrors.php      26-Sep-2022 04:10               14490
mongodb-driver-writeresult.isacknowledged.php      26-Sep-2022 04:10                8837
mongodb.architecture.php                           26-Sep-2022 04:10                2004
mongodb.configuration.php                          26-Sep-2022 04:10                5447
mongodb.connection-handling.php                    26-Sep-2022 04:10               10532
mongodb.constants.php                              26-Sep-2022 04:10                1916
mongodb.exceptions.php                             26-Sep-2022 04:10                5159
mongodb.exceptions.tree.php                        26-Sep-2022 04:10                5566
mongodb.installation.hhvm.php                      26-Sep-2022 04:10                3882
mongodb.installation.homebrew.php                  26-Sep-2022 04:10                2113
mongodb.installation.manual.php                    26-Sep-2022 04:10                3374
mongodb.installation.pecl.php                      26-Sep-2022 04:10                3624
mongodb.installation.php                           26-Sep-2022 04:10                2016
mongodb.installation.windows.php                   26-Sep-2022 04:10                3058
mongodb.monitoring.php                             26-Sep-2022 04:10               18355
mongodb.overview.php                               26-Sep-2022 04:10                8035
mongodb.persistence.deserialization.php            26-Sep-2022 04:10               20106
mongodb.persistence.php                            26-Sep-2022 04:10                1880
mongodb.persistence.serialization.php              26-Sep-2022 04:10               23791
mongodb.requirements.php                           26-Sep-2022 04:10                1307
mongodb.security.php                               26-Sep-2022 04:10                1492
mongodb.security.request_injection.php             26-Sep-2022 04:10                3004
mongodb.security.script_injection.php              26-Sep-2022 04:10               10549
mongodb.setup.php                                  26-Sep-2022 04:10                2274
mongodb.tutorial.apm.php                           26-Sep-2022 04:10               24298
mongodb.tutorial.library.php                       26-Sep-2022 04:10               12038
mongodb.tutorial.php                               26-Sep-2022 04:10                1726
mqseries.configure.php                             26-Sep-2022 04:10                2875
mqseries.constants.php                             26-Sep-2022 04:10                2121
mqseries.ini.php                                   26-Sep-2022 04:10                1361
mqseries.requirements.php                          26-Sep-2022 04:10                1624
mqseries.resources.php                             26-Sep-2022 04:10                1682
mqseries.setup.php                                 26-Sep-2022 04:10                1650
multipleiterator.attachiterator.php                26-Sep-2022 04:10                4106
multipleiterator.construct.php                     26-Sep-2022 04:10                8387
multipleiterator.containsiterator.php              26-Sep-2022 04:10                3363
multipleiterator.countiterators.php                26-Sep-2022 04:10                3063
multipleiterator.current.php                       26-Sep-2022 04:10                3702
multipleiterator.detachiterator.php                26-Sep-2022 04:10                3245
multipleiterator.getflags.php                      26-Sep-2022 04:10                3229
multipleiterator.key.php                           26-Sep-2022 04:10                3595
multipleiterator.next.php                          26-Sep-2022 04:10                2907
multipleiterator.rewind.php                        26-Sep-2022 04:10                2920
multipleiterator.setflags.php                      26-Sep-2022 04:10                3548
multipleiterator.valid.php                         26-Sep-2022 04:10                2972
mysql-xdevapi-baseresult.getwarnings.php           26-Sep-2022 04:10                7044
mysql-xdevapi-baseresult.getwarningscount.php      26-Sep-2022 04:10                6776
mysql-xdevapi-client.close.php                     26-Sep-2022 04:10                2320
mysql-xdevapi-client.construct.php                 26-Sep-2022 04:10                3602
