Index of /php.ihc-ru.net/manual/en/


../
feeds/                                             30-Sep-2022 11:01                   -
images/                                            30-Sep-2022 11:01                   -
styles/                                            30-Sep-2022 11:00                   -
toc/                                               30-Sep-2022 11:01                   -
about.formats.php                                  30-Sep-2022 11:01                4107
about.generate.php                                 30-Sep-2022 11:01                2657
about.howtohelp.php                                30-Sep-2022 11:01                3369
about.more.php                                     30-Sep-2022 11:01                1794
about.notes.php                                    30-Sep-2022 11:01                2374
about.php                                          30-Sep-2022 11:01                1816
about.phpversions.php                              30-Sep-2022 11:01                3322
about.prototypes.php                               30-Sep-2022 11:01                7181
about.translations.php                             30-Sep-2022 11:01                3130
aliases.php                                        30-Sep-2022 11:01               29037
apache.configuration.php                           30-Sep-2022 11:01                4800
apache.constants.php                               30-Sep-2022 11:01                1116
apache.installation.php                            30-Sep-2022 11:01                1216
apache.requirements.php                            30-Sep-2022 11:01                1160
apache.resources.php                               30-Sep-2022 11:01                1158
apache.setup.php                                   30-Sep-2022 11:01                1553
apcu.configuration.php                             30-Sep-2022 11:00               14359
apcu.constants.php                                 30-Sep-2022 11:00                5232
apcu.installation.php                              30-Sep-2022 11:00                3173
apcu.requirements.php                              30-Sep-2022 11:00                1146
apcu.resources.php                                 30-Sep-2022 11:00                1144
apcu.setup.php                                     30-Sep-2022 11:00                1511
apcuiterator.construct.php                         30-Sep-2022 11:00                6393
apcuiterator.current.php                           30-Sep-2022 11:00                2957
apcuiterator.gettotalcount.php                     30-Sep-2022 11:00                3099
apcuiterator.gettotalhits.php                      30-Sep-2022 11:00                3183
apcuiterator.gettotalsize.php                      30-Sep-2022 11:00                2976
apcuiterator.key.php                               30-Sep-2022 11:00                2655
apcuiterator.next.php                              30-Sep-2022 11:00                2870
apcuiterator.rewind.php                            30-Sep-2022 11:00                2657
apcuiterator.valid.php                             30-Sep-2022 11:00                2743
appendices.php                                     30-Sep-2022 11:01               11363
appenditerator.append.php                          30-Sep-2022 11:01                5493
appenditerator.construct.php                       30-Sep-2022 11:01               10522
appenditerator.current.php                         30-Sep-2022 11:01                3464
appenditerator.getarrayiterator.php                30-Sep-2022 11:01                3137
appenditerator.getinneriterator.php                30-Sep-2022 11:01                6810
appenditerator.getiteratorindex.php                30-Sep-2022 11:01                6751
appenditerator.key.php                             30-Sep-2022 11:01                8171
appenditerator.next.php                            30-Sep-2022 11:01                3341
appenditerator.rewind.php                          30-Sep-2022 11:01                3337
appenditerator.valid.php                           30-Sep-2022 11:01                3184
array.configuration.php                            30-Sep-2022 11:01                1206
array.constants.php                                30-Sep-2022 11:01                8071
array.installation.php                             30-Sep-2022 11:01                1189
array.requirements.php                             30-Sep-2022 11:01                1153
array.resources.php                                30-Sep-2022 11:01                1151
array.setup.php                                    30-Sep-2022 11:01                1520
array.sorting.php                                  30-Sep-2022 11:01                6612
arrayaccess.offsetexists.php                       30-Sep-2022 11:00                9552
arrayaccess.offsetget.php                          30-Sep-2022 11:00                4849
arrayaccess.offsetset.php                          30-Sep-2022 11:00                5100
arrayaccess.offsetunset.php                        30-Sep-2022 11:00                2795
arrayiterator.append.php                           30-Sep-2022 11:01                3435
arrayiterator.asort.php                            30-Sep-2022 11:01                5830
arrayiterator.construct.php                        30-Sep-2022 11:01                3511
arrayiterator.count.php                            30-Sep-2022 11:01                2898
arrayiterator.current.php                          30-Sep-2022 11:01                5373
arrayiterator.getarraycopy.php                     30-Sep-2022 11:01                2863
arrayiterator.getflags.php                         30-Sep-2022 11:01                2993
arrayiterator.key.php                              30-Sep-2022 11:01                3788
arrayiterator.ksort.php                            30-Sep-2022 11:01                5800
arrayiterator.natcasesort.php                      30-Sep-2022 11:01                3968
arrayiterator.natsort.php                          30-Sep-2022 11:01                3784
arrayiterator.next.php                             30-Sep-2022 11:01                4663
arrayiterator.offsetexists.php                     30-Sep-2022 11:01                3169
arrayiterator.offsetget.php                        30-Sep-2022 11:01                3415
arrayiterator.offsetset.php                        30-Sep-2022 11:01                3657
arrayiterator.offsetunset.php                      30-Sep-2022 11:01                3756
arrayiterator.rewind.php                           30-Sep-2022 11:01                4643
arrayiterator.seek.php                             30-Sep-2022 11:01                2480
arrayiterator.serialize.php                        30-Sep-2022 11:01                2774
arrayiterator.setflags.php                         30-Sep-2022 11:01                4007
arrayiterator.uasort.php                           30-Sep-2022 11:01                5047
arrayiterator.uksort.php                           30-Sep-2022 11:01                4812
arrayiterator.unserialize.php                      30-Sep-2022 11:01                2999
arrayiterator.valid.php                            30-Sep-2022 11:01                4540
arrayobject.append.php                             30-Sep-2022 11:01                5456
arrayobject.asort.php                              30-Sep-2022 11:01                8850
arrayobject.construct.php                          30-Sep-2022 11:01                6009
arrayobject.count.php                              30-Sep-2022 11:01                5421
arrayobject.exchangearray.php                      30-Sep-2022 11:01                6082
arrayobject.getarraycopy.php                       30-Sep-2022 11:01                5305
arrayobject.getflags.php                           30-Sep-2022 11:01                6168
arrayobject.getiterator.php                        30-Sep-2022 11:01                5512
arrayobject.getiteratorclass.php                   30-Sep-2022 11:01                6712
arrayobject.ksort.php                              30-Sep-2022 11:01                8531
arrayobject.natcasesort.php                        30-Sep-2022 11:01                7580
arrayobject.natsort.php                            30-Sep-2022 11:01                7296
arrayobject.offsetexists.php                       30-Sep-2022 11:01                4800
arrayobject.offsetget.php                          30-Sep-2022 11:01                5099
arrayobject.offsetset.php                          30-Sep-2022 11:01                6871
arrayobject.offsetunset.php                        30-Sep-2022 11:01                4228
arrayobject.serialize.php                          30-Sep-2022 11:01                5030
arrayobject.setflags.php                           30-Sep-2022 11:01                6785
arrayobject.setiteratorclass.php                   30-Sep-2022 11:01                5908
arrayobject.uasort.php                             30-Sep-2022 11:01                9910
arrayobject.uksort.php                             30-Sep-2022 11:01                9241
arrayobject.unserialize.php                        30-Sep-2022 11:01                3444
backedenum.from.php                                30-Sep-2022 11:00                5978
backedenum.tryfrom.php                             30-Sep-2022 11:00                6270
bc.configuration.php                               30-Sep-2022 11:00                2360
bc.constants.php                                   30-Sep-2022 11:00                1090
bc.installation.php                                30-Sep-2022 11:00                1385
bc.requirements.php                                30-Sep-2022 11:00                1132
bc.resources.php                                   30-Sep-2022 11:00                1130
bc.setup.php                                       30-Sep-2022 11:00                1511
book.apache.php                                    30-Sep-2022 11:01                3125
book.apcu.php                                      30-Sep-2022 11:00                4316
book.array.php                                     30-Sep-2022 11:01               11595
book.bc.php                                        30-Sep-2022 11:00                2872
book.bson.php                                      30-Sep-2022 11:00               19849
book.bzip2.php                                     30-Sep-2022 11:00                2829
book.calendar.php                                  30-Sep-2022 11:00                3974
book.classobj.php                                  30-Sep-2022 11:01                4286
book.cmark.php                                     30-Sep-2022 11:01                8663
book.com.php                                       30-Sep-2022 11:01                7853
book.componere.php                                 30-Sep-2022 11:00                6124
book.csprng.php                                    30-Sep-2022 11:00                2108
book.ctype.php                                     30-Sep-2022 11:01                3057
book.cubrid.php                                    30-Sep-2022 11:00               13782
book.curl.php                                      30-Sep-2022 11:01                6811
book.datetime.php                                  30-Sep-2022 11:00               15750
book.dba.php                                       30-Sep-2022 11:00                3353
book.dbase.php                                     30-Sep-2022 11:00                3159
book.dio.php                                       30-Sep-2022 11:00                2882
book.dir.php                                       30-Sep-2022 11:00                2997
book.dom.php                                       30-Sep-2022 11:01               17702
book.ds.php                                        30-Sep-2022 11:01               25041
book.eio.php                                       30-Sep-2022 11:00                7871
book.enchant.php                                   30-Sep-2022 11:00                5283
book.errorfunc.php                                 30-Sep-2022 11:00                3373
book.ev.php                                        30-Sep-2022 11:00               13309
book.event.php                                     30-Sep-2022 11:01               22975
book.exec.php                                      30-Sep-2022 11:01                3135
book.exif.php                                      30-Sep-2022 11:00                2421
book.expect.php                                    30-Sep-2022 11:00                2422
book.fann.php                                      30-Sep-2022 11:01               23047
book.fdf.php                                       30-Sep-2022 11:00                5541
book.ffi.php                                       30-Sep-2022 11:00                5581
book.fileinfo.php                                  30-Sep-2022 11:00                2983
book.filesystem.php                                30-Sep-2022 11:00                9376
book.filter.php                                    30-Sep-2022 11:01                3354
book.fpm.php                                       30-Sep-2022 11:01                1913
book.ftp.php                                       30-Sep-2022 11:01                5838
book.funchand.php                                  30-Sep-2022 11:01                3572
book.gearman.php                                   30-Sep-2022 11:01               14752
book.gender.php                                    30-Sep-2022 11:00                2527
book.geoip.php                                     30-Sep-2022 11:01                4297
book.gettext.php                                   30-Sep-2022 11:00                2870
book.gmagick.php                                   30-Sep-2022 11:00               22520
book.gmp.php                                       30-Sep-2022 11:00                6391
book.gnupg.php                                     30-Sep-2022 11:00                4801
book.hash.php                                      30-Sep-2022 11:00                4106
book.hrtime.php                                    30-Sep-2022 11:00                3423
book.ibase.php                                     30-Sep-2022 11:00               11971
book.ibm-db2.php                                   30-Sep-2022 11:00                8575
book.iconv.php                                     30-Sep-2022 11:00                3179
book.igbinary.php                                  30-Sep-2022 11:01                2079
book.image.php                                     30-Sep-2022 11:00               15102
book.imagick.php                                   30-Sep-2022 11:00               62122
book.imap.php                                      30-Sep-2022 11:00               10059
book.info.php                                      30-Sep-2022 11:00                7943
book.inotify.php                                   30-Sep-2022 11:00                2487
book.intl.php                                      30-Sep-2022 11:00               44314
book.json.php                                      30-Sep-2022 11:01                2735
book.ldap.php                                      30-Sep-2022 11:01                8870
book.libxml.php                                    30-Sep-2022 11:01                2906
book.lua.php                                       30-Sep-2022 11:01                2586
book.luasandbox.php                                30-Sep-2022 11:01                5506
book.lzf.php                                       30-Sep-2022 11:00                2130
book.mail.php                                      30-Sep-2022 11:00                2017
book.mailparse.php                                 30-Sep-2022 11:00                3850
book.math.php                                      30-Sep-2022 11:00                5992
book.mbstring.php                                  30-Sep-2022 11:00                9480
book.mcrypt.php                                    30-Sep-2022 11:00                6330
book.memcache.php                                  30-Sep-2022 11:01                4159
book.memcached.php                                 30-Sep-2022 11:01                8015
book.mhash.php                                     30-Sep-2022 11:00                2412
book.misc.php                                      30-Sep-2022 11:01                5180
book.mongodb.php                                   30-Sep-2022 11:00               25588
book.mqseries.php                                  30-Sep-2022 11:01                3117
book.mysql-xdevapi.php                             30-Sep-2022 11:00               28922
book.mysql.php                                     30-Sep-2022 11:00                7537
book.mysqli.php                                    30-Sep-2022 11:00               17842
book.mysqlnd.php                                   30-Sep-2022 11:00                2411
book.network.php                                   30-Sep-2022 11:01                5711
book.oauth.php                                     30-Sep-2022 11:01                7120
book.oci8.php                                      30-Sep-2022 11:00               16716
book.opcache.php                                   30-Sep-2022 11:00                2627
book.openal.php                                    30-Sep-2022 11:00                4368
book.openssl.php                                   30-Sep-2022 11:00               10819
book.outcontrol.php                                30-Sep-2022 11:00                4074
book.parallel.php                                  30-Sep-2022 11:01                5680
book.parle.php                                     30-Sep-2022 11:01                8760
book.password.php                                  30-Sep-2022 11:00                2504
book.pcntl.php                                     30-Sep-2022 11:00                4987
book.pcre.php                                      30-Sep-2022 11:01                3684
book.pdo.php                                       30-Sep-2022 11:00                7824
book.pgsql.php                                     30-Sep-2022 11:00               12166
book.phar.php                                      30-Sep-2022 11:00               15652
book.phpdbg.php                                    30-Sep-2022 11:00                2847
book.posix.php                                     30-Sep-2022 11:01                6090
book.ps.php                                        30-Sep-2022 11:00                9115
book.pspell.php                                    30-Sep-2022 11:00                4375
book.pthreads.php                                  30-Sep-2022 11:01                5390
book.quickhash.php                                 30-Sep-2022 11:01                8842
book.radius.php                                    30-Sep-2022 11:00                5469
book.rar.php                                       30-Sep-2022 11:00                5191
book.readline.php                                  30-Sep-2022 11:00                3597
book.recode.php                                    30-Sep-2022 11:00                2220
book.reflection.php                                30-Sep-2022 11:01               36679
book.rpminfo.php                                   30-Sep-2022 11:00                2342
book.rrd.php                                       30-Sep-2022 11:01                5038
book.runkit7.php                                   30-Sep-2022 11:00                4159
book.scoutapm.php                                  30-Sep-2022 11:01                2132
book.seaslog.php                                   30-Sep-2022 11:01                5098
book.sem.php                                       30-Sep-2022 11:01                4086
book.session.php                                   30-Sep-2022 11:01                7715
book.shmop.php                                     30-Sep-2022 11:01                2730
book.simplexml.php                                 30-Sep-2022 11:01                5465
book.snmp.php                                      30-Sep-2022 11:01                5775
book.soap.php                                      30-Sep-2022 11:01                6027
book.sockets.php                                   30-Sep-2022 11:01                6867
book.sodium.php                                    30-Sep-2022 11:00               17266
book.solr.php                                      30-Sep-2022 11:01               53059
book.spl.php                                       30-Sep-2022 11:01                9935
book.sqlite3.php                                   30-Sep-2022 11:00                6912
book.sqlsrv.php                                    30-Sep-2022 11:00                5266
book.ssdeep.php                                    30-Sep-2022 11:01                2256
book.ssh2.php                                      30-Sep-2022 11:01                5388
book.stats.php                                     30-Sep-2022 11:00               11747
book.stomp.php                                     30-Sep-2022 11:01                4076
book.stream.php                                    30-Sep-2022 11:01               11513
book.strings.php                                   30-Sep-2022 11:01               12564
book.svm.php                                       30-Sep-2022 11:01                3611
book.svn.php                                       30-Sep-2022 11:01                7533
book.swoole.php                                    30-Sep-2022 11:01               37255
book.sync.php                                      30-Sep-2022 11:01                4701
book.taint.php                                     30-Sep-2022 11:01                2455
book.tcpwrap.php                                   30-Sep-2022 11:01                1980
book.tidy.php                                      30-Sep-2022 11:01                6513
book.tokenizer.php                                 30-Sep-2022 11:01                3035
book.trader.php                                    30-Sep-2022 11:00               17445
book.ui.php                                        30-Sep-2022 11:01               27868
book.uodbc.php                                     30-Sep-2022 11:00                6476
book.uopz.php                                      30-Sep-2022 11:00                5027
book.url.php                                       30-Sep-2022 11:01                2864
book.v8js.php                                      30-Sep-2022 11:01                3028
book.var.php                                       30-Sep-2022 11:01                5617
book.var_representation.php                        30-Sep-2022 11:01                2075
book.varnish.php                                   30-Sep-2022 11:01                5298
book.wddx.php                                      30-Sep-2022 11:01                2731
book.win32service.php                              30-Sep-2022 11:01                5086
book.wincache.php                                  30-Sep-2022 11:00                5531
book.wkhtmltox.php                                 30-Sep-2022 11:00                3236
book.xattr.php                                     30-Sep-2022 11:00                2370
book.xdiff.php                                     30-Sep-2022 11:00                4021
book.xhprof.php                                    30-Sep-2022 11:00                2376
book.xlswriter.php                                 30-Sep-2022 11:00                4348
book.xml.php                                       30-Sep-2022 11:01                5270
book.xmldiff.php                                   30-Sep-2022 11:01                3060
book.xmlreader.php                                 30-Sep-2022 11:01                4755
book.xmlrpc.php                                    30-Sep-2022 11:01                3680
book.xmlwriter.php                                 30-Sep-2022 11:01                6453
book.xsl.php                                       30-Sep-2022 11:01                3685
book.yac.php                                       30-Sep-2022 11:00                2519
book.yaconf.php                                    30-Sep-2022 11:01                2070
book.yaf.php                                       30-Sep-2022 11:01               34581
book.yaml.php                                      30-Sep-2022 11:01                2695
book.yar.php                                       30-Sep-2022 11:01                3613
book.yaz.php                                       30-Sep-2022 11:01                4282
book.zip.php                                       30-Sep-2022 11:00                9802
book.zlib.php                                      30-Sep-2022 11:00                4878
book.zmq.php                                       30-Sep-2022 11:01                5436
book.zookeeper.php                                 30-Sep-2022 11:01                6582
bzip2.configuration.php                            30-Sep-2022 11:00                1206
bzip2.constants.php                                30-Sep-2022 11:00                1105
bzip2.examples.php                                 30-Sep-2022 11:00                4242
bzip2.installation.php                             30-Sep-2022 11:00                1322
bzip2.requirements.php                             30-Sep-2022 11:00                1319
bzip2.resources.php                                30-Sep-2022 11:00                1209
bzip2.setup.php                                    30-Sep-2022 11:00                1540
cachingiterator.construct.php                      30-Sep-2022 11:01                2721
cachingiterator.count.php                          30-Sep-2022 11:01                2390
cachingiterator.current.php                        30-Sep-2022 11:01                2808
cachingiterator.getcache.php                       30-Sep-2022 11:01                5586
cachingiterator.getflags.php                       30-Sep-2022 11:01                2402
cachingiterator.getinneriterator.php               30-Sep-2022 11:01                2541
cachingiterator.hasnext.php                        30-Sep-2022 11:01                2403
cachingiterator.key.php                            30-Sep-2022 11:01                2182
cachingiterator.next.php                           30-Sep-2022 11:01                2337
cachingiterator.offsetexists.php                   30-Sep-2022 11:01                2694
cachingiterator.offsetget.php                      30-Sep-2022 11:01                2645
cachingiterator.offsetset.php                      30-Sep-2022 11:01                2990
cachingiterator.offsetunset.php                    30-Sep-2022 11:01                2618
cachingiterator.rewind.php                         30-Sep-2022 11:01                2353
cachingiterator.setflags.php                       30-Sep-2022 11:01                2652
cachingiterator.tostring.php                       30-Sep-2022 11:01                2460
cachingiterator.valid.php                          30-Sep-2022 11:01                2434
calendar.configuration.php                         30-Sep-2022 11:00                1227
calendar.constants.php                             30-Sep-2022 11:00               10356
calendar.installation.php                          30-Sep-2022 11:00                1428
calendar.requirements.php                          30-Sep-2022 11:00                1174
calendar.resources.php                             30-Sep-2022 11:00                1172
calendar.setup.php                                 30-Sep-2022 11:00                1578
callbackfilteriterator.accept.php                  30-Sep-2022 11:01                3296
callbackfilteriterator.construct.php               30-Sep-2022 11:01                3829
cc.license.php                                     30-Sep-2022 11:01               21012
changelog.misc.php                                 30-Sep-2022 11:01                3408
changelog.mysql.php                                30-Sep-2022 11:00                2454
changelog.mysql_xdevapi.php                        30-Sep-2022 11:00                2266
changelog.mysqli.php                               30-Sep-2022 11:00                3462
changelog.strings.php                              30-Sep-2022 11:01               11053
class.addressinfo.php                              30-Sep-2022 11:01                1761
class.apcuiterator.php                             30-Sep-2022 11:00                6522
class.appenditerator.php                           30-Sep-2022 11:01                8097
class.argumentcounterror.php                       30-Sep-2022 11:00                6623
class.arithmeticerror.php                          30-Sep-2022 11:00                6866
class.arrayaccess.php                              30-Sep-2022 11:00               13019
class.arrayiterator.php                            30-Sep-2022 11:01               15357
class.arrayobject.php                              30-Sep-2022 11:01               14822
class.assertionerror.php                           30-Sep-2022 11:00                6634
class.backedenum.php                               30-Sep-2022 11:00                4036
class.badfunctioncallexception.php                 30-Sep-2022 11:01                6746
class.badmethodcallexception.php                   30-Sep-2022 11:01                6764
class.cachingiterator.php                          30-Sep-2022 11:01               16121
class.callbackfilteriterator.php                   30-Sep-2022 11:01               12179
class.closure.php                                  30-Sep-2022 11:00                6303
class.collator.php                                 30-Sep-2022 11:00               24160
class.collectable.php                              30-Sep-2022 11:01                2414
class.com-exception.php                            30-Sep-2022 11:01                6552
class.com.php                                      30-Sep-2022 11:01               12793
class.commonmark-cql.php                           30-Sep-2022 11:01                7564
class.commonmark-interfaces-ivisitable.php         30-Sep-2022 11:01                2887
class.commonmark-interfaces-ivisitor.php           30-Sep-2022 11:01                4251
class.commonmark-node-blockquote.php               30-Sep-2022 11:01                8234
class.commonmark-node-bulletlist.php               30-Sep-2022 11:01               10118
class.commonmark-node-code.php                     30-Sep-2022 11:01                9108
class.commonmark-node-codeblock.php                30-Sep-2022 11:01               10313
class.commonmark-node-customblock.php              30-Sep-2022 11:01                8862
class.commonmark-node-custominline.php             30-Sep-2022 11:01                8842
class.commonmark-node-document.php                 30-Sep-2022 11:01                8186
class.commonmark-node-heading.php                  30-Sep-2022 11:01                9474
class.commonmark-node-htmlblock.php                30-Sep-2022 11:01                9166
class.commonmark-node-htmlinline.php               30-Sep-2022 11:01                9142
class.commonmark-node-image.php                    30-Sep-2022 11:01               10198
class.commonmark-node-item.php                     30-Sep-2022 11:01                8201
class.commonmark-node-linebreak.php                30-Sep-2022 11:01                8215
class.commonmark-node-link.php                     30-Sep-2022 11:01               10191
class.commonmark-node-orderedlist.php              30-Sep-2022 11:01               10852
class.commonmark-node-paragraph.php                30-Sep-2022 11:01                8240
class.commonmark-node-softbreak.php                30-Sep-2022 11:01                8233
class.commonmark-node-text-emphasis.php            30-Sep-2022 11:01                8262
class.commonmark-node-text-strong.php              30-Sep-2022 11:01                8251
class.commonmark-node-text.php                     30-Sep-2022 11:01                9508
class.commonmark-node-thematicbreak.php            30-Sep-2022 11:01                8262
class.commonmark-node.php                          30-Sep-2022 11:01                9154
class.commonmark-parser.php                        30-Sep-2022 11:01                3621
class.compersisthelper.php                         30-Sep-2022 11:01                6527
class.compileerror.php                             30-Sep-2022 11:00                6553
class.componere-abstract-definition.php            30-Sep-2022 11:00                4595
class.componere-definition.php                     30-Sep-2022 11:00                9381
class.componere-method.php                         30-Sep-2022 11:00                4355
class.componere-patch.php                          30-Sep-2022 11:00                7767
class.componere-value.php                          30-Sep-2022 11:00                5219
class.countable.php                                30-Sep-2022 11:01                2513
class.curlfile.php                                 30-Sep-2022 11:01                7355
class.curlhandle.php                               30-Sep-2022 11:01                1772
class.curlmultihandle.php                          30-Sep-2022 11:01                1811
class.curlsharehandle.php                          30-Sep-2022 11:01                1807
class.curlstringfile.php                           30-Sep-2022 11:01                5236
class.dateinterval.php                             30-Sep-2022 11:00               13011
class.dateperiod.php                               30-Sep-2022 11:00               13003
class.datetime.php                                 30-Sep-2022 11:00               20585
class.datetimeimmutable.php                        30-Sep-2022 11:00               20305
class.datetimeinterface.php                        30-Sep-2022 11:00               16652
class.datetimezone.php                             30-Sep-2022 11:00               12920
class.deflatecontext.php                           30-Sep-2022 11:00                1826
class.directory.php                                30-Sep-2022 11:00                5267
class.directoryiterator.php                        30-Sep-2022 11:01               23346
class.divisionbyzeroerror.php                      30-Sep-2022 11:00                6611
class.domainexception.php                          30-Sep-2022 11:01                6679
class.domattr.php                                  30-Sep-2022 11:01               21376
class.domcdatasection.php                          30-Sep-2022 11:01               22900
class.domcharacterdata.php                         30-Sep-2022 11:01               24037
class.domchildnode.php                             30-Sep-2022 11:01                3950
class.domcomment.php                               30-Sep-2022 11:01               21844
class.domdocument.php                              30-Sep-2022 11:01               54233
class.domdocumentfragment.php                      30-Sep-2022 11:01               20948
class.domdocumenttype.php                          30-Sep-2022 11:01               21067
class.domelement.php                               30-Sep-2022 11:01               35907
class.domentity.php                                30-Sep-2022 11:01               21395
class.domentityreference.php                       30-Sep-2022 11:01               17475
class.domexception.php                             30-Sep-2022 11:01                7443
class.domimplementation.php                        30-Sep-2022 11:01                5349
class.domnamednodemap.php                          30-Sep-2022 11:01                6477
class.domnode.php                                  30-Sep-2022 11:01               25170
class.domnodelist.php                              30-Sep-2022 11:01                5320
class.domnotation.php                              30-Sep-2022 11:01               17692
class.domparentnode.php                            30-Sep-2022 11:01                3040
class.domprocessinginstruction.php                 30-Sep-2022 11:01               18814
class.domtext.php                                  30-Sep-2022 11:01               24504
class.domxpath.php                                 30-Sep-2022 11:01                7643
class.dotnet.php                                   30-Sep-2022 11:01                6794
class.ds-collection.php                            30-Sep-2022 11:01                5100
class.ds-deque.php                                 30-Sep-2022 11:01               21388
class.ds-hashable.php                              30-Sep-2022 11:01                4067
class.ds-map.php                                   30-Sep-2022 11:01               22566
class.ds-pair.php                                  30-Sep-2022 11:01                4465
class.ds-priorityqueue.php                         30-Sep-2022 11:01                7912
class.ds-queue.php                                 30-Sep-2022 11:01                7473
class.ds-sequence.php                              30-Sep-2022 11:01               19152
class.ds-set.php                                   30-Sep-2022 11:01               17998
class.ds-stack.php                                 30-Sep-2022 11:01                6908
class.ds-vector.php                                30-Sep-2022 11:01               20955
class.emptyiterator.php                            30-Sep-2022 11:01                3924
class.enchantbroker.php                            30-Sep-2022 11:00                1838
class.enchantdictionary.php                        30-Sep-2022 11:00                1828
class.error.php                                    30-Sep-2022 11:00                9783
class.errorexception.php                           30-Sep-2022 11:00               12968
class.ev.php                                       30-Sep-2022 11:00               37637
class.evcheck.php                                  30-Sep-2022 11:00               10072
class.evchild.php                                  30-Sep-2022 11:00               11520
class.evembed.php                                  30-Sep-2022 11:00                9238
class.event.php                                    30-Sep-2022 11:01               17096
class.eventbase.php                                30-Sep-2022 11:01               13326
class.eventbuffer.php                              30-Sep-2022 11:01               20217
class.eventbufferevent.php                         30-Sep-2022 11:01               33445
class.eventconfig.php                              30-Sep-2022 11:01                6830
class.eventdnsbase.php                             30-Sep-2022 11:01               10171
class.eventhttp.php                                30-Sep-2022 11:01                8489
class.eventhttpconnection.php                      30-Sep-2022 11:01                9461
class.eventhttprequest.php                         30-Sep-2022 11:01               19854
class.eventlistener.php                            30-Sep-2022 11:01               11601
class.eventsslcontext.php                          30-Sep-2022 11:01               16447
class.eventutil.php                                30-Sep-2022 11:01               22330
class.evfork.php                                   30-Sep-2022 11:00                8217
class.evidle.php                                   30-Sep-2022 11:00                9249
class.evio.php                                     30-Sep-2022 11:00               11921
class.evloop.php                                   30-Sep-2022 11:00               29219
class.evperiodic.php                               30-Sep-2022 11:00               13901
class.evprepare.php                                30-Sep-2022 11:00               10220
class.evsignal.php                                 30-Sep-2022 11:00               10944
class.evstat.php                                   30-Sep-2022 11:00               13333
class.evtimer.php                                  30-Sep-2022 11:00               13312
class.evwatcher.php                                30-Sep-2022 11:00                9192
class.exception.php                                30-Sep-2022 11:00                9996
class.fannconnection.php                           30-Sep-2022 11:01                6086
class.ffi-cdata.php                                30-Sep-2022 11:00                5462
class.ffi-ctype.php                                30-Sep-2022 11:00                7847
class.ffi-exception.php                            30-Sep-2022 11:00                6396
class.ffi-parserexception.php                      30-Sep-2022 11:00                6452
class.ffi.php                                      30-Sep-2022 11:00               17744
class.fiber.php                                    30-Sep-2022 11:00                7634
class.fibererror.php                               30-Sep-2022 11:00                7297
class.filesystemiterator.php                       30-Sep-2022 11:01               29988
class.filteriterator.php                           30-Sep-2022 11:01                7612
class.finfo.php                                    30-Sep-2022 11:00                5054
class.ftp-connection.php                           30-Sep-2022 11:01                1800
class.gdfont.php                                   30-Sep-2022 11:00                1725
class.gdimage.php                                  30-Sep-2022 11:00                1721
class.gearmanclient.php                            30-Sep-2022 11:01               29665
class.gearmanexception.php                         30-Sep-2022 11:01                6623
class.gearmanjob.php                               30-Sep-2022 11:01                9846
class.gearmantask.php                              30-Sep-2022 11:01                8161
class.gearmanworker.php                            30-Sep-2022 11:01               11343
class.gender.php                                   30-Sep-2022 11:00               33014
class.generator.php                                30-Sep-2022 11:00                6675
class.globiterator.php                             30-Sep-2022 11:01               26158
class.gmagick.php                                  30-Sep-2022 11:00               75794
class.gmagickdraw.php                              30-Sep-2022 11:00               21462
class.gmagickpixel.php                             30-Sep-2022 11:00                5264
class.gmp.php                                      30-Sep-2022 11:00                3258
class.hashcontext.php                              30-Sep-2022 11:00                3217
class.hrtime-performancecounter.php                30-Sep-2022 11:00                3526
class.hrtime-stopwatch.php                         30-Sep-2022 11:00                6284
class.hrtime-unit.php                              30-Sep-2022 11:00                3850
class.imagick.php                                  30-Sep-2022 11:00              240123
class.imagickdraw.php                              30-Sep-2022 11:00               66336
class.imagickkernel.php                            30-Sep-2022 11:00                5631
class.imagickpixel.php                             30-Sep-2022 11:00               11202
class.imagickpixeliterator.php                     30-Sep-2022 11:00                8502
class.imap-connection.php                          30-Sep-2022 11:00                1803
class.infiniteiterator.php                         30-Sep-2022 11:01                5236
class.inflatecontext.php                           30-Sep-2022 11:00                1811
class.internaliterator.php                         30-Sep-2022 11:00                4779
class.intlbreakiterator.php                        30-Sep-2022 11:00               25896
class.intlcalendar.php                             30-Sep-2022 11:00               57651
class.intlchar.php                                 30-Sep-2022 11:00              340823
class.intlcodepointbreakiterator.php               30-Sep-2022 11:00               18394
class.intldateformatter.php                        30-Sep-2022 11:00               23263
class.intldatepatterngenerator.php                 30-Sep-2022 11:00                4120
class.intlexception.php                            30-Sep-2022 11:00                6799
class.intlgregoriancalendar.php                    30-Sep-2022 11:00               38866
class.intliterator.php                             30-Sep-2022 11:00                5073
class.intlpartsiterator.php                        30-Sep-2022 11:00                6733
class.intlrulebasedbreakiterator.php               30-Sep-2022 11:00               20869
class.intltimezone.php                             30-Sep-2022 11:00               18965
class.invalidargumentexception.php                 30-Sep-2022 11:01                6702
class.iterator.php                                 30-Sep-2022 11:00               12551
class.iteratoraggregate.php                        30-Sep-2022 11:00                6430
class.iteratoriterator.php                         30-Sep-2022 11:01                6110
class.jsonexception.php                            30-Sep-2022 11:01                7017
class.jsonserializable.php                         30-Sep-2022 11:01                2832
class.ldap-connection.php                          30-Sep-2022 11:01                1823
class.ldap-result-entry.php                        30-Sep-2022 11:01                1838
class.ldap-result.php                              30-Sep-2022 11:01                1815
class.lengthexception.php                          30-Sep-2022 11:01                6628
class.libxmlerror.php                              30-Sep-2022 11:01                5116
class.limititerator.php                            30-Sep-2022 11:01               11676
class.locale.php                                   30-Sep-2022 11:00               20660
class.logicexception.php                           30-Sep-2022 11:01                6688
class.lua.php                                      30-Sep-2022 11:01                7167
class.luaclosure.php                               30-Sep-2022 11:01                2624
class.luasandbox.php                               30-Sep-2022 11:01               12407
class.luasandboxerror.php                          30-Sep-2022 11:01                8661
class.luasandboxerrorerror.php                     30-Sep-2022 11:01                6701
class.luasandboxfatalerror.php                     30-Sep-2022 11:01                6823
class.luasandboxfunction.php                       30-Sep-2022 11:01                3630
class.luasandboxmemoryerror.php                    30-Sep-2022 11:01                7025
class.luasandboxruntimeerror.php                   30-Sep-2022 11:01                6843
class.luasandboxsyntaxerror.php                    30-Sep-2022 11:01                6705
class.luasandboxtimeouterror.php                   30-Sep-2022 11:01                7009
class.memcache.php                                 30-Sep-2022 11:01               15403
class.memcached.php                                30-Sep-2022 11:01               35714
class.memcachedexception.php                       30-Sep-2022 11:01                6584
class.messageformatter.php                         30-Sep-2022 11:00               10698
class.mongodb-bson-binary.php                      30-Sep-2022 11:00               13700
class.mongodb-bson-binaryinterface.php             30-Sep-2022 11:00                4474
class.mongodb-bson-dbpointer.php                   30-Sep-2022 11:00                5815
class.mongodb-bson-decimal128.php                  30-Sep-2022 11:00                7476
class.mongodb-bson-decimal128interface.php         30-Sep-2022 11:00                3719
class.mongodb-bson-int64.php                       30-Sep-2022 11:00                6541
class.mongodb-bson-javascript.php                  30-Sep-2022 11:00                8081
class.mongodb-bson-javascriptinterface.php         30-Sep-2022 11:00                4646
class.mongodb-bson-maxkey.php                      30-Sep-2022 11:00                5701
class.mongodb-bson-maxkeyinterface.php             30-Sep-2022 11:00                2146
class.mongodb-bson-minkey.php                      30-Sep-2022 11:00                5692
class.mongodb-bson-minkeyinterface.php             30-Sep-2022 11:00                2127
class.mongodb-bson-objectid.php                    30-Sep-2022 11:00                8807
class.mongodb-bson-objectidinterface.php           30-Sep-2022 11:00                4151
class.mongodb-bson-persistable.php                 30-Sep-2022 11:00                4518
class.mongodb-bson-regex.php                       30-Sep-2022 11:00                7733
class.mongodb-bson-regexinterface.php              30-Sep-2022 11:00                4491
class.mongodb-bson-serializable.php                30-Sep-2022 11:00                3765
class.mongodb-bson-symbol.php                      30-Sep-2022 11:00                5703
class.mongodb-bson-timestamp.php                   30-Sep-2022 11:00                7988
class.mongodb-bson-timestampinterface.php          30-Sep-2022 11:00                4653
class.mongodb-bson-type.php                        30-Sep-2022 11:00                1976
class.mongodb-bson-undefined.php                   30-Sep-2022 11:00                5791
class.mongodb-bson-unserializable.php              30-Sep-2022 11:00                3830
class.mongodb-bson-utcdatetime.php                 30-Sep-2022 11:00                7542