mysql-xdevapi-client.getsession.php                26-Sep-2022 04:10                2386
mysql-xdevapi-collection.add.php                   26-Sep-2022 04:10                9923
mysql-xdevapi-collection.addorreplaceone.php       26-Sep-2022 04:10                8566
mysql-xdevapi-collection.construct.php             26-Sep-2022 04:10                6784
mysql-xdevapi-collection.count.php                 26-Sep-2022 04:10                6895
mysql-xdevapi-collection.createindex.php           26-Sep-2022 04:10               10053
mysql-xdevapi-collection.dropindex.php             26-Sep-2022 04:10                6922
mysql-xdevapi-collection.existsindatabase.php      26-Sep-2022 04:10                6167
mysql-xdevapi-collection.find.php                  26-Sep-2022 04:10               10195
mysql-xdevapi-collection.getname.php               26-Sep-2022 04:10                5225
mysql-xdevapi-collection.getone.php                26-Sep-2022 04:10                7463
mysql-xdevapi-collection.getschema.php             26-Sep-2022 04:10                5432
mysql-xdevapi-collection.getsession.php            26-Sep-2022 04:10                5707
mysql-xdevapi-collection.modify.php                26-Sep-2022 04:10                8535
mysql-xdevapi-collection.remove.php                26-Sep-2022 04:10                8865
mysql-xdevapi-collection.removeone.php             26-Sep-2022 04:10                8109
mysql-xdevapi-collection.replaceone.php            26-Sep-2022 04:10                8381
mysql-xdevapi-collectionadd.construct.php          26-Sep-2022 04:10                8387
mysql-xdevapi-collectionadd.execute.php            26-Sep-2022 04:10                8373
mysql-xdevapi-collectionfind.bind.php              26-Sep-2022 04:10                8267
mysql-xdevapi-collectionfind.construct.php         26-Sep-2022 04:10                7265
mysql-xdevapi-collectionfind.execute.php           26-Sep-2022 04:10                7442
mysql-xdevapi-collectionfind.fields.php            26-Sep-2022 04:10                7869
mysql-xdevapi-collectionfind.groupby.php           26-Sep-2022 04:10                4344
mysql-xdevapi-collectionfind.having.php            26-Sep-2022 04:10                4588
mysql-xdevapi-collectionfind.limit.php             26-Sep-2022 04:10                8534
mysql-xdevapi-collectionfind.lockexclusive.php     26-Sep-2022 04:10                6708
mysql-xdevapi-collectionfind.lockshared.php        26-Sep-2022 04:10                6511
mysql-xdevapi-collectionfind.offset.php            26-Sep-2022 04:10                8281
mysql-xdevapi-collectionfind.sort.php              26-Sep-2022 04:10                8391
mysql-xdevapi-collectionmodify.arrayappend.php     26-Sep-2022 04:10                8350
mysql-xdevapi-collectionmodify.arrayinsert.php     26-Sep-2022 04:10                8769
mysql-xdevapi-collectionmodify.bind.php            26-Sep-2022 04:10                8494
mysql-xdevapi-collectionmodify.construct.php       26-Sep-2022 04:10                7130
mysql-xdevapi-collectionmodify.execute.php         26-Sep-2022 04:10                3276
mysql-xdevapi-collectionmodify.limit.php           26-Sep-2022 04:10                8945
mysql-xdevapi-collectionmodify.patch.php           26-Sep-2022 04:10                4207
mysql-xdevapi-collectionmodify.replace.php         26-Sep-2022 04:10                8167
mysql-xdevapi-collectionmodify.set.php             26-Sep-2022 04:10                8109
mysql-xdevapi-collectionmodify.skip.php            26-Sep-2022 04:10                4876
mysql-xdevapi-collectionmodify.sort.php            26-Sep-2022 04:10                4919
mysql-xdevapi-collectionmodify.unset.php           26-Sep-2022 04:10                4507
mysql-xdevapi-collectionremove.bind.php            26-Sep-2022 04:10                5168
mysql-xdevapi-collectionremove.construct.php       26-Sep-2022 04:10                7645
mysql-xdevapi-collectionremove.execute.php         26-Sep-2022 04:10                4068
mysql-xdevapi-collectionremove.limit.php           26-Sep-2022 04:10                4508
mysql-xdevapi-collectionremove.sort.php            26-Sep-2022 04:10                4586
mysql-xdevapi-columnresult.construct.php           26-Sep-2022 04:10               10002