class.mongodb-bson-utcdatetimeinterface.php        30-Sep-2022 11:00                4282
class.mongodb-driver-bulkwrite.php                 30-Sep-2022 11:00               25894
class.mongodb-driver-clientencryption.php          30-Sep-2022 11:00               11799
class.mongodb-driver-command.php                   30-Sep-2022 11:00               15953
class.mongodb-driver-cursor.php                    30-Sep-2022 11:00               27589
class.mongodb-driver-cursorid.php                  30-Sep-2022 11:00                5293
class.mongodb-driver-cursorinterface.php           30-Sep-2022 11:00                5930
class.mongodb-driver-exception-authenticationex..> 30-Sep-2022 11:00                8078
class.mongodb-driver-exception-bulkwriteexcepti..> 30-Sep-2022 11:00                8932
class.mongodb-driver-exception-commandexception..> 30-Sep-2022 11:00                9717
class.mongodb-driver-exception-connectionexcept..> 30-Sep-2022 11:00                8147
class.mongodb-driver-exception-connectiontimeou..> 30-Sep-2022 11:00                8535
class.mongodb-driver-exception-encryptionexcept..> 30-Sep-2022 11:00                8081
class.mongodb-driver-exception-exception.php       30-Sep-2022 11:00                2141
class.mongodb-driver-exception-executiontimeout..> 30-Sep-2022 11:00                9185
class.mongodb-driver-exception-invalidargumente..> 30-Sep-2022 11:00                7284
class.mongodb-driver-exception-logicexception.php  30-Sep-2022 11:00                7168
class.mongodb-driver-exception-runtimeexception..> 30-Sep-2022 11:00               10585
class.mongodb-driver-exception-serverexception.php 30-Sep-2022 11:00                8158
class.mongodb-driver-exception-sslconnectionexc..> 30-Sep-2022 11:00                8425
class.mongodb-driver-exception-unexpectedvaluee..> 30-Sep-2022 11:00                7301
class.mongodb-driver-exception-writeexception.php  30-Sep-2022 11:00               11103
class.mongodb-driver-manager.php                   30-Sep-2022 11:00               19670
class.mongodb-driver-monitoring-commandfailedev..> 30-Sep-2022 11:00                7537
class.mongodb-driver-monitoring-commandstartede..> 30-Sep-2022 11:00                7039
class.mongodb-driver-monitoring-commandsubscrib..> 30-Sep-2022 11:00                6144
class.mongodb-driver-monitoring-commandsucceede..> 30-Sep-2022 11:00                7119
class.mongodb-driver-monitoring-sdamsubscriber.php 30-Sep-2022 11:00               11378
class.mongodb-driver-monitoring-serverchangedev..> 30-Sep-2022 11:00                5581
class.mongodb-driver-monitoring-serverclosedeve..> 30-Sep-2022 11:00                4228
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:00                5462
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:00                4347
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:00                5474
class.mongodb-driver-monitoring-serveropeningev..> 30-Sep-2022 11:00                4248
class.mongodb-driver-monitoring-subscriber.php     30-Sep-2022 11:00                2591
class.mongodb-driver-monitoring-topologychanged..> 30-Sep-2022 11:00                4694
class.mongodb-driver-monitoring-topologyclosede..> 30-Sep-2022 11:00                3305
class.mongodb-driver-monitoring-topologyopening..> 30-Sep-2022 11:00                3319
class.mongodb-driver-query.php                     30-Sep-2022 11:00                3121
class.mongodb-driver-readconcern.php               30-Sep-2022 11:00               15997
class.mongodb-driver-readpreference.php            30-Sep-2022 11:00               18157
class.mongodb-driver-server.php                    30-Sep-2022 11:00               23564
class.mongodb-driver-serverapi.php                 30-Sep-2022 11:00               15123
class.mongodb-driver-serverdescription.php         30-Sep-2022 11:00               14695
class.mongodb-driver-session.php                   30-Sep-2022 11:00               13714
class.mongodb-driver-topologydescription.php       30-Sep-2022 11:00               10199
class.mongodb-driver-writeconcern.php              30-Sep-2022 11:00                9092
class.mongodb-driver-writeconcernerror.php         30-Sep-2022 11:00                4103
class.mongodb-driver-writeerror.php                30-Sep-2022 11:00                4369
class.mongodb-driver-writeresult.php               30-Sep-2022 11:00                7838
class.multipleiterator.php                         30-Sep-2022 11:01               10221
class.mysql-xdevapi-baseresult.php                 30-Sep-2022 11:00                2886
class.mysql-xdevapi-client.php                     30-Sep-2022 11:00                3025
class.mysql-xdevapi-collection.php                 30-Sep-2022 11:00                9937
class.mysql-xdevapi-collectionadd.php              30-Sep-2022 11:00                2903
class.mysql-xdevapi-collectionfind.php             30-Sep-2022 11:00                8261
class.mysql-xdevapi-collectionmodify.php           30-Sep-2022 11:00                9418
class.mysql-xdevapi-collectionremove.php           30-Sep-2022 11:00                5001
class.mysql-xdevapi-columnresult.php               30-Sep-2022 11:00                6017
class.mysql-xdevapi-crudoperationbindable.php      30-Sep-2022 11:00                2881
class.mysql-xdevapi-crudoperationlimitable.php     30-Sep-2022 11:00                2887
class.mysql-xdevapi-crudoperationskippable.php     30-Sep-2022 11:00                2898
class.mysql-xdevapi-crudoperationsortable.php      30-Sep-2022 11:00                2872
class.mysql-xdevapi-databaseobject.php             30-Sep-2022 11:00                3384
class.mysql-xdevapi-docresult.php                  30-Sep-2022 11:00                3773
class.mysql-xdevapi-exception.php                  30-Sep-2022 11:00                2157
class.mysql-xdevapi-executable.php                 30-Sep-2022 11:00                2581
class.mysql-xdevapi-executionstatus.php            30-Sep-2022 11:00                4836
class.mysql-xdevapi-expression.php                 30-Sep-2022 11:00                3157
class.mysql-xdevapi-result.php                     30-Sep-2022 11:00                4099
class.mysql-xdevapi-rowresult.php                  30-Sep-2022 11:00                4696
class.mysql-xdevapi-schema.php                     30-Sep-2022 11:00                7164
class.mysql-xdevapi-schemaobject.php               30-Sep-2022 11:00                2766
class.mysql-xdevapi-session.php                    30-Sep-2022 11:00                8495
class.mysql-xdevapi-sqlstatement.php               30-Sep-2022 11:00                6207
class.mysql-xdevapi-sqlstatementresult.php         30-Sep-2022 11:00                6643
class.mysql-xdevapi-statement.php                  30-Sep-2022 11:00                4635
class.mysql-xdevapi-table.php                      30-Sep-2022 11:00                7317
class.mysql-xdevapi-tabledelete.php                30-Sep-2022 11:00                4906
class.mysql-xdevapi-tableinsert.php                30-Sep-2022 11:00                3405
class.mysql-xdevapi-tableselect.php                30-Sep-2022 11:00                8000
class.mysql-xdevapi-tableupdate.php                30-Sep-2022 11:00                5863
class.mysql-xdevapi-warning.php                    30-Sep-2022 11:00                3720
class.mysqli-driver.php                            30-Sep-2022 11:00                7615
class.mysqli-result.php                            30-Sep-2022 11:00               13595
class.mysqli-sql-exception.php                     30-Sep-2022 11:00                8121
class.mysqli-stmt.php                              30-Sep-2022 11:00               16363
class.mysqli-warning.php                           30-Sep-2022 11:00                4203
class.mysqli.php                                   30-Sep-2022 11:00               33131
class.norewinditerator.php                         30-Sep-2022 11:01                7106
class.normalizer.php                               30-Sep-2022 11:00                8227
class.numberformatter.php                          30-Sep-2022 11:00               39379
class.oauth.php                                    30-Sep-2022 11:01               17204
class.oauthexception.php                           30-Sep-2022 11:01                7636
class.oauthprovider.php                            30-Sep-2022 11:01               11565
class.ocicollection.php                            30-Sep-2022 11:00                6189
class.ocilob.php                                   30-Sep-2022 11:00               12464
class.opensslasymmetrickey.php                     30-Sep-2022 11:00                1901
class.opensslcertificate.php                       30-Sep-2022 11:00                1905
class.opensslcertificatesigningrequest.php         30-Sep-2022 11:00                1992
class.outeriterator.php                            30-Sep-2022 11:01                4310
class.outofboundsexception.php                     30-Sep-2022 11:01                6737
class.outofrangeexception.php                      30-Sep-2022 11:01                6739
class.overflowexception.php                        30-Sep-2022 11:01                6658
class.parallel-channel.php                         30-Sep-2022 11:01                7996
class.parallel-events-event-type.php               30-Sep-2022 11:01                3317
class.parallel-events-event.php                    30-Sep-2022 11:01                3292
class.parallel-events-input.php                    30-Sep-2022 11:01                4550
class.parallel-events.php                          30-Sep-2022 11:01                6667
class.parallel-future.php                          30-Sep-2022 11:01                8213
class.parallel-runtime.php                         30-Sep-2022 11:01                6140
class.parallel-sync.php                            30-Sep-2022 11:01                5219
class.parentiterator.php                           30-Sep-2022 11:01                9530
class.parle-errorinfo.php                          30-Sep-2022 11:01                3686
class.parle-lexer.php                              30-Sep-2022 11:01               11764
class.parle-lexerexception.php                     30-Sep-2022 11:01                6837
class.parle-parser.php                             30-Sep-2022 11:01               14703
class.parle-parserexception.php                    30-Sep-2022 11:01                6819
class.parle-rlexer.php                             30-Sep-2022 11:01               13405
class.parle-rparser.php                            30-Sep-2022 11:01               14854
class.parle-stack.php                              30-Sep-2022 11:01                4644
class.parle-token.php                              30-Sep-2022 11:01                4407
class.parseerror.php                               30-Sep-2022 11:00                7069
class.pdo.php                                      30-Sep-2022 11:00               12969
class.pdoexception.php                             30-Sep-2022 11:00                8417
class.pdostatement.php                             30-Sep-2022 11:00               19506
class.pgsql-connection.php                         30-Sep-2022 11:00                1846
class.pgsql-lob.php                                30-Sep-2022 11:00                1788
class.pgsql-result.php                             30-Sep-2022 11:00                1820
class.phar.php                                     30-Sep-2022 11:00               60246
class.phardata.php                                 30-Sep-2022 11:00               44391
class.pharexception.php                            30-Sep-2022 11:00                6628
class.pharfileinfo.php                             30-Sep-2022 11:00               18277
class.php-user-filter.php                          30-Sep-2022 11:01                6014
class.phptoken.php                                 30-Sep-2022 11:01                7710
class.pool.php                                     30-Sep-2022 11:01                7156
class.pspell-config.php                            30-Sep-2022 11:00                1822
class.pspell-dictionary.php                        30-Sep-2022 11:00                1859
class.quickhashinthash.php                         30-Sep-2022 11:01               12917
class.quickhashintset.php                          30-Sep-2022 11:01               11113
class.quickhashintstringhash.php                   30-Sep-2022 11:01               13731
class.quickhashstringinthash.php                   30-Sep-2022 11:01               11846
class.rangeexception.php                           30-Sep-2022 11:01                6867
class.rararchive.php                               30-Sep-2022 11:00                6943
class.rarentry.php                                 30-Sep-2022 11:00               41837
class.rarexception.php                             30-Sep-2022 11:00                7598
class.recursivearrayiterator.php                   30-Sep-2022 11:01               13684
class.recursivecachingiterator.php                 30-Sep-2022 11:01               13212
class.recursivecallbackfilteriterator.php          30-Sep-2022 11:01               14101
class.recursivedirectoryiterator.php               30-Sep-2022 11:01               29151
class.recursivefilteriterator.php                  30-Sep-2022 11:01                8355
class.recursiveiterator.php                        30-Sep-2022 11:01                4790
class.recursiveiteratoriterator.php                30-Sep-2022 11:01               13268
class.recursiveregexiterator.php                   30-Sep-2022 11:01               13239
class.recursivetreeiterator.php                    30-Sep-2022 11:01               22604
class.reflection.php                               30-Sep-2022 11:01                3182
class.reflectionattribute.php                      30-Sep-2022 11:01                6010
class.reflectionclass.php                          30-Sep-2022 11:01               31037
class.reflectionclassconstant.php                  30-Sep-2022 11:01               13342
class.reflectionenum.php                           30-Sep-2022 11:01               25841
class.reflectionenumbackedcase.php                 30-Sep-2022 11:01               11106
class.reflectionenumunitcase.php                   30-Sep-2022 11:01               10845
class.reflectionexception.php                      30-Sep-2022 11:01                6606
class.reflectionextension.php                      30-Sep-2022 11:01                9049
class.reflectionfiber.php                          30-Sep-2022 11:01                4760
class.reflectionfunction.php                       30-Sep-2022 11:01               17741
class.reflectionfunctionabstract.php               30-Sep-2022 11:01               17245
class.reflectiongenerator.php                      30-Sep-2022 11:01                6025
class.reflectionintersectiontype.php               30-Sep-2022 11:01                3328
class.reflectionmethod.php                         30-Sep-2022 11:01               27297
class.reflectionnamedtype.php                      30-Sep-2022 11:01                3583
class.reflectionobject.php                         30-Sep-2022 11:01               23475
class.reflectionparameter.php                      30-Sep-2022 11:01               14202
class.reflectionproperty.php                       30-Sep-2022 11:01               18848
class.reflectionreference.php                      30-Sep-2022 11:01                3876
class.reflectiontype.php                           30-Sep-2022 11:01                4463
class.reflectionuniontype.php                      30-Sep-2022 11:01                3214
class.reflectionzendextension.php                  30-Sep-2022 11:01                6712
class.reflector.php                                30-Sep-2022 11:01                3864
class.regexiterator.php                            30-Sep-2022 11:01               15429
class.resourcebundle.php                           30-Sep-2022 11:00                9361
class.rrdcreator.php                               30-Sep-2022 11:01                4028
class.rrdgraph.php                                 30-Sep-2022 11:01                3598
class.rrdupdater.php                               30-Sep-2022 11:01                3006
class.runtimeexception.php                         30-Sep-2022 11:01                6645
class.seaslog.php                                  30-Sep-2022 11:01               17885
class.seekableiterator.php                         30-Sep-2022 11:01               12730
class.serializable.php                             30-Sep-2022 11:00                8390
class.sessionhandler.php                           30-Sep-2022 11:01               26637
class.sessionhandlerinterface.php                  30-Sep-2022 11:01               16325
class.sessionidinterface.php                       30-Sep-2022 11:01                3126
class.sessionupdatetimestamphandlerinterface.php   30-Sep-2022 11:01                4132
class.shmop.php                                    30-Sep-2022 11:01                1720
class.simplexmlelement.php                         30-Sep-2022 11:01               12773
class.simplexmliterator.php                        30-Sep-2022 11:01               12631
class.snmp.php                                     30-Sep-2022 11:01               23821
class.snmpexception.php                            30-Sep-2022 11:01                7566
class.soapclient.php                               30-Sep-2022 11:01               29666
class.soapfault.php                                30-Sep-2022 11:01               12726
class.soapheader.php                               30-Sep-2022 11:01                5534
class.soapparam.php                                30-Sep-2022 11:01                3712
class.soapserver.php                               30-Sep-2022 11:01                9113
class.soapvar.php                                  30-Sep-2022 11:01                7027
class.socket.php                                   30-Sep-2022 11:01                1784
class.sodiumexception.php                          30-Sep-2022 11:00                6573
class.solrclient.php                               30-Sep-2022 11:01               21128
class.solrclientexception.php                      30-Sep-2022 11:01                8489
class.solrcollapsefunction.php                     30-Sep-2022 11:01               10432
class.solrdismaxquery.php                          30-Sep-2022 11:01               94822
class.solrdocument.php                             30-Sep-2022 11:01               20075
class.solrdocumentfield.php                        30-Sep-2022 11:01                4415
class.solrexception.php                            30-Sep-2022 11:01                8943
class.solrgenericresponse.php                      30-Sep-2022 11:01               10928
class.solrillegalargumentexception.php             30-Sep-2022 11:01                8613
class.solrillegaloperationexception.php            30-Sep-2022 11:01                8651
class.solrinputdocument.php                        30-Sep-2022 11:01               16592
class.solrmissingmandatoryparameterexception.php   30-Sep-2022 11:01                7830
class.solrmodifiableparams.php                     30-Sep-2022 11:01                7928
class.solrobject.php                               30-Sep-2022 11:01                5347
class.solrparams.php                               30-Sep-2022 11:01                8083
class.solrpingresponse.php                         30-Sep-2022 11:01               10094
class.solrquery.php                                30-Sep-2022 11:01              104037
class.solrqueryresponse.php                        30-Sep-2022 11:01               10855
class.solrresponse.php                             30-Sep-2022 11:01               12771
class.solrserverexception.php                      30-Sep-2022 11:01                8495
class.solrupdateresponse.php                       30-Sep-2022 11:01               10899
class.solrutils.php                                30-Sep-2022 11:01                4429
class.spldoublylinkedlist.php                      30-Sep-2022 11:01               16282
class.splfileinfo.php                              30-Sep-2022 11:01               15498
class.splfileobject.php                            30-Sep-2022 11:01               30397
class.splfixedarray.php                            30-Sep-2022 11:01               17166
class.splheap.php                                  30-Sep-2022 11:01                7582
class.splmaxheap.php                               30-Sep-2022 11:01                6996
class.splminheap.php                               30-Sep-2022 11:01                7006
class.splobjectstorage.php                         30-Sep-2022 11:01               20101
class.splobserver.php                              30-Sep-2022 11:01                2815
class.splpriorityqueue.php                         30-Sep-2022 11:01                9386
class.splqueue.php                                 30-Sep-2022 11:01               12307
class.splstack.php                                 30-Sep-2022 11:01               11337
class.splsubject.php                               30-Sep-2022 11:01                3634
class.spltempfileobject.php                        30-Sep-2022 11:01               25460
class.spoofchecker.php                             30-Sep-2022 11:00               13179
class.sqlite3.php                                  30-Sep-2022 11:00               15445
class.sqlite3result.php                            30-Sep-2022 11:00                5171
class.sqlite3stmt.php                              30-Sep-2022 11:00                7229
class.stomp.php                                    30-Sep-2022 11:01               16984
class.stompexception.php                           30-Sep-2022 11:01                5237
class.stompframe.php                               30-Sep-2022 11:01                4054
class.streamwrapper.php                            30-Sep-2022 11:01               17102
class.stringable.php                               30-Sep-2022 11:00                8832
class.svm.php                                      30-Sep-2022 11:01               15548
class.svmmodel.php                                 30-Sep-2022 11:01                6038
class.swoole-async.php                             30-Sep-2022 11:01                7051
class.swoole-atomic.php                            30-Sep-2022 11:01                4396
class.swoole-buffer.php                            30-Sep-2022 11:01                6508
class.swoole-channel.php                           30-Sep-2022 11:01                3713
class.swoole-client.php                            30-Sep-2022 11:01               14249
class.swoole-connection-iterator.php               30-Sep-2022 11:01                7036
class.swoole-coroutine.php                         30-Sep-2022 11:01               20034
class.swoole-event.php                             30-Sep-2022 11:01                6598
class.swoole-exception.php                         30-Sep-2022 11:01                4125
class.swoole-http-client.php                       30-Sep-2022 11:01               12891
class.swoole-http-request.php                      30-Sep-2022 11:01                2854
class.swoole-http-response.php                     30-Sep-2022 11:01                9462
class.swoole-http-server.php                       30-Sep-2022 11:01               21508
class.swoole-lock.php                              30-Sep-2022 11:01                4434
class.swoole-mmap.php                              30-Sep-2022 11:01                2842
class.swoole-mysql-exception.php                   30-Sep-2022 11:01                4166
class.swoole-mysql.php                             30-Sep-2022 11:01                5119
class.swoole-process.php                           30-Sep-2022 11:01               11854
class.swoole-redis-server.php                      30-Sep-2022 11:01               26078
class.swoole-serialize.php                         30-Sep-2022 11:01                3353
class.swoole-server.php                            30-Sep-2022 11:01               24758
class.swoole-table.php                             30-Sep-2022 11:01               10956
class.swoole-timer.php                             30-Sep-2022 11:01                4479
class.swoole-websocket-frame.php                   30-Sep-2022 11:01                1854
class.swoole-websocket-server.php                  30-Sep-2022 11:01                6986
class.syncevent.php                                30-Sep-2022 11:01                4286
class.syncmutex.php                                30-Sep-2022 11:01                3777
class.syncreaderwriter.php                         30-Sep-2022 11:01                4642
class.syncsemaphore.php                            30-Sep-2022 11:01                4098
class.syncsharedmemory.php                         30-Sep-2022 11:01                4941
class.sysvmessagequeue.php                         30-Sep-2022 11:01                1830
class.sysvsemaphore.php                            30-Sep-2022 11:01                1815
class.sysvsharedmemory.php                         30-Sep-2022 11:01                1818
class.thread.php                                   30-Sep-2022 11:01               10116
class.threaded.php                                 30-Sep-2022 11:01                8003
class.throwable.php                                30-Sep-2022 11:00                6695
class.tidy.php                                     30-Sep-2022 11:01               17352
class.tidynode.php                                 30-Sep-2022 11:01               10457
class.transliterator.php                           30-Sep-2022 11:00                8449
class.traversable.php                              30-Sep-2022 11:00                3796
class.typeerror.php                                30-Sep-2022 11:00                7650
class.uconverter.php                               30-Sep-2022 11:00               32283
class.ui-area.php                                  30-Sep-2022 11:01               11098
class.ui-control.php                               30-Sep-2022 11:01                5206
class.ui-controls-box.php                          30-Sep-2022 11:01                9116
class.ui-controls-button.php                       30-Sep-2022 11:01                6227
class.ui-controls-check.php                        30-Sep-2022 11:01                6953
class.ui-controls-colorbutton.php                  30-Sep-2022 11:01                6263
class.ui-controls-combo.php                        30-Sep-2022 11:01                6199
class.ui-controls-editablecombo.php                30-Sep-2022 11:01                6307
class.ui-controls-entry.php                        30-Sep-2022 11:01                8691
class.ui-controls-form.php                         30-Sep-2022 11:01                7313
class.ui-controls-grid.php                         30-Sep-2022 11:01               11277
class.ui-controls-group.php                        30-Sep-2022 11:01                7787
class.ui-controls-label.php                        30-Sep-2022 11:01                5978
class.ui-controls-multilineentry.php               30-Sep-2022 11:01                8974
class.ui-controls-picker.php                       30-Sep-2022 11:01                6858
class.ui-controls-progress.php                     30-Sep-2022 11:01                5543
class.ui-controls-radio.php                        30-Sep-2022 11:01                6178
class.ui-controls-separator.php                    30-Sep-2022 11:01                6476
class.ui-controls-slider.php                       30-Sep-2022 11:01                6510
class.ui-controls-spin.php                         30-Sep-2022 11:01                6380
class.ui-controls-tab.php                          30-Sep-2022 11:01                8238
class.ui-draw-brush-gradient.php                   30-Sep-2022 11:01                6321
class.ui-draw-brush-lineargradient.php             30-Sep-2022 11:01                5682
class.ui-draw-brush-radialgradient.php             30-Sep-2022 11:01                5810
class.ui-draw-brush.php                            30-Sep-2022 11:01                4176
class.ui-draw-color.php                            30-Sep-2022 11:01                7706
class.ui-draw-line-cap.php                         30-Sep-2022 11:01                2396
class.ui-draw-line-join.php                        30-Sep-2022 11:01                2356
class.ui-draw-matrix.php                           30-Sep-2022 11:01                5415
class.ui-draw-path.php                             30-Sep-2022 11:01                9441
class.ui-draw-pen.php                              30-Sep-2022 11:01                7923
class.ui-draw-stroke.php                           30-Sep-2022 11:01                6094
class.ui-draw-text-font-descriptor.php             30-Sep-2022 11:01                5368
class.ui-draw-text-font-italic.php                 30-Sep-2022 11:01                2586
class.ui-draw-text-font-stretch.php                30-Sep-2022 11:01                3985
class.ui-draw-text-font-weight.php                 30-Sep-2022 11:01                3964
class.ui-draw-text-font.php                        30-Sep-2022 11:01                4491
class.ui-draw-text-layout.php                      30-Sep-2022 11:01                4725
class.ui-exception-invalidargumentexception.php    30-Sep-2022 11:01                6854
class.ui-exception-runtimeexception.php            30-Sep-2022 11:01                6777
class.ui-executor.php                              30-Sep-2022 11:01                4826
class.ui-key.php                                   30-Sep-2022 11:01                9128
class.ui-menu.php                                  30-Sep-2022 11:01                5720
class.ui-menuitem.php                              30-Sep-2022 11:01                3552
class.ui-point.php                                 30-Sep-2022 11:01                5814
class.ui-size.php                                  30-Sep-2022 11:01                5910
class.ui-window.php                                30-Sep-2022 11:01               11795
class.underflowexception.php                       30-Sep-2022 11:01                6729
class.unexpectedvalueexception.php                 30-Sep-2022 11:01                6889
class.unhandledmatcherror.php                      30-Sep-2022 11:00                6617
class.unitenum.php                                 30-Sep-2022 11:00                2716
class.v8js.php                                     30-Sep-2022 11:01                7745
class.v8jsexception.php                            30-Sep-2022 11:01               10186
class.valueerror.php                               30-Sep-2022 11:00                6697
class.variant.php                                  30-Sep-2022 11:01                5550
class.varnishadmin.php                             30-Sep-2022 11:01                9880
class.varnishlog.php                               30-Sep-2022 11:01               28010
class.varnishstat.php                              30-Sep-2022 11:01                2803
class.volatile.php                                 30-Sep-2022 11:01               11544
class.vtiful-kernel-excel.php                      30-Sep-2022 11:00               10225
class.vtiful-kernel-format.php                     30-Sep-2022 11:00               13132
class.weakmap.php                                  30-Sep-2022 11:00                9460
class.weakreference.php                            30-Sep-2022 11:00                5484
class.win32serviceexception.php                    30-Sep-2022 11:01                6905
class.wkhtmltox-image-converter.php                30-Sep-2022 11:00                3775
class.wkhtmltox-pdf-converter.php                  30-Sep-2022 11:00                4134
class.wkhtmltox-pdf-object.php                     30-Sep-2022 11:00                2790
class.worker.php                                   30-Sep-2022 11:01                7639
class.xmldiff-base.php                             30-Sep-2022 11:01                4217
class.xmldiff-dom.php                              30-Sep-2022 11:01                5232
class.xmldiff-file.php                             30-Sep-2022 11:01                4848
class.xmldiff-memory.php                           30-Sep-2022 11:01                4880
class.xmlparser.php                                30-Sep-2022 11:01                1801
class.xmlreader.php                                30-Sep-2022 11:01               32195
class.xmlwriter.php                                30-Sep-2022 11:01               25086
class.xsltprocessor.php                            30-Sep-2022 11:01                9448
class.yac.php                                      30-Sep-2022 11:00                8351
class.yaconf.php                                   30-Sep-2022 11:01                3299
class.yaf-action-abstract.php                      30-Sep-2022 11:01               11551
class.yaf-application.php                          30-Sep-2022 11:01               12354
class.yaf-bootstrap-abstract.php                   30-Sep-2022 11:01                6148
class.yaf-config-abstract.php                      30-Sep-2022 11:01                5046
class.yaf-config-ini.php                           30-Sep-2022 11:01               16547
class.yaf-config-simple.php                        30-Sep-2022 11:01               11990
class.yaf-controller-abstract.php                  30-Sep-2022 11:01               18679
class.yaf-dispatcher.php                           30-Sep-2022 11:01               19345
class.yaf-exception-dispatchfailed.php             30-Sep-2022 11:01                2538
class.yaf-exception-loadfailed-action.php          30-Sep-2022 11:01                2609
class.yaf-exception-loadfailed-controller.php      30-Sep-2022 11:01                2634
class.yaf-exception-loadfailed-module.php          30-Sep-2022 11:01                2598
class.yaf-exception-loadfailed-view.php            30-Sep-2022 11:01                2538
class.yaf-exception-loadfailed.php                 30-Sep-2022 11:01                2512
class.yaf-exception-routerfailed.php               30-Sep-2022 11:01                2523
class.yaf-exception-startuperror.php               30-Sep-2022 11:01                2521
class.yaf-exception-typeerror.php                  30-Sep-2022 11:01                2492
class.yaf-exception.php                            30-Sep-2022 11:01                7531
class.yaf-loader.php                               30-Sep-2022 11:01               17970
class.yaf-plugin-abstract.php                      30-Sep-2022 11:01               18327
class.yaf-registry.php                             30-Sep-2022 11:01                5551
class.yaf-request-abstract.php                     30-Sep-2022 11:01               21233
class.yaf-request-http.php                         30-Sep-2022 11:01               20481
class.yaf-request-simple.php                       30-Sep-2022 11:01               19728
class.yaf-response-abstract.php                    30-Sep-2022 11:01               10498
class.yaf-route-interface.php                      30-Sep-2022 11:01                3418
class.yaf-route-map.php                            30-Sep-2022 11:01                6022
class.yaf-route-regex.php                          30-Sep-2022 11:01                7508
class.yaf-route-rewrite.php                        30-Sep-2022 11:01                6783
class.yaf-route-simple.php                         30-Sep-2022 11:01                6039
class.yaf-route-static.php                         30-Sep-2022 11:01                4653
class.yaf-route-supervar.php                       30-Sep-2022 11:01                4369
class.yaf-router.php                               30-Sep-2022 11:01               11701
class.yaf-session.php                              30-Sep-2022 11:01               11401
class.yaf-view-interface.php                       30-Sep-2022 11:01                5338
class.yaf-view-simple.php                          30-Sep-2022 11:01                9884
class.yar-client-exception.php                     30-Sep-2022 11:01                6003
class.yar-client.php                               30-Sep-2022 11:01                5458
class.yar-concurrent-client.php                    30-Sep-2022 11:01                6147
class.yar-server-exception.php                     30-Sep-2022 11:01                6463
class.yar-server.php                               30-Sep-2022 11:01                3284
class.ziparchive.php                               30-Sep-2022 11:00               38837
class.zmq.php                                      30-Sep-2022 11:01               32613
class.zmqcontext.php                               30-Sep-2022 11:01                5046
class.zmqdevice.php                                30-Sep-2022 11:01                6803
class.zmqpoll.php                                  30-Sep-2022 11:01                4671
class.zmqsocket.php                                30-Sep-2022 11:01                9970
class.zookeeper.php                                30-Sep-2022 11:01               46810
class.zookeeperauthenticationexception.php         30-Sep-2022 11:01                6784
class.zookeeperconfig.php                          30-Sep-2022 11:01                5386
class.zookeeperconnectionexception.php             30-Sep-2022 11:01                6779
class.zookeeperexception.php                       30-Sep-2022 11:01                6645
class.zookeepermarshallingexception.php            30-Sep-2022 11:01                6800
class.zookeepernonodeexception.php                 30-Sep-2022 11:01                6767
class.zookeeperoperationtimeoutexception.php       30-Sep-2022 11:01                6810
class.zookeepersessionexception.php                30-Sep-2022 11:01                6727
classobj.configuration.php                         30-Sep-2022 11:01                1227
classobj.constants.php                             30-Sep-2022 11:01                1136
classobj.examples.php                              30-Sep-2022 11:01               15062
classobj.installation.php                          30-Sep-2022 11:01                1210
classobj.requirements.php                          30-Sep-2022 11:01                1174
classobj.resources.php                             30-Sep-2022 11:01                1172
classobj.setup.php                                 30-Sep-2022 11:01                1565
closure.bind.php                                   30-Sep-2022 11:00                7705
closure.bindto.php                                 30-Sep-2022 11:00                9132
closure.call.php                                   30-Sep-2022 11:00                6552
closure.construct.php                              30-Sep-2022 11:00                2411
closure.fromcallable.php                           30-Sep-2022 11:00                3768
cmark.installation.php                             30-Sep-2022 11:01                1933
cmark.requirements.php                             30-Sep-2022 11:01                1263
cmark.setup.php                                    30-Sep-2022 11:01                1393
collator.asort.php                                 30-Sep-2022 11:00                8964
collator.compare.php                               30-Sep-2022 11:00               10474
collator.construct.php                             30-Sep-2022 11:00                5539
collator.create.php                                30-Sep-2022 11:00                5339
collator.getattribute.php                          30-Sep-2022 11:00                5839
collator.geterrorcode.php                          30-Sep-2022 11:00                5125
collator.geterrormessage.php                       30-Sep-2022 11:00                5187
collator.getlocale.php                             30-Sep-2022 11:00                6521
collator.getsortkey.php                            30-Sep-2022 11:00                6528
collator.getstrength.php                           30-Sep-2022 11:00                4774
collator.setattribute.php                          30-Sep-2022 11:00                6390
collator.setstrength.php                           30-Sep-2022 11:00               12753
collator.sort.php                                  30-Sep-2022 11:00                7669
collator.sortwithsortkeys.php                      30-Sep-2022 11:00                6245
collectable.isgarbage.php                          30-Sep-2022 11:01                2651
com.configuration.php                              30-Sep-2022 11:01                7664
com.constants.php                                  30-Sep-2022 11:01               18641
com.construct.php                                  30-Sep-2022 11:01                8035
com.error-handling.php                             30-Sep-2022 11:01                1552
com.examples.arrays.php                            30-Sep-2022 11:01                2053
com.examples.foreach.php                           30-Sep-2022 11:01                2958
com.examples.php                                   30-Sep-2022 11:01                1400
com.installation.php                               30-Sep-2022 11:01                1560
com.requirements.php                               30-Sep-2022 11:01                1223
com.resources.php                                  30-Sep-2022 11:01                1137
com.setup.php                                      30-Sep-2022 11:01                1515
commonmark-cql.construct.php                       30-Sep-2022 11:01                2121
commonmark-cql.invoke.php                          30-Sep-2022 11:01                3738
commonmark-interfaces-ivisitable.accept.php        30-Sep-2022 11:01                3100
commonmark-interfaces-ivisitor.enter.php           30-Sep-2022 11:01                4099
commonmark-interfaces-ivisitor.leave.php           30-Sep-2022 11:01                4101
commonmark-node-bulletlist.construct.php           30-Sep-2022 11:01                2971
commonmark-node-codeblock.construct.php            30-Sep-2022 11:01                2689
commonmark-node-heading.construct.php              30-Sep-2022 11:01                2528
commonmark-node-image.construct.php                30-Sep-2022 11:01                3072
commonmark-node-link.construct.php                 30-Sep-2022 11:01                3069
commonmark-node-orderedlist.construct.php          30-Sep-2022 11:01                3793
commonmark-node-text.construct.php                 30-Sep-2022 11:01                2573
commonmark-node.accept.php                         30-Sep-2022 11:01                2840
commonmark-node.appendchild.php                    30-Sep-2022 11:01                2673
commonmark-node.insertafter.php                    30-Sep-2022 11:01                2698
commonmark-node.insertbefore.php                   30-Sep-2022 11:01                2696
commonmark-node.prependchild.php                   30-Sep-2022 11:01                2700
commonmark-node.replace.php                        30-Sep-2022 11:01                2644
commonmark-node.unlink.php                         30-Sep-2022 11:01                2311
commonmark-parser.construct.php                    30-Sep-2022 11:01                3225
commonmark-parser.finish.php                       30-Sep-2022 11:01                2366
commonmark-parser.parse.php                        30-Sep-2022 11:01                2518
compersisthelper.construct.php                     30-Sep-2022 11:01                3456
compersisthelper.getcurfilename.php                30-Sep-2022 11:01                3011
compersisthelper.getmaxstreamsize.php              30-Sep-2022 11:01                3045
compersisthelper.initnew.php                       30-Sep-2022 11:01                2877
compersisthelper.loadfromfile.php                  30-Sep-2022 11:01                3985
compersisthelper.loadfromstream.php                30-Sep-2022 11:01                3252
compersisthelper.savetofile.php                    30-Sep-2022 11:01                5886
compersisthelper.savetostream.php                  30-Sep-2022 11:01                3279
componere-abstract-definition.addinterface.php     30-Sep-2022 11:00                3244
componere-abstract-definition.addmethod.php        30-Sep-2022 11:00                4012
componere-abstract-definition.addtrait.php         30-Sep-2022 11:00                3196
componere-abstract-definition.getreflector.php     30-Sep-2022 11:00                2358
componere-definition.addconstant.php               30-Sep-2022 11:00                4300
componere-definition.addproperty.php               30-Sep-2022 11:00                3707
componere-definition.construct.php                 30-Sep-2022 11:00                5457
componere-definition.getclosure.php                30-Sep-2022 11:00                3372
componere-definition.getclosures.php               30-Sep-2022 11:00                2620
componere-definition.isregistered.php              30-Sep-2022 11:00                2181
componere-definition.register.php                  30-Sep-2022 11:00                2402
componere-method.construct.php                     30-Sep-2022 11:00                2177
componere-method.getreflector.php                  30-Sep-2022 11:00                2161
componere-method.setprivate.php                    30-Sep-2022 11:00                2423
componere-method.setprotected.php                  30-Sep-2022 11:00                2438
componere-method.setstatic.php                     30-Sep-2022 11:00                2019
componere-patch.apply.php                          30-Sep-2022 11:00                1822
componere-patch.construct.php                      30-Sep-2022 11:00                3417
componere-patch.derive.php                         30-Sep-2022 11:00                3155
componere-patch.getclosure.php                     30-Sep-2022 11:00                2964
componere-patch.getclosures.php                    30-Sep-2022 11:00                2103
componere-patch.isapplied.php                      30-Sep-2022 11:00                1742
componere-patch.revert.php                         30-Sep-2022 11:00                1819
componere-value.construct.php                      30-Sep-2022 11:00                2611
componere-value.hasdefault.php                     30-Sep-2022 11:00                1789
componere-value.isprivate.php                      30-Sep-2022 11:00                1807
componere-value.isprotected.php                    30-Sep-2022 11:00                1817
componere-value.isstatic.php                       30-Sep-2022 11:00                1801
componere-value.setprivate.php                     30-Sep-2022 11:00                2445
componere-value.setprotected.php                   30-Sep-2022 11:00                2459
componere-value.setstatic.php                      30-Sep-2022 11:00                2035
componere.cast.php                                 30-Sep-2022 11:00                4877
componere.cast_by_ref.php                          30-Sep-2022 11:00                5049
componere.installation.php                         30-Sep-2022 11:00                1304
componere.requirements.php                         30-Sep-2022 11:00                1153
componere.setup.php                                30-Sep-2022 11:00                1432
configuration.changes.modes.php                    30-Sep-2022 11:00                3610
configuration.changes.php                          30-Sep-2022 11:00                8415
configuration.file.per-user.php                    30-Sep-2022 11:00                2961
configuration.file.php                             30-Sep-2022 11:00                9659
configuration.php                                  30-Sep-2022 11:00                1633
configure.about.php                                30-Sep-2022 11:01               12001
configure.php                                      30-Sep-2022 11:01                1365
context.curl.php                                   30-Sep-2022 11:00                8591
context.ftp.php                                    30-Sep-2022 11:00                3953
context.http.php                                   30-Sep-2022 11:00               15529
context.params.php                                 30-Sep-2022 11:00                2424
context.phar.php                                   30-Sep-2022 11:00                2725
context.php                                        30-Sep-2022 11:00                2755
context.socket.php                                 30-Sep-2022 11:00                9991
context.ssl.php                                    30-Sep-2022 11:00               10770
context.zip.php                                    30-Sep-2022 11:00                4356
control-structures.alternative-syntax.php          30-Sep-2022 11:00                7137
control-structures.break.php                       30-Sep-2022 11:00                5485
control-structures.continue.php                    30-Sep-2022 11:00                7539
control-structures.declare.php                     30-Sep-2022 11:00               10360
control-structures.do.while.php                    30-Sep-2022 11:00                5313
control-structures.else.php                        30-Sep-2022 11:00                4805
control-structures.elseif.php                      30-Sep-2022 11:00                7801
control-structures.for.php                         30-Sep-2022 11:00               12391