mysql-xdevapi-columnresult.getcharactersetname.php 26-Sep-2022 04:10                3268
mysql-xdevapi-columnresult.getcollationname.php    26-Sep-2022 04:10                3247
mysql-xdevapi-columnresult.getcolumnlabel.php      26-Sep-2022 04:10                3213
mysql-xdevapi-columnresult.getcolumnname.php       26-Sep-2022 04:10                3208
mysql-xdevapi-columnresult.getfractionaldigits.php 26-Sep-2022 04:10                3319
mysql-xdevapi-columnresult.getlength.php           26-Sep-2022 04:10                3163
mysql-xdevapi-columnresult.getschemaname.php       26-Sep-2022 04:10                3237
mysql-xdevapi-columnresult.gettablelabel.php       26-Sep-2022 04:10                3192
mysql-xdevapi-columnresult.gettablename.php        26-Sep-2022 04:10                3202
mysql-xdevapi-columnresult.gettype.php             26-Sep-2022 04:10                3119
mysql-xdevapi-columnresult.isnumbersigned.php      26-Sep-2022 04:10                3365
mysql-xdevapi-columnresult.ispadded.php            26-Sep-2022 04:10                3206
mysql-xdevapi-crudoperationbindable.bind.php       26-Sep-2022 04:10                5818
mysql-xdevapi-crudoperationlimitable.limit.php     26-Sep-2022 04:10                5909
mysql-xdevapi-crudoperationskippable.skip.php      26-Sep-2022 04:10                4580
mysql-xdevapi-crudoperationsortable.sort.php       26-Sep-2022 04:10                4616
mysql-xdevapi-databaseobject.existsindatabase.php  26-Sep-2022 04:10                3493
mysql-xdevapi-databaseobject.getname.php           26-Sep-2022 04:10                3439
mysql-xdevapi-databaseobject.getsession.php        26-Sep-2022 04:10                3542
mysql-xdevapi-docresult.construct.php              26-Sep-2022 04:10                7795
mysql-xdevapi-docresult.fetchall.php               26-Sep-2022 04:10                8248
mysql-xdevapi-docresult.fetchone.php               26-Sep-2022 04:10                7890
mysql-xdevapi-docresult.getwarnings.php            26-Sep-2022 04:10                8911
mysql-xdevapi-docresult.getwarningscount.php       26-Sep-2022 04:10                8723
mysql-xdevapi-executable.execute.php               26-Sep-2022 04:10                6750
mysql-xdevapi-executionstatus.construct.php        26-Sep-2022 04:10                2988
mysql-xdevapi-expression.construct.php             26-Sep-2022 04:10                3085
mysql-xdevapi-result.construct.php                 26-Sep-2022 04:10                7340
mysql-xdevapi-result.getaffecteditemscount.php     26-Sep-2022 04:10                6141
mysql-xdevapi-result.getautoincrementvalue.php     26-Sep-2022 04:10                7680
mysql-xdevapi-result.getgeneratedids.php           26-Sep-2022 04:10                6963
mysql-xdevapi-result.getwarnings.php               26-Sep-2022 04:10                6926
mysql-xdevapi-result.getwarningscount.php          26-Sep-2022 04:10                6622
mysql-xdevapi-rowresult.construct.php              26-Sep-2022 04:10                4998
mysql-xdevapi-rowresult.fetchall.php               26-Sep-2022 04:10                6696
mysql-xdevapi-rowresult.fetchone.php               26-Sep-2022 04:10                6890
mysql-xdevapi-rowresult.getcolumncount.php         26-Sep-2022 04:10                6186
mysql-xdevapi-rowresult.getcolumnnames.php         26-Sep-2022 04:10                6217
mysql-xdevapi-rowresult.getcolumns.php             26-Sep-2022 04:10                7178
mysql-xdevapi-rowresult.getwarnings.php            26-Sep-2022 04:10                6973
mysql-xdevapi-rowresult.getwarningscount.php       26-Sep-2022 04:10                6668
mysql-xdevapi-schema.construct.php                 26-Sep-2022 04:10                5523
mysql-xdevapi-schema.createcollection.php          26-Sep-2022 04:10               10327
mysql-xdevapi-schema.dropcollection.php            26-Sep-2022 04:10                6673
mysql-xdevapi-schema.existsindatabase.php          26-Sep-2022 04:10                6529
mysql-xdevapi-schema.getcollection.php             26-Sep-2022 04:10                5680
mysql-xdevapi-schema.getcollectionastable.php      26-Sep-2022 04:10                7312
mysql-xdevapi-schema.getcollections.php            26-Sep-2022 04:10                6410