control-structures.foreach.php                     30-Sep-2022 11:00               22997
control-structures.goto.php                        30-Sep-2022 11:00                6979
control-structures.if.php                          30-Sep-2022 11:00                4735
control-structures.intro.php                       30-Sep-2022 11:00                2507
control-structures.match.php                       30-Sep-2022 11:00               19468
control-structures.switch.php                      30-Sep-2022 11:00               21783
control-structures.while.php                       30-Sep-2022 11:00                4814
copyright.php                                      30-Sep-2022 11:00                1981
countable.count.php                                30-Sep-2022 11:01                5416
csprng.configuration.php                           30-Sep-2022 11:00                1213
csprng.constants.php                               30-Sep-2022 11:00                1116
csprng.installation.php                            30-Sep-2022 11:00                1196
csprng.requirements.php                            30-Sep-2022 11:00                1160
csprng.resources.php                               30-Sep-2022 11:00                1158
csprng.setup.php                                   30-Sep-2022 11:00                1532
ctype.configuration.php                            30-Sep-2022 11:01                1206
ctype.constants.php                                30-Sep-2022 11:01                1107
ctype.installation.php                             30-Sep-2022 11:01                1377
ctype.requirements.php                             30-Sep-2022 11:01                1184
ctype.resources.php                                30-Sep-2022 11:01                1151
ctype.setup.php                                    30-Sep-2022 11:01                1524
cubrid.configuration.php                           30-Sep-2022 11:00                1165
cubrid.constants.php                               30-Sep-2022 11:00               13745
cubrid.examples.php                                30-Sep-2022 11:00               21167
cubrid.installation.php                            30-Sep-2022 11:00                2015
cubrid.requirements.php                            30-Sep-2022 11:00                1229
cubrid.resources.php                               30-Sep-2022 11:00                3052
cubrid.setup.php                                   30-Sep-2022 11:00                1538
cubridmysql.cubrid.php                             30-Sep-2022 11:00                4906
curl.configuration.php                             30-Sep-2022 11:01                2343
curl.constants.php                                 30-Sep-2022 11:01              100165
curl.examples-basic.php                            30-Sep-2022 11:01                4621
curl.examples.php                                  30-Sep-2022 11:01                1328
curl.installation.php                              30-Sep-2022 11:01                2426
curl.requirements.php                              30-Sep-2022 11:01                1411
curl.resources.php                                 30-Sep-2022 11:01                1321
curl.setup.php                                     30-Sep-2022 11:01                1532
curlfile.construct.php                             30-Sep-2022 11:01               20990
curlfile.getfilename.php                           30-Sep-2022 11:01                2037
curlfile.getmimetype.php                           30-Sep-2022 11:01                2043
curlfile.getpostfilename.php                       30-Sep-2022 11:01                2093
curlfile.setmimetype.php                           30-Sep-2022 11:01                2309
curlfile.setpostfilename.php                       30-Sep-2022 11:01                2350
curlstringfile.construct.php                       30-Sep-2022 11:01                6839
dateinterval.construct.php                         30-Sep-2022 11:00               12877
dateinterval.createfromdatestring.php              30-Sep-2022 11:00               15056
dateinterval.format.php                            30-Sep-2022 11:00               14597
dateperiod.construct.php                           30-Sep-2022 11:00               18593
dateperiod.getdateinterval.php                     30-Sep-2022 11:00                4610
dateperiod.getenddate.php                          30-Sep-2022 11:00                7552
dateperiod.getrecurrences.php                      30-Sep-2022 11:00                2594
dateperiod.getstartdate.php                        30-Sep-2022 11:00                5039
datetime.add.php                                   30-Sep-2022 11:00                4872
datetime.configuration.php                         30-Sep-2022 11:00                5616
datetime.constants.php                             30-Sep-2022 11:00                2475
datetime.construct.php                             30-Sep-2022 11:00                4798
datetime.createfromformat.php                      30-Sep-2022 11:00                5242
datetime.createfromimmutable.php                   30-Sep-2022 11:00                4260
datetime.createfrominterface.php                   30-Sep-2022 11:00                4877
datetime.diff.php                                  30-Sep-2022 11:00               14714
datetime.examples-arithmetic.php                   30-Sep-2022 11:00               15965
datetime.examples.php                              30-Sep-2022 11:00                1384
datetime.format.php                                30-Sep-2022 11:00               22370
datetime.formats.compound.php                      30-Sep-2022 11:00               12010
datetime.formats.date.php                          30-Sep-2022 11:00               14341
datetime.formats.php                               30-Sep-2022 11:00                7188
datetime.formats.relative.php                      30-Sep-2022 11:00               15982
datetime.formats.time.php                          30-Sep-2022 11:00                7343
datetime.getlasterrors.php                         30-Sep-2022 11:00                3489
datetime.getoffset.php                             30-Sep-2022 11:00                8177
datetime.gettimestamp.php                          30-Sep-2022 11:00                6893
datetime.gettimezone.php                           30-Sep-2022 11:00                7621
datetime.installation.php                          30-Sep-2022 11:00                1567
datetime.modify.php                                30-Sep-2022 11:00               10306
datetime.requirements.php                          30-Sep-2022 11:00                1174
datetime.resources.php                             30-Sep-2022 11:00                1172
datetime.set-state.php                             30-Sep-2022 11:00                2758
datetime.setdate.php                               30-Sep-2022 11:00                5190
datetime.setisodate.php                            30-Sep-2022 11:00                5359
datetime.settime.php                               30-Sep-2022 11:00                6572
datetime.settimestamp.php                          30-Sep-2022 11:00                4820
datetime.settimezone.php                           30-Sep-2022 11:00                9337
datetime.setup.php                                 30-Sep-2022 11:00                1587
datetime.sub.php                                   30-Sep-2022 11:00                4805
datetime.wakeup.php                                30-Sep-2022 11:00                2906
datetimeimmutable.add.php                          30-Sep-2022 11:00               10744
datetimeimmutable.construct.php                    30-Sep-2022 11:00               18232
datetimeimmutable.createfromformat.php             30-Sep-2022 11:00               43764
datetimeimmutable.createfrominterface.php          30-Sep-2022 11:00                5141
datetimeimmutable.createfrommutable.php            30-Sep-2022 11:00                4419
datetimeimmutable.getlasterrors.php                30-Sep-2022 11:00                4899
datetimeimmutable.modify.php                       30-Sep-2022 11:00                8207
datetimeimmutable.set-state.php                    30-Sep-2022 11:00                2673
datetimeimmutable.setdate.php                      30-Sep-2022 11:00                9111
datetimeimmutable.setisodate.php                   30-Sep-2022 11:00               12827
datetimeimmutable.settime.php                      30-Sep-2022 11:00               11973
datetimeimmutable.settimestamp.php                 30-Sep-2022 11:00                5738
datetimeimmutable.settimezone.php                  30-Sep-2022 11:00                5995
datetimeimmutable.sub.php                          30-Sep-2022 11:00               10943
datetimezone.construct.php                         30-Sep-2022 11:00                9842
datetimezone.getlocation.php                       30-Sep-2022 11:00                5629
datetimezone.getname.php                           30-Sep-2022 11:00                3449
datetimezone.getoffset.php                         30-Sep-2022 11:00                7781
datetimezone.gettransitions.php                    30-Sep-2022 11:00               10907
datetimezone.listabbreviations.php                 30-Sep-2022 11:00                5862
datetimezone.listidentifiers.php                   30-Sep-2022 11:00               14103
dba.configuration.php                              30-Sep-2022 11:00                2153
dba.constants.php                                  30-Sep-2022 11:00                1867
dba.example.php                                    30-Sep-2022 11:00                6651
dba.examples.php                                   30-Sep-2022 11:00                1289
dba.installation.php                               30-Sep-2022 11:00                9370
dba.requirements.php                               30-Sep-2022 11:00                7177
dba.resources.php                                  30-Sep-2022 11:00                1416
dba.setup.php                                      30-Sep-2022 11:00                1519
dbase.configuration.php                            30-Sep-2022 11:00                1206
dbase.constants.php                                30-Sep-2022 11:00                3026
dbase.installation.php                             30-Sep-2022 11:00                1533
dbase.requirements.php                             30-Sep-2022 11:00                1153
dbase.resources.php                                30-Sep-2022 11:00                1428
dbase.setup.php                                    30-Sep-2022 11:00                1540
debugger-about.php                                 30-Sep-2022 11:01                1782
debugger.php                                       30-Sep-2022 11:01                1344
dio.configuration.php                              30-Sep-2022 11:00                1192
dio.constants.php                                  30-Sep-2022 11:00                7200
dio.installation.php                               30-Sep-2022 11:00                1937
dio.requirements.php                               30-Sep-2022 11:00                1139
dio.resources.php                                  30-Sep-2022 11:00                1274
dio.setup.php                                      30-Sep-2022 11:00                1520
dir.configuration.php                              30-Sep-2022 11:00                1192
dir.constants.php                                  30-Sep-2022 11:00                2142
dir.installation.php                               30-Sep-2022 11:00                1175
dir.requirements.php                               30-Sep-2022 11:00                1139
dir.resources.php                                  30-Sep-2022 11:00                1137
dir.setup.php                                      30-Sep-2022 11:00                1515
directory.close.php                                30-Sep-2022 11:00                2117
directory.read.php                                 30-Sep-2022 11:00                2190
directory.rewind.php                               30-Sep-2022 11:00                2129
directoryiterator.construct.php                    30-Sep-2022 11:01                5851
directoryiterator.current.php                      30-Sep-2022 11:01                6253
directoryiterator.getatime.php                     30-Sep-2022 11:01                5628
directoryiterator.getbasename.php                  30-Sep-2022 11:01                6690
directoryiterator.getctime.php                     30-Sep-2022 11:01                5715
directoryiterator.getextension.php                 30-Sep-2022 11:01                6067
directoryiterator.getfilename.php                  30-Sep-2022 11:01                5356
directoryiterator.getgroup.php                     30-Sep-2022 11:01                5757
directoryiterator.getinode.php                     30-Sep-2022 11:01                4611
directoryiterator.getmtime.php                     30-Sep-2022 11:01                5643
directoryiterator.getowner.php                     30-Sep-2022 11:01                5176
directoryiterator.getpath.php                      30-Sep-2022 11:01                4756
directoryiterator.getpathname.php                  30-Sep-2022 11:01                5151
directoryiterator.getperms.php                     30-Sep-2022 11:01                6075
directoryiterator.getsize.php                      30-Sep-2022 11:01                4889
directoryiterator.gettype.php                      30-Sep-2022 11:01                5705
directoryiterator.isdir.php                        30-Sep-2022 11:01                5549
directoryiterator.isdot.php                        30-Sep-2022 11:01                5783
directoryiterator.isexecutable.php                 30-Sep-2022 11:01                5434
directoryiterator.isfile.php                       30-Sep-2022 11:01                5704
directoryiterator.islink.php                       30-Sep-2022 11:01                7346
directoryiterator.isreadable.php                   30-Sep-2022 11:01                5286
directoryiterator.iswritable.php                   30-Sep-2022 11:01                5462
directoryiterator.key.php                          30-Sep-2022 11:01                6643
directoryiterator.next.php                         30-Sep-2022 11:01                5477
directoryiterator.rewind.php                       30-Sep-2022 11:01                5405
directoryiterator.seek.php                         30-Sep-2022 11:01                5322
directoryiterator.tostring.php                     30-Sep-2022 11:01                4586
directoryiterator.valid.php                        30-Sep-2022 11:01                5707
doc.changelog.php                                  30-Sep-2022 11:01              262103
dom.configuration.php                              30-Sep-2022 11:01                1192
dom.constants.php                                  30-Sep-2022 11:01               14241
dom.examples.php                                   30-Sep-2022 11:01                2917
dom.installation.php                               30-Sep-2022 11:01                1259
dom.requirements.php                               30-Sep-2022 11:01                1443
dom.resources.php                                  30-Sep-2022 11:01                1137
dom.setup.php                                      30-Sep-2022 11:01                1509
domattr.construct.php                              30-Sep-2022 11:01                5473
domattr.isid.php                                   30-Sep-2022 11:01                4951
domcdatasection.construct.php                      30-Sep-2022 11:01                5146
domcharacterdata.appenddata.php                    30-Sep-2022 11:01                3655
domcharacterdata.deletedata.php                    30-Sep-2022 11:01                4662
domcharacterdata.insertdata.php                    30-Sep-2022 11:01                4382
domcharacterdata.replacedata.php                   30-Sep-2022 11:01                5002
domcharacterdata.substringdata.php                 30-Sep-2022 11:01                4669
domchildnode.after.php                             30-Sep-2022 11:01                3470
domchildnode.before.php                            30-Sep-2022 11:01                3285
domchildnode.remove.php                            30-Sep-2022 11:01                3072
domchildnode.replacewith.php                       30-Sep-2022 11:01                3691
domcomment.construct.php                           30-Sep-2022 11:01                4997
domdocument.construct.php                          30-Sep-2022 11:01                4280
domdocument.createattribute.php                    30-Sep-2022 11:01                5753
domdocument.createattributens.php                  30-Sep-2022 11:01                6598
domdocument.createcdatasection.php                 30-Sep-2022 11:01                5426
domdocument.createcomment.php                      30-Sep-2022 11:01                5826
domdocument.createdocumentfragment.php             30-Sep-2022 11:01                5709
domdocument.createelement.php                      30-Sep-2022 11:01               11299
domdocument.createelementns.php                    30-Sep-2022 11:01               14008
domdocument.createentityreference.php              30-Sep-2022 11:01                6070
domdocument.createprocessinginstruction.php        30-Sep-2022 11:01                6334
domdocument.createtextnode.php                     30-Sep-2022 11:01                5814
domdocument.getelementbyid.php                     30-Sep-2022 11:01                7585
domdocument.getelementsbytagname.php               30-Sep-2022 11:01                6121
domdocument.getelementsbytagnamens.php             30-Sep-2022 11:01                7593
domdocument.importnode.php                         30-Sep-2022 11:01                8930
domdocument.load.php                               30-Sep-2022 11:01                6084
domdocument.loadhtml.php                           30-Sep-2022 11:01                6675
domdocument.loadhtmlfile.php                       30-Sep-2022 11:01                6422
domdocument.loadxml.php                            30-Sep-2022 11:01                6834
domdocument.normalizedocument.php                  30-Sep-2022 11:01                2923
domdocument.registernodeclass.php                  30-Sep-2022 11:01               21067
domdocument.relaxngvalidate.php                    30-Sep-2022 11:01                3797
domdocument.relaxngvalidatesource.php              30-Sep-2022 11:01                3830
domdocument.save.php                               30-Sep-2022 11:01                7539
domdocument.savehtml.php                           30-Sep-2022 11:01                7428
domdocument.savehtmlfile.php                       30-Sep-2022 11:01                7977
domdocument.savexml.php                            30-Sep-2022 11:01                8852
domdocument.schemavalidate.php                     30-Sep-2022 11:01                4129
domdocument.schemavalidatesource.php               30-Sep-2022 11:01                4191
domdocument.validate.php                           30-Sep-2022 11:01                5927
domdocument.xinclude.php                           30-Sep-2022 11:01                7086
domdocumentfragment.appendxml.php                  30-Sep-2022 11:01                5280
domdocumentfragment.construct.php                  30-Sep-2022 11:01                2068
domelement.construct.php                           30-Sep-2022 11:01                6491
domelement.getattribute.php                        30-Sep-2022 11:01                3409
domelement.getattributenode.php                    30-Sep-2022 11:01                3932
domelement.getattributenodens.php                  30-Sep-2022 11:01                4316
domelement.getattributens.php                      30-Sep-2022 11:01                3867
domelement.getelementsbytagname.php                30-Sep-2022 11:01                3548
domelement.getelementsbytagnamens.php              30-Sep-2022 11:01                4264
domelement.hasattribute.php                        30-Sep-2022 11:01                3601
domelement.hasattributens.php                      30-Sep-2022 11:01                3975
domelement.removeattribute.php                     30-Sep-2022 11:01                3750
domelement.removeattributenode.php                 30-Sep-2022 11:01                4185
domelement.removeattributens.php                   30-Sep-2022 11:01                4155
domelement.setattribute.php                        30-Sep-2022 11:01                5963
domelement.setattributenode.php                    30-Sep-2022 11:01                3947
domelement.setattributenodens.php                  30-Sep-2022 11:01                3945
domelement.setattributens.php                      30-Sep-2022 11:01                4837
domelement.setidattribute.php                      30-Sep-2022 11:01                4465
domelement.setidattributenode.php                  30-Sep-2022 11:01                4519
domelement.setidattributens.php                    30-Sep-2022 11:01                4832
domentityreference.construct.php                   30-Sep-2022 11:01                4829
domimplementation.construct.php                    30-Sep-2022 11:01                2097
domimplementation.createdocument.php               30-Sep-2022 11:01                6736
domimplementation.createdocumenttype.php           30-Sep-2022 11:01                9235
domimplementation.hasfeature.php                   30-Sep-2022 11:01                9615
domnamednodemap.count.php                          30-Sep-2022 11:01                2315
domnamednodemap.getnameditem.php                   30-Sep-2022 11:01                3250
domnamednodemap.getnameditemns.php                 30-Sep-2022 11:01                3628
domnamednodemap.item.php                           30-Sep-2022 11:01                2836
domnode.appendchild.php                            30-Sep-2022 11:01                8505
domnode.c14n.php                                   30-Sep-2022 11:01                4243
domnode.c14nfile.php                               30-Sep-2022 11:01                4523
domnode.clonenode.php                              30-Sep-2022 11:01                2605
domnode.getlineno.php                              30-Sep-2022 11:01                4845
domnode.getnodepath.php                            30-Sep-2022 11:01                5125
domnode.hasattributes.php                          30-Sep-2022 11:01                2682
domnode.haschildnodes.php                          30-Sep-2022 11:01                2604
domnode.insertbefore.php                           30-Sep-2022 11:01                4988
domnode.isdefaultnamespace.php                     30-Sep-2022 11:01                2656
domnode.issamenode.php                             30-Sep-2022 11:01                2593
domnode.issupported.php                            30-Sep-2022 11:01                3484
domnode.lookupnamespaceuri.php                     30-Sep-2022 11:01                2934
domnode.lookupprefix.php                           30-Sep-2022 11:01                2910
domnode.normalize.php                              30-Sep-2022 11:01                2749
domnode.removechild.php                            30-Sep-2022 11:01                6853
domnode.replacechild.php                           30-Sep-2022 11:01                5388
domnodelist.count.php                              30-Sep-2022 11:01                2228
domnodelist.item.php                               30-Sep-2022 11:01                6760
domparentnode.append.php                           30-Sep-2022 11:01                2976
domparentnode.prepend.php                          30-Sep-2022 11:01                3009
domprocessinginstruction.construct.php             30-Sep-2022 11:01                6606
domtext.construct.php                              30-Sep-2022 11:01                4795
domtext.iselementcontentwhitespace.php             30-Sep-2022 11:01                2408
domtext.iswhitespaceinelementcontent.php           30-Sep-2022 11:01                2624
domtext.splittext.php                              30-Sep-2022 11:01                3104
domxpath.construct.php                             30-Sep-2022 11:01                2731
domxpath.evaluate.php                              30-Sep-2022 11:01                7389
domxpath.query.php                                 30-Sep-2022 11:01               12202
domxpath.registernamespace.php                     30-Sep-2022 11:01                2964
domxpath.registerphpfunctions.php                  30-Sep-2022 11:01               13982