mysql-xdevapi-schema.getname.php                   26-Sep-2022 04:10                4812
mysql-xdevapi-schema.getsession.php                26-Sep-2022 04:10                5310
mysql-xdevapi-schema.gettable.php                  26-Sep-2022 04:10                6879
mysql-xdevapi-schema.gettables.php                 26-Sep-2022 04:10                7119
mysql-xdevapi-schemaobject.getschema.php           26-Sep-2022 04:10                4079
mysql-xdevapi-session.close.php                    26-Sep-2022 04:10                3967
mysql-xdevapi-session.commit.php                   26-Sep-2022 04:10                4768
mysql-xdevapi-session.construct.php                26-Sep-2022 04:10                3127
mysql-xdevapi-session.createschema.php             26-Sep-2022 04:10                4982
mysql-xdevapi-session.dropschema.php               26-Sep-2022 04:10                4083
mysql-xdevapi-session.generateuuid.php             26-Sep-2022 04:10                3987
mysql-xdevapi-session.getdefaultschema.php         26-Sep-2022 04:10                4148
mysql-xdevapi-session.getschema.php                26-Sep-2022 04:10                4258
mysql-xdevapi-session.getschemas.php               26-Sep-2022 04:10                4080
mysql-xdevapi-session.getserverversion.php         26-Sep-2022 04:10                3923
mysql-xdevapi-session.listclients.php              26-Sep-2022 04:10                4247
mysql-xdevapi-session.quotename.php                26-Sep-2022 04:10                5359
mysql-xdevapi-session.releasesavepoint.php         26-Sep-2022 04:10                5698
mysql-xdevapi-session.rollback.php                 26-Sep-2022 04:10                5394
mysql-xdevapi-session.rollbackto.php               26-Sep-2022 04:10                5777
mysql-xdevapi-session.setsavepoint.php             26-Sep-2022 04:10                6021
mysql-xdevapi-session.sql.php                      26-Sep-2022 04:10                3941
mysql-xdevapi-session.starttransaction.php         26-Sep-2022 04:10                5470
mysql-xdevapi-sqlstatement.bind.php                26-Sep-2022 04:10                3374
mysql-xdevapi-sqlstatement.construct.php           26-Sep-2022 04:10                2926
mysql-xdevapi-sqlstatement.execute.php             26-Sep-2022 04:10                3217
mysql-xdevapi-sqlstatement.getnextresult.php       26-Sep-2022 04:10                3269
mysql-xdevapi-sqlstatement.getresult.php           26-Sep-2022 04:10                3238
mysql-xdevapi-sqlstatement.hasmoreresults.php      26-Sep-2022 04:10                3288
mysql-xdevapi-sqlstatementresult.construct.php     26-Sep-2022 04:10                3046
mysql-xdevapi-sqlstatementresult.fetchall.php      26-Sep-2022 04:10                7134
mysql-xdevapi-sqlstatementresult.fetchone.php      26-Sep-2022 04:10                6963
mysql-xdevapi-sqlstatementresult.getaffectedite..> 26-Sep-2022 04:10                3403
mysql-xdevapi-sqlstatementresult.getcolumncount..> 26-Sep-2022 04:10                3943
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 26-Sep-2022 04:10                3319
mysql-xdevapi-sqlstatementresult.getcolumns.php    26-Sep-2022 04:10                3275
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 26-Sep-2022 04:10                3433
mysql-xdevapi-sqlstatementresult.getlastinserti..> 26-Sep-2022 04:10                3376
mysql-xdevapi-sqlstatementresult.getwarningcoun..> 26-Sep-2022 04:10                3406
mysql-xdevapi-sqlstatementresult.getwarnings.php   26-Sep-2022 04:10                3527
mysql-xdevapi-sqlstatementresult.hasdata.php       26-Sep-2022 04:10                3308
mysql-xdevapi-sqlstatementresult.nextresult.php    26-Sep-2022 04:10                3374
mysql-xdevapi-statement.construct.php              26-Sep-2022 04:10                2894
mysql-xdevapi-statement.getnextresult.php          26-Sep-2022 04:10                3218
mysql-xdevapi-statement.getresult.php              26-Sep-2022 04:10                3181
mysql-xdevapi-statement.hasmoreresults.php         26-Sep-2022 04:10                3131
mysql-xdevapi-table.construct.php                  26-Sep-2022 04:10                3593
mysql-xdevapi-table.count.php                      26-Sep-2022 04:10                5805
mysql-xdevapi-table.delete.php                     26-Sep-2022 04:10                6569