dotnet.construct.php                               30-Sep-2022 11:01                2854
ds-collection.clear.php                            30-Sep-2022 11:01                3942
ds-collection.copy.php                             30-Sep-2022 11:01                4391
ds-collection.isempty.php                          30-Sep-2022 11:01                4234
ds-collection.toarray.php                          30-Sep-2022 11:01                4004
ds-deque.allocate.php                              30-Sep-2022 11:01                4595
ds-deque.apply.php                                 30-Sep-2022 11:01                5079
ds-deque.capacity.php                              30-Sep-2022 11:01                3906
ds-deque.clear.php                                 30-Sep-2022 11:01                3824
ds-deque.construct.php                             30-Sep-2022 11:01                4360
ds-deque.contains.php                              30-Sep-2022 11:01                7514
ds-deque.copy.php                                  30-Sep-2022 11:01                4218
ds-deque.count.php                                 30-Sep-2022 11:01                1529
ds-deque.filter.php                                30-Sep-2022 11:01                7522
ds-deque.find.php                                  30-Sep-2022 11:01                5480
ds-deque.first.php                                 30-Sep-2022 11:01                3819
ds-deque.get.php                                   30-Sep-2022 11:01                6684
ds-deque.insert.php                                30-Sep-2022 11:01                7016
ds-deque.isempty.php                               30-Sep-2022 11:01                4081
ds-deque.join.php                                  30-Sep-2022 11:01                5761
ds-deque.jsonserialize.php                         30-Sep-2022 11:01                1809
ds-deque.last.php                                  30-Sep-2022 11:01                3807
ds-deque.map.php                                   30-Sep-2022 11:01                5460
ds-deque.merge.php                                 30-Sep-2022 11:01                4891
ds-deque.pop.php                                   30-Sep-2022 11:01                4304
ds-deque.push.php                                  30-Sep-2022 11:01                4712
ds-deque.reduce.php                                30-Sep-2022 11:01                8689
ds-deque.remove.php                                30-Sep-2022 11:01                4879
ds-deque.reverse.php                               30-Sep-2022 11:01                3660
ds-deque.reversed.php                              30-Sep-2022 11:01                4033
ds-deque.rotate.php                                30-Sep-2022 11:01                5089
ds-deque.set.php                                   30-Sep-2022 11:01                6148
ds-deque.shift.php                                 30-Sep-2022 11:01                4405
ds-deque.slice.php                                 30-Sep-2022 11:01                7240
ds-deque.sort.php                                  30-Sep-2022 11:01                7463
ds-deque.sorted.php                                30-Sep-2022 11:01                7522
ds-deque.sum.php                                   30-Sep-2022 11:01                5132
ds-deque.toarray.php                               30-Sep-2022 11:01                3855
ds-deque.unshift.php                               30-Sep-2022 11:01                4792
ds-hashable.equals.php                             30-Sep-2022 11:01                3388
ds-hashable.hash.php                               30-Sep-2022 11:01                8529
ds-map.allocate.php                                30-Sep-2022 11:01                4461
ds-map.apply.php                                   30-Sep-2022 11:01                5851
ds-map.capacity.php                                30-Sep-2022 11:01                3191
ds-map.clear.php                                   30-Sep-2022 11:01                4380
ds-map.construct.php                               30-Sep-2022 11:01                4892
ds-map.copy.php                                    30-Sep-2022 11:01                4148
ds-map.count.php                                   30-Sep-2022 11:01                1490
ds-map.diff.php                                    30-Sep-2022 11:01                5646
ds-map.filter.php                                  30-Sep-2022 11:01                8387
ds-map.first.php                                   30-Sep-2022 11:01                4107
ds-map.get.php                                     30-Sep-2022 11:01                8696
ds-map.haskey.php                                  30-Sep-2022 11:01                4640
ds-map.hasvalue.php                                30-Sep-2022 11:01                4684
ds-map.intersect.php                               30-Sep-2022 11:01                6167
ds-map.isempty.php                                 30-Sep-2022 11:01                4333
ds-map.jsonserialize.php                           30-Sep-2022 11:01                1787
ds-map.keys.php                                    30-Sep-2022 11:01                3985
ds-map.ksort.php                                   30-Sep-2022 11:01                8195
ds-map.ksorted.php                                 30-Sep-2022 11:01                8316
ds-map.last.php                                    30-Sep-2022 11:01                4092
ds-map.map.php                                     30-Sep-2022 11:01                6500
ds-map.merge.php                                   30-Sep-2022 11:01                5800
ds-map.pairs.php                                   30-Sep-2022 11:01                4376
ds-map.put.php                                     30-Sep-2022 11:01               14865
ds-map.putall.php                                  30-Sep-2022 11:01                5443
ds-map.reduce.php                                  30-Sep-2022 11:01                9739
ds-map.remove.php                                  30-Sep-2022 11:01                7121
ds-map.reverse.php                                 30-Sep-2022 11:01                4142
ds-map.reversed.php                                30-Sep-2022 11:01                4273
ds-map.skip.php                                    30-Sep-2022 11:01                4603
ds-map.slice.php                                   30-Sep-2022 11:01                8141
ds-map.sort.php                                    30-Sep-2022 11:01                8113
ds-map.sorted.php                                  30-Sep-2022 11:01                8295
ds-map.sum.php                                     30-Sep-2022 11:01                5659
ds-map.toarray.php                                 30-Sep-2022 11:01                4816
ds-map.union.php                                   30-Sep-2022 11:01                6151
ds-map.values.php                                  30-Sep-2022 11:01                3979
ds-map.xor.php                                     30-Sep-2022 11:01                5708
ds-pair.clear.php                                  30-Sep-2022 11:01                3720
ds-pair.construct.php                              30-Sep-2022 11:01                2630
ds-pair.copy.php                                   30-Sep-2022 11:01                4137
ds-pair.isempty.php                                30-Sep-2022 11:01                4026
ds-pair.jsonserialize.php                          30-Sep-2022 11:01                1807
ds-pair.toarray.php                                30-Sep-2022 11:01                3780
ds-priorityqueue.allocate.php                      30-Sep-2022 11:01                4761
ds-priorityqueue.capacity.php                      30-Sep-2022 11:01                3400
ds-priorityqueue.clear.php                         30-Sep-2022 11:01                4491
ds-priorityqueue.construct.php                     30-Sep-2022 11:01                2941
ds-priorityqueue.copy.php                          30-Sep-2022 11:01                4521
ds-priorityqueue.count.php                         30-Sep-2022 11:01                1638
ds-priorityqueue.isempty.php                       30-Sep-2022 11:01                5001
ds-priorityqueue.jsonserialize.php                 30-Sep-2022 11:01                1927
ds-priorityqueue.peek.php                          30-Sep-2022 11:01                4807
ds-priorityqueue.pop.php                           30-Sep-2022 11:01                5577
ds-priorityqueue.push.php                          30-Sep-2022 11:01                5594
ds-priorityqueue.toarray.php                       30-Sep-2022 11:01                4964
ds-queue.allocate.php                              30-Sep-2022 11:01                4788
ds-queue.capacity.php                              30-Sep-2022 11:01                3912
ds-queue.clear.php                                 30-Sep-2022 11:01                3809
ds-queue.construct.php                             30-Sep-2022 11:01                4358
ds-queue.copy.php                                  30-Sep-2022 11:01                4355
ds-queue.count.php                                 30-Sep-2022 11:01                1526
ds-queue.isempty.php                               30-Sep-2022 11:01                4097
ds-queue.jsonserialize.php                         30-Sep-2022 11:01                1815
ds-queue.peek.php                                  30-Sep-2022 11:01                4391
ds-queue.pop.php                                   30-Sep-2022 11:01                4925
ds-queue.push.php                                  30-Sep-2022 11:01                4747
ds-queue.toarray.php                               30-Sep-2022 11:01                4015
ds-sequence.allocate.php                           30-Sep-2022 11:01                4499
ds-sequence.apply.php                              30-Sep-2022 11:01                5194
ds-sequence.capacity.php                           30-Sep-2022 11:01                4471
ds-sequence.contains.php                           30-Sep-2022 11:01                7641
ds-sequence.filter.php                             30-Sep-2022 11:01                7661
ds-sequence.find.php                               30-Sep-2022 11:01                5592
ds-sequence.first.php                              30-Sep-2022 11:01                3934
ds-sequence.get.php                                30-Sep-2022 11:01                6812
ds-sequence.insert.php                             30-Sep-2022 11:01                7135
ds-sequence.join.php                               30-Sep-2022 11:01                5857
ds-sequence.last.php                               30-Sep-2022 11:01                3901
ds-sequence.map.php                                30-Sep-2022 11:01                5589
ds-sequence.merge.php                              30-Sep-2022 11:01                5017
ds-sequence.pop.php                                30-Sep-2022 11:01                4416
ds-sequence.push.php                               30-Sep-2022 11:01                4834
ds-sequence.reduce.php                             30-Sep-2022 11:01                8808
ds-sequence.remove.php                             30-Sep-2022 11:01                4991
ds-sequence.reverse.php                            30-Sep-2022 11:01                3773
ds-sequence.reversed.php                           30-Sep-2022 11:01                4156
ds-sequence.rotate.php                             30-Sep-2022 11:01                5226
ds-sequence.set.php                                30-Sep-2022 11:01                6272
ds-sequence.shift.php                              30-Sep-2022 11:01                4517
ds-sequence.slice.php                              30-Sep-2022 11:01                7405
ds-sequence.sort.php                               30-Sep-2022 11:01                7590
ds-sequence.sorted.php                             30-Sep-2022 11:01                7649
ds-sequence.sum.php                                30-Sep-2022 11:01                5257
ds-sequence.unshift.php                            30-Sep-2022 11:01                4903
ds-set.add.php                                     30-Sep-2022 11:01               13049
ds-set.allocate.php                                30-Sep-2022 11:01                4474
ds-set.capacity.php                                30-Sep-2022 11:01                3865
ds-set.clear.php                                   30-Sep-2022 11:01                3755
ds-set.construct.php                               30-Sep-2022 11:01                4312
ds-set.contains.php                                30-Sep-2022 11:01                7469
ds-set.copy.php                                    30-Sep-2022 11:01                4294
ds-set.count.php                                   30-Sep-2022 11:01                1490
ds-set.diff.php                                    30-Sep-2022 11:01                4876
ds-set.filter.php                                  30-Sep-2022 11:01                7470
ds-set.first.php                                   30-Sep-2022 11:01                3772
ds-set.get.php                                     30-Sep-2022 11:01                6628
ds-set.intersect.php                               30-Sep-2022 11:01                5107
ds-set.isempty.php                                 30-Sep-2022 11:01                4039
ds-set.join.php                                    30-Sep-2022 11:01                5707
ds-set.jsonserialize.php                           30-Sep-2022 11:01                1781
ds-set.last.php                                    30-Sep-2022 11:01                3773
ds-set.merge.php                                   30-Sep-2022 11:01                4817
ds-set.reduce.php                                  30-Sep-2022 11:01                8635
ds-set.remove.php                                  30-Sep-2022 11:01                5223
ds-set.reverse.php                                 30-Sep-2022 11:01                3608
ds-set.reversed.php                                30-Sep-2022 11:01                3971
ds-set.slice.php                                   30-Sep-2022 11:01                7154
ds-set.sort.php                                    30-Sep-2022 11:01                7399
ds-set.sorted.php                                  30-Sep-2022 11:01                7458
ds-set.sum.php                                     30-Sep-2022 11:01                5072
ds-set.toarray.php                                 30-Sep-2022 11:01                3801
ds-set.union.php                                   30-Sep-2022 11:01                5070
ds-set.xor.php                                     30-Sep-2022 11:01                5042
ds-stack.allocate.php                              30-Sep-2022 11:01                2708
ds-stack.capacity.php                              30-Sep-2022 11:01                2067
ds-stack.clear.php                                 30-Sep-2022 11:01                3805
ds-stack.construct.php                             30-Sep-2022 11:01                4324
ds-stack.copy.php                                  30-Sep-2022 11:01                4355
ds-stack.count.php                                 30-Sep-2022 11:01                1526
ds-stack.isempty.php                               30-Sep-2022 11:01                4097
ds-stack.jsonserialize.php                         30-Sep-2022 11:01                1815
ds-stack.peek.php                                  30-Sep-2022 11:01                4385
ds-stack.pop.php                                   30-Sep-2022 11:01                4919
ds-stack.push.php                                  30-Sep-2022 11:01                4747
ds-stack.toarray.php                               30-Sep-2022 11:01                3842
ds-vector.allocate.php                             30-Sep-2022 11:01                4416
ds-vector.apply.php                                30-Sep-2022 11:01                5105
ds-vector.capacity.php                             30-Sep-2022 11:01                4376
ds-vector.clear.php                                30-Sep-2022 11:01                3836
ds-vector.construct.php                            30-Sep-2022 11:01                4392
ds-vector.contains.php                             30-Sep-2022 11:01                7544
ds-vector.copy.php                                 30-Sep-2022 11:01                4379
ds-vector.count.php                                30-Sep-2022 11:01                1543
ds-vector.filter.php                               30-Sep-2022 11:01                7556
ds-vector.find.php                                 30-Sep-2022 11:01                5505
ds-vector.first.php                                30-Sep-2022 11:01                3845
ds-vector.get.php                                  30-Sep-2022 11:01                6715
ds-vector.insert.php                               30-Sep-2022 11:01                7046
ds-vector.isempty.php                              30-Sep-2022 11:01                4105
ds-vector.join.php                                 30-Sep-2022 11:01                5788
ds-vector.jsonserialize.php                        30-Sep-2022 11:01                1823
ds-vector.last.php                                 30-Sep-2022 11:01                3832
ds-vector.map.php                                  30-Sep-2022 11:01                5492
ds-vector.merge.php                                30-Sep-2022 11:01                4922
ds-vector.pop.php                                  30-Sep-2022 11:01                4329
ds-vector.push.php                                 30-Sep-2022 11:01                4741
ds-vector.reduce.php                               30-Sep-2022 11:01                8717
ds-vector.remove.php                               30-Sep-2022 11:01                4904
ds-vector.reverse.php                              30-Sep-2022 11:01                3686
ds-vector.reversed.php                             30-Sep-2022 11:01                4063
ds-vector.rotate.php                               30-Sep-2022 11:01                5123
ds-vector.set.php                                  30-Sep-2022 11:01                6179
ds-vector.shift.php                                30-Sep-2022 11:01                4430
ds-vector.slice.php                                30-Sep-2022 11:01                7286
ds-vector.sort.php                                 30-Sep-2022 11:01                7495
ds-vector.sorted.php                               30-Sep-2022 11:01                7554
ds-vector.sum.php                                  30-Sep-2022 11:01                5162
ds-vector.toarray.php                              30-Sep-2022 11:01                3880
ds-vector.unshift.php                              30-Sep-2022 11:01                4822
ds.constants.php                                   30-Sep-2022 11:01                1095
ds.examples.php                                    30-Sep-2022 11:01                4887
ds.installation.php                                30-Sep-2022 11:01                2461
ds.requirements.php                                30-Sep-2022 11:01                1154
ds.setup.php                                       30-Sep-2022 11:01                1369
eio.configuration.php                              30-Sep-2022 11:00                1190
eio.constants.php                                  30-Sep-2022 11:00               16055
eio.examples.php                                   30-Sep-2022 11:00               29459
eio.installation.php                               30-Sep-2022 11:00                1667
eio.requirements.php                               30-Sep-2022 11:00                1274
eio.resources.php                                  30-Sep-2022 11:00                1182
eio.setup.php                                      30-Sep-2022 11:00                1521
emptyiterator.current.php                          30-Sep-2022 11:01                2646
emptyiterator.key.php                              30-Sep-2022 11:01                2610
emptyiterator.next.php                             30-Sep-2022 11:01                2309
emptyiterator.rewind.php                           30-Sep-2022 11:01                2331
emptyiterator.valid.php                            30-Sep-2022 11:01                2315
enchant.configuration.php                          30-Sep-2022 11:00                1220
enchant.constants.php                              30-Sep-2022 11:00                2523
enchant.examples.php                               30-Sep-2022 11:00                5844
enchant.installation.php                           30-Sep-2022 11:00                3172
enchant.requirements.php                           30-Sep-2022 11:00                1757
enchant.resources.php                              30-Sep-2022 11:00                1289
enchant.setup.php                                  30-Sep-2022 11:00                1566
error.clone.php                                    30-Sep-2022 11:00                2737
error.construct.php                                30-Sep-2022 11:00                3209
error.getcode.php                                  30-Sep-2022 11:00                3969
error.getfile.php                                  30-Sep-2022 11:00                3713
error.getline.php                                  30-Sep-2022 11:00                3976
error.getmessage.php                               30-Sep-2022 11:00                3798
error.getprevious.php                              30-Sep-2022 11:00                6858
error.gettrace.php                                 30-Sep-2022 11:00                4182
error.gettraceasstring.php                         30-Sep-2022 11:00                4071
error.tostring.php                                 30-Sep-2022 11:00                3842
errorexception.construct.php                       30-Sep-2022 11:00                5391
errorexception.getseverity.php                     30-Sep-2022 11:00                4345
errorfunc.configuration.php                        30-Sep-2022 11:00               22424
errorfunc.constants.php                            30-Sep-2022 11:00                9347
errorfunc.examples.php                             30-Sep-2022 11:00               23913
errorfunc.installation.php                         30-Sep-2022 11:00                1217
errorfunc.requirements.php                         30-Sep-2022 11:00                1181
errorfunc.resources.php                            30-Sep-2022 11:00                1179
errorfunc.setup.php                                30-Sep-2022 11:00                1581
ev.backend.php                                     30-Sep-2022 11:00                3385
ev.configuration.php                               30-Sep-2022 11:00                1185
ev.depth.php                                       30-Sep-2022 11:00                3163
ev.embeddablebackends.php                          30-Sep-2022 11:00                6922
ev.examples.php                                    30-Sep-2022 11:00               47772
ev.feedsignal.php                                  30-Sep-2022 11:00                3264
ev.feedsignalevent.php                             30-Sep-2022 11:00                3051
ev.global.constants.php                            30-Sep-2022 11:00                1249
ev.installation.php                                30-Sep-2022 11:00                1653
ev.iteration.php                                   30-Sep-2022 11:00                2537
ev.now.php                                         30-Sep-2022 11:00                3008
ev.nowupdate.php                                   30-Sep-2022 11:00                3135
ev.periodic-modes.php                              30-Sep-2022 11:00                7866
ev.recommendedbackends.php                         30-Sep-2022 11:00                7664
ev.requirements.php                                30-Sep-2022 11:00                1209
ev.resources.php                                   30-Sep-2022 11:00                1137
ev.resume.php                                      30-Sep-2022 11:00                3725
ev.run.php                                         30-Sep-2022 11:00                4758
ev.setup.php                                       30-Sep-2022 11:00                1476
ev.sleep.php                                       30-Sep-2022 11:00                2312
ev.stop.php                                        30-Sep-2022 11:00                2780
ev.supportedbackends.php                           30-Sep-2022 11:00                6904
ev.suspend.php                                     30-Sep-2022 11:00                3458
ev.time.php                                        30-Sep-2022 11:00                2582
ev.verify.php                                      30-Sep-2022 11:00                2204