mysql-xdevapi-table.existsindatabase.php           26-Sep-2022 04:10                6268
mysql-xdevapi-table.getname.php                    26-Sep-2022 04:10                5888
mysql-xdevapi-table.getschema.php                  26-Sep-2022 04:10                6051
mysql-xdevapi-table.getsession.php                 26-Sep-2022 04:10                6000
mysql-xdevapi-table.insert.php                     26-Sep-2022 04:10                7153
mysql-xdevapi-table.isview.php                     26-Sep-2022 04:10                6179
mysql-xdevapi-table.select.php                     26-Sep-2022 04:10                7413
mysql-xdevapi-table.update.php                     26-Sep-2022 04:10                6376
mysql-xdevapi-tabledelete.bind.php                 26-Sep-2022 04:10                6972
mysql-xdevapi-tabledelete.construct.php            26-Sep-2022 04:10                6425
mysql-xdevapi-tabledelete.execute.php              26-Sep-2022 04:10                6703
mysql-xdevapi-tabledelete.limit.php                26-Sep-2022 04:10                6955
mysql-xdevapi-tabledelete.orderby.php              26-Sep-2022 04:10                5354
mysql-xdevapi-tabledelete.where.php                26-Sep-2022 04:10                5180
mysql-xdevapi-tableinsert.construct.php            26-Sep-2022 04:10                6200
mysql-xdevapi-tableinsert.execute.php              26-Sep-2022 04:10                6466
mysql-xdevapi-tableinsert.values.php               26-Sep-2022 04:10                6712
mysql-xdevapi-tableselect.bind.php                 26-Sep-2022 04:10                6203
mysql-xdevapi-tableselect.construct.php            26-Sep-2022 04:10                7480
mysql-xdevapi-tableselect.execute.php              26-Sep-2022 04:10                6023
mysql-xdevapi-tableselect.groupby.php              26-Sep-2022 04:10                8057
mysql-xdevapi-tableselect.having.php               26-Sep-2022 04:10                8124
mysql-xdevapi-tableselect.limit.php                26-Sep-2022 04:10                5677
mysql-xdevapi-tableselect.lockexclusive.php        26-Sep-2022 04:10                6773
mysql-xdevapi-tableselect.lockshared.php           26-Sep-2022 04:10                6739
mysql-xdevapi-tableselect.offset.php               26-Sep-2022 04:10                7404
mysql-xdevapi-tableselect.orderby.php              26-Sep-2022 04:10                6324
mysql-xdevapi-tableselect.where.php                26-Sep-2022 04:10                6197
mysql-xdevapi-tableupdate.bind.php                 26-Sep-2022 04:10                5535
mysql-xdevapi-tableupdate.construct.php            26-Sep-2022 04:10                5038
mysql-xdevapi-tableupdate.execute.php              26-Sep-2022 04:10                5339
mysql-xdevapi-tableupdate.limit.php                26-Sep-2022 04:10                5568
mysql-xdevapi-tableupdate.orderby.php              26-Sep-2022 04:10                6095
mysql-xdevapi-tableupdate.set.php                  26-Sep-2022 04:10                5827
mysql-xdevapi-tableupdate.where.php                26-Sep-2022 04:10                5546
mysql-xdevapi-warning.construct.php                26-Sep-2022 04:10                2823
mysql-xdevapi.build.php                            26-Sep-2022 04:10                4167
mysql-xdevapi.configuration.php                    26-Sep-2022 04:10                4618
mysql-xdevapi.constants.php                        26-Sep-2022 04:10                9537
mysql-xdevapi.examples.php                         26-Sep-2022 04:10               10320
mysql-xdevapi.installation.php                     26-Sep-2022 04:10                3185
mysql-xdevapi.requirements.php                     26-Sep-2022 04:10                1425
mysql-xdevapi.setup.php                            26-Sep-2022 04:10                1717
mysql.configuration.php                            26-Sep-2022 04:10                8858
mysql.constants.php                                26-Sep-2022 04:10                4275
mysql.examples-basic.php                           26-Sep-2022 04:10                5725
mysql.examples.php                                 26-Sep-2022 04:10                1405
mysql.installation.php                             26-Sep-2022 04:10                7871
mysql.php