ev.watcher-callbacks.php                           30-Sep-2022 11:00                4117
ev.watchers.php                                    30-Sep-2022 11:00                3458
evcheck.construct.php                              30-Sep-2022 11:00                3634
evcheck.createstopped.php                          30-Sep-2022 11:00                3502
evchild.construct.php                              30-Sep-2022 11:00                6418
evchild.createstopped.php                          30-Sep-2022 11:00                4942
evchild.set.php                                    30-Sep-2022 11:00                3045
evembed.construct.php                              30-Sep-2022 11:00                8473
evembed.createstopped.php                          30-Sep-2022 11:00                4672
evembed.set.php                                    30-Sep-2022 11:00                2434
evembed.sweep.php                                  30-Sep-2022 11:00                3006
event.add.php                                      30-Sep-2022 11:01               11055
event.addsignal.php                                30-Sep-2022 11:01                1630
event.addtimer.php                                 30-Sep-2022 11:01                1639
event.callbacks.php                                30-Sep-2022 11:01                5402
event.configuration.php                            30-Sep-2022 11:01                1206
event.construct.php                                30-Sep-2022 11:01                4740
event.constructing.signal.events.php               30-Sep-2022 11:01                6853
event.del.php                                      30-Sep-2022 11:01                2425
event.delsignal.php                                30-Sep-2022 11:01                1630
event.deltimer.php                                 30-Sep-2022 11:01                1627
event.examples.php                                 30-Sep-2022 11:01              198943
event.flags.php                                    30-Sep-2022 11:01                2319
event.free.php                                     30-Sep-2022 11:01                2911
event.getsupportedmethods.php                      30-Sep-2022 11:01                2579
event.installation.php                             30-Sep-2022 11:01                1680
event.pending.php                                  30-Sep-2022 11:01                2655
event.persistence.php                              30-Sep-2022 11:01                2752
event.requirements.php                             30-Sep-2022 11:01                1427
event.resources.php                                30-Sep-2022 11:01                1138
event.set.php                                      30-Sep-2022 11:01                4476
event.setpriority.php                              30-Sep-2022 11:01                2344
event.settimer.php                                 30-Sep-2022 11:01                3990
event.setup.php                                    30-Sep-2022 11:01                1515
event.signal.php                                   30-Sep-2022 11:01                4230
event.timer.php                                    30-Sep-2022 11:01                3563
eventbase.construct.php                            30-Sep-2022 11:01                2789
eventbase.dispatch.php                             30-Sep-2022 11:01                3170
eventbase.exit.php                                 30-Sep-2022 11:01                2854
eventbase.free.php                                 30-Sep-2022 11:01                3266
eventbase.getfeatures.php                          30-Sep-2022 11:01                5971
eventbase.getmethod.php                            30-Sep-2022 11:01                4590
eventbase.gettimeofdaycached.php                   30-Sep-2022 11:01                2622
eventbase.gotexit.php                              30-Sep-2022 11:01                3196
eventbase.gotstop.php                              30-Sep-2022 11:01                3168
eventbase.loop.php                                 30-Sep-2022 11:01                3414
eventbase.priorityinit.php                         30-Sep-2022 11:01                2831
eventbase.reinit.php                               30-Sep-2022 11:01                2198
eventbase.stop.php                                 30-Sep-2022 11:01                2693
eventbuffer.add.php                                30-Sep-2022 11:01                2830
eventbuffer.addbuffer.php                          30-Sep-2022 11:01                3242
eventbuffer.appendfrom.php                         30-Sep-2022 11:01                4858
eventbuffer.construct.php                          30-Sep-2022 11:01                2127
eventbuffer.copyout.php                            30-Sep-2022 11:01                3804
eventbuffer.drain.php                              30-Sep-2022 11:01                3322
eventbuffer.enablelocking.php                      30-Sep-2022 11:01                2844
eventbuffer.expand.php                             30-Sep-2022 11:01                2617
eventbuffer.freeze.php                             30-Sep-2022 11:01                2879
eventbuffer.lock.php                               30-Sep-2022 11:01                2986
eventbuffer.prepend.php                            30-Sep-2022 11:01                3335
eventbuffer.prependbuffer.php                      30-Sep-2022 11:01                3557
eventbuffer.pullup.php                             30-Sep-2022 11:01                4560
eventbuffer.read.php                               30-Sep-2022 11:01                4825
eventbuffer.readfrom.php                           30-Sep-2022 11:01                4311
eventbuffer.readline.php                           30-Sep-2022 11:01                4135
eventbuffer.search.php                             30-Sep-2022 11:01                8616
eventbuffer.searcheol.php                          30-Sep-2022 11:01                4555
eventbuffer.substr.php                             30-Sep-2022 11:01                3297
eventbuffer.unfreeze.php                           30-Sep-2022 11:01                2893
eventbuffer.unlock.php                             30-Sep-2022 11:01                2653
eventbuffer.write.php                              30-Sep-2022 11:01                3364
eventbufferevent.about.callbacks.php               30-Sep-2022 11:01                5612
eventbufferevent.close.php                         30-Sep-2022 11:01                2436
eventbufferevent.connect.php                       30-Sep-2022 11:01               26996
eventbufferevent.connecthost.php                   30-Sep-2022 11:01               18467
eventbufferevent.construct.php                     30-Sep-2022 11:01                6884
eventbufferevent.createpair.php                    30-Sep-2022 11:01                4029
eventbufferevent.disable.php                       30-Sep-2022 11:01                3129
eventbufferevent.enable.php                        30-Sep-2022 11:01                3393
eventbufferevent.free.php                          30-Sep-2022 11:01                2743
eventbufferevent.getdnserrorstring.php             30-Sep-2022 11:01                3047
eventbufferevent.getenabled.php                    30-Sep-2022 11:01                3013
eventbufferevent.getinput.php                      30-Sep-2022 11:01                5183
eventbufferevent.getoutput.php                     30-Sep-2022 11:01                8339
eventbufferevent.read.php                          30-Sep-2022 11:01                2965
eventbufferevent.readbuffer.php                    30-Sep-2022 11:01                3079
eventbufferevent.setcallbacks.php                  30-Sep-2022 11:01                4598
eventbufferevent.setpriority.php                   30-Sep-2022 11:01                2727
eventbufferevent.settimeouts.php                   30-Sep-2022 11:01                2897
eventbufferevent.setwatermark.php                  30-Sep-2022 11:01                3815
eventbufferevent.sslerror.php                      30-Sep-2022 11:01                6323
eventbufferevent.sslfilter.php                     30-Sep-2022 11:01               41019
eventbufferevent.sslgetcipherinfo.php              30-Sep-2022 11:01                2812
eventbufferevent.sslgetciphername.php              30-Sep-2022 11:01                2698
eventbufferevent.sslgetcipherversion.php           30-Sep-2022 11:01                2727
eventbufferevent.sslgetprotocol.php                30-Sep-2022 11:01                2656
eventbufferevent.sslrenegotiate.php                30-Sep-2022 11:01                2779
eventbufferevent.sslsocket.php                     30-Sep-2022 11:01                5503
eventbufferevent.write.php                         30-Sep-2022 11:01                3015
eventbufferevent.writebuffer.php                   30-Sep-2022 11:01                3197
eventconfig.avoidmethod.php                        30-Sep-2022 11:01                4252
eventconfig.construct.php                          30-Sep-2022 11:01                4503
eventconfig.requirefeatures.php                    30-Sep-2022 11:01                6051
eventconfig.setflags.php                           30-Sep-2022 11:01                3134
eventconfig.setmaxdispatchinterval.php             30-Sep-2022 11:01                4249
eventdnsbase.addnameserverip.php                   30-Sep-2022 11:01                2751
eventdnsbase.addsearch.php                         30-Sep-2022 11:01                2464
eventdnsbase.clearsearch.php                       30-Sep-2022 11:01                2775
eventdnsbase.construct.php                         30-Sep-2022 11:01                3218
eventdnsbase.countnameservers.php                  30-Sep-2022 11:01                2465
eventdnsbase.loadhosts.php                         30-Sep-2022 11:01                2624
eventdnsbase.parseresolvconf.php                   30-Sep-2022 11:01                4042
eventdnsbase.setoption.php                         30-Sep-2022 11:01                3142
eventdnsbase.setsearchndots.php                    30-Sep-2022 11:01                2688
eventhttp.accept.php                               30-Sep-2022 11:01               13234
eventhttp.addserveralias.php                       30-Sep-2022 11:01                6449
eventhttp.bind.php                                 30-Sep-2022 11:01                7836
eventhttp.construct.php                            30-Sep-2022 11:01               19926
eventhttp.removeserveralias.php                    30-Sep-2022 11:01                3025
eventhttp.setallowedmethods.php                    30-Sep-2022 11:01                3305
eventhttp.setcallback.php                          30-Sep-2022 11:01               19742
eventhttp.setdefaultcallback.php                   30-Sep-2022 11:01                7815
eventhttp.setmaxbodysize.php                       30-Sep-2022 11:01                2831
eventhttp.setmaxheaderssize.php                    30-Sep-2022 11:01                2743
eventhttp.settimeout.php                           30-Sep-2022 11:01                2419
eventhttpconnection.construct.php                  30-Sep-2022 11:01                5205
eventhttpconnection.getbase.php                    30-Sep-2022 11:01                2546
eventhttpconnection.getpeer.php                    30-Sep-2022 11:01                2879
eventhttpconnection.makerequest.php                30-Sep-2022 11:01               12538
eventhttpconnection.setclosecallback.php           30-Sep-2022 11:01               11800
eventhttpconnection.setlocaladdress.php            30-Sep-2022 11:01                3128
eventhttpconnection.setlocalport.php               30-Sep-2022 11:01                3021
eventhttpconnection.setmaxbodysize.php             30-Sep-2022 11:01                3053
eventhttpconnection.setmaxheaderssize.php          30-Sep-2022 11:01                3074
eventhttpconnection.setretries.php                 30-Sep-2022 11:01                2649
eventhttpconnection.settimeout.php                 30-Sep-2022 11:01                2546
eventhttprequest.addheader.php                     30-Sep-2022 11:01                3637
eventhttprequest.cancel.php                        30-Sep-2022 11:01                2797
eventhttprequest.clearheaders.php                  30-Sep-2022 11:01                2760
eventhttprequest.closeconnection.php               30-Sep-2022 11:01                2352
eventhttprequest.construct.php                     30-Sep-2022 11:01               12706
eventhttprequest.findheader.php                    30-Sep-2022 11:01                3354
eventhttprequest.free.php                          30-Sep-2022 11:01                2260
eventhttprequest.getbufferevent.php                30-Sep-2022 11:01                3669
eventhttprequest.getcommand.php                    30-Sep-2022 11:01                2637
eventhttprequest.getconnection.php                 30-Sep-2022 11:01                4438
eventhttprequest.gethost.php                       30-Sep-2022 11:01                2805
eventhttprequest.getinputbuffer.php                30-Sep-2022 11:01                2752
eventhttprequest.getinputheaders.php               30-Sep-2022 11:01                2785
eventhttprequest.getoutputbuffer.php               30-Sep-2022 11:01                2811
eventhttprequest.getoutputheaders.php              30-Sep-2022 11:01                2769
eventhttprequest.getresponsecode.php               30-Sep-2022 11:01                3102
eventhttprequest.geturi.php                        30-Sep-2022 11:01                3013
eventhttprequest.removeheader.php                  30-Sep-2022 11:01                3365
eventhttprequest.senderror.php                     30-Sep-2022 11:01                5685
eventhttprequest.sendreply.php                     30-Sep-2022 11:01                3929
eventhttprequest.sendreplychunk.php                30-Sep-2022 11:01                3411
eventhttprequest.sendreplyend.php                  30-Sep-2022 11:01                3008
eventhttprequest.sendreplystart.php                30-Sep-2022 11:01                4184
eventlistener.construct.php                        30-Sep-2022 11:01               27649
eventlistener.disable.php                          30-Sep-2022 11:01                2629
eventlistener.enable.php                           30-Sep-2022 11:01                2615
eventlistener.getbase.php                          30-Sep-2022 11:01                2276
eventlistener.getsocketname.php                    30-Sep-2022 11:01                3164
eventlistener.setcallback.php                      30-Sep-2022 11:01                5706
eventlistener.seterrorcallback.php                 30-Sep-2022 11:01                4233
eventsslcontext.construct.php                      30-Sep-2022 11:01                5816
eventutil.construct.php                            30-Sep-2022 11:01                2313
eventutil.getlastsocketerrno.php                   30-Sep-2022 11:01                3227
eventutil.getlastsocketerror.php                   30-Sep-2022 11:01                3092
eventutil.getsocketfd.php                          30-Sep-2022 11:01                3133
eventutil.getsocketname.php                        30-Sep-2022 11:01                3612
eventutil.setsocketoption.php                      30-Sep-2022 11:01                5451
eventutil.sslrandpoll.php                          30-Sep-2022 11:01                2302
evfork.construct.php                               30-Sep-2022 11:00                3609
evfork.createstopped.php                           30-Sep-2022 11:00                3704
evidle.construct.php                               30-Sep-2022 11:00                3664
evidle.createstopped.php                           30-Sep-2022 11:00                4020
evio.construct.php                                 30-Sep-2022 11:00                4712
evio.createstopped.php                             30-Sep-2022 11:00                5086
evio.set.php                                       30-Sep-2022 11:00                2776
evloop.backend.php                                 30-Sep-2022 11:00                2638
evloop.check.php                                   30-Sep-2022 11:00                3106
evloop.child.php                                   30-Sep-2022 11:00                3468
evloop.construct.php                               30-Sep-2022 11:00                3904
evloop.defaultloop.php                             30-Sep-2022 11:00                4499
evloop.embed.php                                   30-Sep-2022 11:00                3571
evloop.fork.php                                    30-Sep-2022 11:00                3300
evloop.idle.php                                    30-Sep-2022 11:00                3320
evloop.invokepending.php                           30-Sep-2022 11:00                2167
evloop.io.php                                      30-Sep-2022 11:00                3739
evloop.loopfork.php                                30-Sep-2022 11:00                2467
evloop.now.php                                     30-Sep-2022 11:00                2752
evloop.nowupdate.php                               30-Sep-2022 11:00                3112
evloop.periodic.php                                30-Sep-2022 11:00                3778
evloop.prepare.php                                 30-Sep-2022 11:00                3318
evloop.resume.php                                  30-Sep-2022 11:00                2772
evloop.run.php                                     30-Sep-2022 11:00                4724
evloop.signal.php                                  30-Sep-2022 11:00                3565
evloop.stat.php                                    30-Sep-2022 11:00                3686
evloop.stop.php                                    30-Sep-2022 11:00                2907
evloop.suspend.php                                 30-Sep-2022 11:00                2764
evloop.timer.php                                   30-Sep-2022 11:00                3705
evloop.verify.php                                  30-Sep-2022 11:00                2539
evperiodic.again.php                               30-Sep-2022 11:00                2512
evperiodic.at.php                                  30-Sep-2022 11:00                2544
evperiodic.construct.php                           30-Sep-2022 11:00               10159
evperiodic.createstopped.php                       30-Sep-2022 11:00                5642
evperiodic.set.php                                 30-Sep-2022 11:00                3034
evprepare.construct.php                            30-Sep-2022 11:00                3389
evprepare.createstopped.php                        30-Sep-2022 11:00                4252
evsignal.construct.php                             30-Sep-2022 11:00                5481
evsignal.createstopped.php                         30-Sep-2022 11:00                4740
evsignal.set.php                                   30-Sep-2022 11:00                2388
evstat.attr.php                                    30-Sep-2022 11:00                8651
evstat.construct.php                               30-Sep-2022 11:00                7407
evstat.createstopped.php                           30-Sep-2022 11:00                5036
evstat.prev.php                                    30-Sep-2022 11:00                2898
evstat.set.php                                     30-Sep-2022 11:00                2709
evstat.stat.php                                    30-Sep-2022 11:00                2818
evtimer.again.php                                  30-Sep-2022 11:00                3007
evtimer.construct.php                              30-Sep-2022 11:00               13502
evtimer.createstopped.php                          30-Sep-2022 11:00                8496
evtimer.set.php                                    30-Sep-2022 11:00                2851
evwatcher.clear.php                                30-Sep-2022 11:00                2733
evwatcher.construct.php                            30-Sep-2022 11:00                2071
evwatcher.feed.php                                 30-Sep-2022 11:00                2501
evwatcher.getloop.php                              30-Sep-2022 11:00                2275
evwatcher.invoke.php                               30-Sep-2022 11:00                2508
evwatcher.keepalive.php                            30-Sep-2022 11:00                5115
evwatcher.setcallback.php                          30-Sep-2022 11:00                2521
evwatcher.start.php                                30-Sep-2022 11:00                2454
evwatcher.stop.php                                 30-Sep-2022 11:00                2423
example.xml-external-entity.php                    30-Sep-2022 11:01               26022
example.xml-map-tags.php                           30-Sep-2022 11:01                9081
example.xml-structure.php                          30-Sep-2022 11:01                6939
example.xmlwriter-namespace.php                    30-Sep-2022 11:01                5453
example.xmlwriter-oop.php                          30-Sep-2022 11:01                3381
example.xmlwriter-simple.php                       30-Sep-2022 11:01                8903
exception.clone.php                                30-Sep-2022 11:00                2812
exception.construct.php                            30-Sep-2022 11:00                3577
exception.getcode.php                              30-Sep-2022 11:00                4477
exception.getfile.php                              30-Sep-2022 11:00                3838
exception.getline.php                              30-Sep-2022 11:00                4100
exception.getmessage.php                           30-Sep-2022 11:00                3905
exception.getprevious.php                          30-Sep-2022 11:00                7112
exception.gettrace.php                             30-Sep-2022 11:00                4297
exception.gettraceasstring.php                     30-Sep-2022 11:00                4186
exception.tostring.php                             30-Sep-2022 11:00                3999
exec.configuration.php                             30-Sep-2022 11:01                1199
exec.constants.php                                 30-Sep-2022 11:01                1124
exec.installation.php                              30-Sep-2022 11:01                1182
exec.requirements.php                              30-Sep-2022 11:01                1146
exec.resources.php                                 30-Sep-2022 11:01                1289
exec.setup.php                                     30-Sep-2022 11:01                1535
exif.configuration.php                             30-Sep-2022 11:00                6713
exif.constants.php                                 30-Sep-2022 11:00                1870
exif.installation.php                              30-Sep-2022 11:00                1628
exif.requirements.php                              30-Sep-2022 11:00                1728
exif.resources.php                                 30-Sep-2022 11:00                1144
exif.setup.php                                     30-Sep-2022 11:00                1533
expect.configuration.php                           30-Sep-2022 11:00                5029
expect.constants.php                               30-Sep-2022 11:00                3211
expect.examples-usage.php                          30-Sep-2022 11:00               17167
expect.examples.php                                30-Sep-2022 11:00                1353
expect.installation.php                            30-Sep-2022 11:00                2289
expect.requirements.php                            30-Sep-2022 11:00                1280
expect.resources.php                               30-Sep-2022 11:00                1366
expect.setup.php                                   30-Sep-2022 11:00                1559
ext-weakmap.construct.php                          30-Sep-2022 11:00                1838
extensions.alphabetical.php                        30-Sep-2022 11:01               20551
extensions.membership.php                          30-Sep-2022 11:01               20244
extensions.php                                     30-Sep-2022 11:01                1612
extensions.state.php                               30-Sep-2022 11:01                2565
fann.configuration.php                             30-Sep-2022 11:01                1199
fann.constants.php                                 30-Sep-2022 11:01               17625
fann.examples-1.php                                30-Sep-2022 11:01                9049
fann.examples.php                                  30-Sep-2022 11:01                1307
fann.installation.php                              30-Sep-2022 11:01                4999
fann.requirements.php                              30-Sep-2022 11:01                1135
fann.resources.php                                 30-Sep-2022 11:01                1103
fann.setup.php                                     30-Sep-2022 11:01                1506
fannconnection.construct.php                       30-Sep-2022 11:01                2810
fannconnection.getfromneuron.php                   30-Sep-2022 11:01                2270
fannconnection.gettoneuron.php                     30-Sep-2022 11:01                2258
fannconnection.getweight.php                       30-Sep-2022 11:01                2226
fannconnection.setweight.php                       30-Sep-2022 11:01                2820
faq.build.php                                      30-Sep-2022 11:01               22893
faq.com.php                                        30-Sep-2022 11:01               11398
faq.databases.php                                  30-Sep-2022 11:01                7203
faq.general.php                                    30-Sep-2022 11:01                4686
faq.html.php                                       30-Sep-2022 11:01               20245
faq.installation.php                               30-Sep-2022 11:01               24239
faq.mailinglist.php                                30-Sep-2022 11:01               10822
faq.misc.php                                       30-Sep-2022 11:01                4302
faq.obtaining.php                                  30-Sep-2022 11:01               10387
faq.passwords.php                                  30-Sep-2022 11:01                9496
faq.php                                            30-Sep-2022 11:01                1951
faq.using.php                                      30-Sep-2022 11:01               22357
fdf.configuration.php                              30-Sep-2022 11:00                1192
fdf.constants.php                                  30-Sep-2022 11:00                6325
fdf.examples.php                                   30-Sep-2022 11:00                6591
fdf.installation.php                               30-Sep-2022 11:00                3374
fdf.requirements.php                               30-Sep-2022 11:00                1472
fdf.resources.php                                  30-Sep-2022 11:00                1663
fdf.setup.php                                      30-Sep-2022 11:00                1514
features.commandline.differences.php               30-Sep-2022 11:00               11800
features.commandline.ini.php                       30-Sep-2022 11:00                2177
features.commandline.interactive.php               30-Sep-2022 11:00                8734
features.commandline.introduction.php              30-Sep-2022 11:00                6340
features.commandline.io-streams.php                30-Sep-2022 11:00                5854
features.commandline.options.php                   30-Sep-2022 11:00               25433
features.commandline.php                           30-Sep-2022 11:00                1981
features.commandline.usage.php                     30-Sep-2022 11:00               13987
features.commandline.webserver.php                 30-Sep-2022 11:00               12950
features.connection-handling.php                   30-Sep-2022 11:00                5345
features.cookies.php                               30-Sep-2022 11:00                2866
features.dtrace.dtrace.php                         30-Sep-2022 11:00               13923
features.dtrace.introduction.php                   30-Sep-2022 11:00                3313
features.dtrace.php                                30-Sep-2022 11:00                1602
features.dtrace.systemtap.php                      30-Sep-2022 11:00                8005
features.file-upload.common-pitfalls.php           30-Sep-2022 11:00                4820
features.file-upload.errors.php                    30-Sep-2022 11:00                3701
features.file-upload.errors.seealso.php            30-Sep-2022 11:00                1299
features.file-upload.multiple.php                  30-Sep-2022 11:00                6484
features.file-upload.php                           30-Sep-2022 11:00                1815
features.file-upload.post-method.php               30-Sep-2022 11:00               16196
features.file-upload.put-method.php                30-Sep-2022 11:00                5920
features.gc.collecting-cycles.php                  30-Sep-2022 11:00                7918
features.gc.performance-considerations.php         30-Sep-2022 11:00               14100
features.gc.php                                    30-Sep-2022 11:00                1697
features.gc.refcounting-basics.php                 30-Sep-2022 11:00               21315
features.http-auth.php                             30-Sep-2022 11:00               24721
features.persistent-connections.php                30-Sep-2022 11:00                8376
features.php                                       30-Sep-2022 11:00                3935
features.remote-files.php                          30-Sep-2022 11:00                8306
features.session.security.management.php           30-Sep-2022 11:01               23155
features.sessions.php                              30-Sep-2022 11:00                1349
features.xforms.php                                30-Sep-2022 11:00                5248
ffi-ctype.getalignment.php                         30-Sep-2022 11:00                2241
ffi-ctype.getarrayelementtype.php                  30-Sep-2022 11:00                2385
ffi-ctype.getarraylength.php                       30-Sep-2022 11:00                2284
ffi-ctype.getattributes.php                        30-Sep-2022 11:00                2260
ffi-ctype.getenumkind.php                          30-Sep-2022 11:00                2236
ffi-ctype.getfuncabi.php                           30-Sep-2022 11:00                2244
ffi-ctype.getfuncparametercount.php                30-Sep-2022 11:00                2350
ffi-ctype.getfuncparametertype.php                 30-Sep-2022 11:00                2600
ffi-ctype.getfuncreturntype.php                    30-Sep-2022 11:00                2367
ffi-ctype.getkind.php                              30-Sep-2022 11:00                2198
ffi-ctype.getname.php                              30-Sep-2022 11:00                2202
ffi-ctype.getpointertype.php                       30-Sep-2022 11:00                2311
ffi-ctype.getsize.php                              30-Sep-2022 11:00                2216
ffi-ctype.getstructfieldnames.php                  30-Sep-2022 11:00                2326
ffi-ctype.getstructfieldoffset.php                 30-Sep-2022 11:00                2536
ffi-ctype.getstructfieldtype.php                   30-Sep-2022 11:00                2556
ffi.addr.php                                       30-Sep-2022 11:00                2748
ffi.alignof.php                                    30-Sep-2022 11:00                2820
ffi.arraytype.php                                  30-Sep-2022 11:00                4439
ffi.cast.php                                       30-Sep-2022 11:00                4885
ffi.cdef.php                                       30-Sep-2022 11:00                4118
ffi.configuration.php                              30-Sep-2022 11:00                4031
ffi.constants.php                                  30-Sep-2022 11:00                1089
ffi.examples-basic.php                             30-Sep-2022 11:00               17167
ffi.examples-callback.php                          30-Sep-2022 11:00                5041
ffi.examples-complete.php                          30-Sep-2022 11:00                5821
ffi.examples.php                                   30-Sep-2022 11:00                1464
ffi.free.php                                       30-Sep-2022 11:00                2360
ffi.installation.php                               30-Sep-2022 11:00                1380
ffi.isnull.php                                     30-Sep-2022 11:00                2349
ffi.load.php                                       30-Sep-2022 11:00                4139
ffi.memcmp.php                                     30-Sep-2022 11:00                3739
ffi.memcpy.php                                     30-Sep-2022 11:00                3102
ffi.memset.php                                     30-Sep-2022 11:00                2944
ffi.new.php                                        30-Sep-2022 11:00                5270
ffi.requirements.php                               30-Sep-2022 11:00                1231
ffi.resources.php                                  30-Sep-2022 11:00                1137
ffi.scope.php                                      30-Sep-2022 11:00                3051
ffi.setup.php                                      30-Sep-2022 11:00                1504
ffi.sizeof.php                                     30-Sep-2022 11:00                2661
ffi.string.php                                     30-Sep-2022 11:00                3631
ffi.type.php                                       30-Sep-2022 11:00                3513
ffi.typeof.php                                     30-Sep-2022 11:00                2812
fiber.construct.php                                30-Sep-2022 11:00                2318
fiber.getcurrent.php                               30-Sep-2022 11:00                2356
fiber.getreturn.php                                30-Sep-2022 11:00                2577
fiber.isrunning.php                                30-Sep-2022 11:00                2522
fiber.isstarted.php                                30-Sep-2022 11:00                2136
fiber.issuspended.php                              30-Sep-2022 11:00                2151
fiber.isterminated.php                             30-Sep-2022 11:00                2208
fiber.resume.php                                   30-Sep-2022 11:00                3278
fiber.start.php                                    30-Sep-2022 11:00                3006
fiber.suspend.php                                  30-Sep-2022 11:00                4045
fiber.throw.php                                    30-Sep-2022 11:00                3148
fibererror.construct.php                           30-Sep-2022 11:00                2132
fileinfo.configuration.php                         30-Sep-2022 11:00                1227
fileinfo.constants.php                             30-Sep-2022 11:00                4709
fileinfo.installation.php                          30-Sep-2022 11:00                1650
fileinfo.requirements.php                          30-Sep-2022 11:00                1174
fileinfo.resources.php                             30-Sep-2022 11:00                1350
fileinfo.setup.php                                 30-Sep-2022 11:00                1579
filesystem.configuration.php                       30-Sep-2022 11:00                6739
filesystem.constants.php                           30-Sep-2022 11:00                8659
filesystem.installation.php                        30-Sep-2022 11:00                1224
filesystem.requirements.php                        30-Sep-2022 11:00                1188
filesystem.resources.php                           30-Sep-2022 11:00                1338
filesystem.setup.php                               30-Sep-2022 11:00                1605
filesystemiterator.construct.php                   30-Sep-2022 11:01                6939
filesystemiterator.current.php                     30-Sep-2022 11:01                5340
filesystemiterator.getflags.php                    30-Sep-2022 11:01                3122
filesystemiterator.key.php                         30-Sep-2022 11:01                5232
filesystemiterator.next.php                        30-Sep-2022 11:01                4505
filesystemiterator.rewind.php                      30-Sep-2022 11:01                5124
filesystemiterator.setflags.php                    30-Sep-2022 11:01                6684
filter.configuration.php                           30-Sep-2022 11:01                4805
filter.constants.php                               30-Sep-2022 11:01               17843
filter.examples.php                                30-Sep-2022 11:01                1414
filter.examples.sanitization.php                   30-Sep-2022 11:01                6052
filter.examples.validation.php                     30-Sep-2022 11:01               11099
filter.filters.flags.php                           30-Sep-2022 11:01               12170
filter.filters.misc.php                            30-Sep-2022 11:01                1827
filter.filters.php                                 30-Sep-2022 11:01                1566
filter.filters.sanitize.php                        30-Sep-2022 11:01               10299
filter.filters.validate.php                        30-Sep-2022 11:01               10803
filter.installation.php                            30-Sep-2022 11:01                1258
filter.requirements.php                            30-Sep-2022 11:01                1160
filter.resources.php                               30-Sep-2022 11:01                1152
filter.setup.php                                   30-Sep-2022 11:01                1543
filteriterator.accept.php                          30-Sep-2022 11:01                5446
filteriterator.construct.php                       30-Sep-2022 11:01                3048
filteriterator.current.php                         30-Sep-2022 11:01                3007
filteriterator.getinneriterator.php                30-Sep-2022 11:01                2462
filteriterator.key.php                             30-Sep-2022 11:01                2939
filteriterator.next.php                            30-Sep-2022 11:01                2868
filteriterator.rewind.php                          30-Sep-2022 11:01                3061
filteriterator.valid.php                           30-Sep-2022 11:01                2419
filters.compression.php                            30-Sep-2022 11:01               16315
filters.convert.php                                30-Sep-2022 11:01               11975
filters.encryption.php                             30-Sep-2022 11:01               46029
filters.php                                        30-Sep-2022 11:01                3282
filters.string.php                                 30-Sep-2022 11:01               10503
finfo.buffer.php                                   30-Sep-2022 11:00                2436
finfo.construct.php                                30-Sep-2022 11:00                2756
finfo.file.php                                     30-Sep-2022 11:00                2427
finfo.set-flags.php                                30-Sep-2022 11:00                1932
fpm.observability.php                              30-Sep-2022 11:01                1346
fpm.setup.php                                      30-Sep-2022 11:01                1241
fpm.status.php                                     30-Sep-2022 11:01                9923
ftp.configuration.php                              30-Sep-2022 11:01                1192
ftp.constants.php                                  30-Sep-2022 11:01                3975
ftp.examples-basic.php                             30-Sep-2022 11:01                5268
ftp.examples.php                                   30-Sep-2022 11:01                1303
ftp.installation.php                               30-Sep-2022 11:01                1419
ftp.requirements.php                               30-Sep-2022 11:01                1139
ftp.resources.php                                  30-Sep-2022 11:01                1439
ftp.setup.php                                      30-Sep-2022 11:01                1514
funchand.configuration.php                         30-Sep-2022 11:01                1227
funchand.constants.php                             30-Sep-2022 11:01                1152
funchand.installation.php                          30-Sep-2022 11:01                1210
funchand.requirements.php                          30-Sep-2022 11:01                1174
funchand.resources.php                             30-Sep-2022 11:01                1172
funchand.setup.php                                 30-Sep-2022 11:01                1567
funcref.php                                        30-Sep-2022 11:01               13741
function.abs.php                                   30-Sep-2022 11:00                5020
function.acos.php                                  30-Sep-2022 11:00                3335
function.acosh.php                                 30-Sep-2022 11:00                3148
function.addcslashes.php                           30-Sep-2022 11:01                7799
function.addslashes.php                            30-Sep-2022 11:01                6279
function.apache-child-terminate.php                30-Sep-2022 11:01                3314
function.apache-get-modules.php                    30-Sep-2022 11:01                3224
function.apache-get-version.php                    30-Sep-2022 11:01                3740
function.apache-getenv.php                         30-Sep-2022 11:01                4887
function.apache-lookup-uri.php                     30-Sep-2022 11:01                5873
function.apache-note.php                           30-Sep-2022 11:01                6878
function.apache-request-headers.php                30-Sep-2022 11:01                5624
function.apache-response-headers.php               30-Sep-2022 11:01                4186
function.apache-setenv.php                         30-Sep-2022 11:01                5322
function.apcu-add.php                              30-Sep-2022 11:00                8205
function.apcu-cache-info.php                       30-Sep-2022 11:00                6403
function.apcu-cas.php                              30-Sep-2022 11:00                8832
function.apcu-clear-cache.php                      30-Sep-2022 11:00                2463
function.apcu-dec.php                              30-Sep-2022 11:00                7974
function.apcu-delete.php                           30-Sep-2022 11:00                5919
function.apcu-enabled.php                          30-Sep-2022 11:00                2189
function.apcu-entry.php                            30-Sep-2022 11:00                8768
function.apcu-exists.php                           30-Sep-2022 11:00                7002
function.apcu-fetch.php                            30-Sep-2022 11:00                5649
function.apcu-inc.php                              30-Sep-2022 11:00                7958
function.apcu-key-info.php                         30-Sep-2022 11:00                4733
function.apcu-sma-info.php                         30-Sep-2022 11:00                4279
function.apcu-store.php                            30-Sep-2022 11:00                6979
function.array-change-key-case.php                 30-Sep-2022 11:01                5367
function.array-chunk.php                           30-Sep-2022 11:01                7239
function.array-column.php                          30-Sep-2022 11:01               17943
function.array-combine.php                         30-Sep-2022 11:01                6883
function.array-count-values.php                    30-Sep-2022 11:01                5439
function.array-diff-assoc.php                      30-Sep-2022 11:01               10922
function.array-diff-key.php                        30-Sep-2022 11:01               12937
function.array-diff-uassoc.php                     30-Sep-2022 11:01               11665
function.array-diff-ukey.php                       30-Sep-2022 11:01               11984
function.array-diff.php                            30-Sep-2022 11:01               12507
function.array-fill-keys.php                       30-Sep-2022 11:01                5207
function.array-fill.php                            30-Sep-2022 11:01                8821
function.array-filter.php                          30-Sep-2022 11:01               16783
function.array-flip.php                            30-Sep-2022 11:01                7005
function.array-intersect-assoc.php                 30-Sep-2022 11:01                8787
function.array-intersect-key.php                   30-Sep-2022 11:01               10184
function.array-intersect-uassoc.php                30-Sep-2022 11:01                8430
function.array-intersect-ukey.php                  30-Sep-2022 11:01               11725
function.array-intersect.php                       30-Sep-2022 11:01                6846
function.array-is-list.php                         30-Sep-2022 11:01                6996
function.array-key-exists.php                      30-Sep-2022 11:01                8418
function.array-key-first.php                       30-Sep-2022 11:01                7155
function.array-key-last.php                        30-Sep-2022 11:01                3073
function.array-keys.php                            30-Sep-2022 11:01                8318
function.array-map.php                             30-Sep-2022 11:01               28043
function.array-merge-recursive.php                 30-Sep-2022 11:01                6821
function.array-merge.php                           30-Sep-2022 11:01               12637
function.array-multisort.php                       30-Sep-2022 11:01               23262
function.array-pad.php                             30-Sep-2022 11:01                6997
function.array-pop.php                             30-Sep-2022 11:01                5616
function.array-product.php                         30-Sep-2022 11:01                4261
function.array-push.php                            30-Sep-2022 11:01                7010
function.array-rand.php                            30-Sep-2022 11:01                6537
function.array-reduce.php                          30-Sep-2022 11:01               10280
function.array-replace-recursive.php               30-Sep-2022 11:01               11254
function.array-replace.php                         30-Sep-2022 11:01                6719
function.array-reverse.php                         30-Sep-2022 11:01                5916
function.array-search.php                          30-Sep-2022 11:01                8128
function.array-shift.php                           30-Sep-2022 11:01                5663
function.array-slice.php                           30-Sep-2022 11:01               13786
function.array-splice.php                          30-Sep-2022 11:01               17789
function.array-sum.php                             30-Sep-2022 11:01                4967
function.array-udiff-assoc.php                     30-Sep-2022 11:01               14506
function.array-udiff-uassoc.php                    30-Sep-2022 11:01               16150
function.array-udiff.php                           30-Sep-2022 11:01               29257
function.array-uintersect-assoc.php                30-Sep-2022 11:01                7953
function.array-uintersect-uassoc.php               30-Sep-2022 11:01                8310
function.array-uintersect.php                      30-Sep-2022 11:01                7554
function.array-unique.php                          30-Sep-2022 11:01                9234
function.array-unshift.php                         30-Sep-2022 11:01                6116
function.array-values.php                          30-Sep-2022 11:01                4464
function.array-walk-recursive.php                  30-Sep-2022 11:01                7388
function.array-walk.php                            30-Sep-2022 11:01               13811
function.array.php                                 30-Sep-2022 11:01               11863
function.arsort.php                                30-Sep-2022 11:01                8052
function.asin.php                                  30-Sep-2022 11:00                3331
function.asinh.php                                 30-Sep-2022 11:00                3144
function.asort.php                                 30-Sep-2022 11:01                8038
function.assert-options.php                        30-Sep-2022 11:00               11873
function.assert.php                                30-Sep-2022 11:00               26174
function.atan.php                                  30-Sep-2022 11:00                3344
function.atan2.php                                 30-Sep-2022 11:00                3239
function.atanh.php                                 30-Sep-2022 11:00                3169
function.autoload.php                              30-Sep-2022 11:01                3067
function.base-convert.php                          30-Sep-2022 11:00                6279
function.base64-decode.php                         30-Sep-2022 11:01                4742
function.base64-encode.php                         30-Sep-2022 11:01                4565
function.basename.php                              30-Sep-2022 11:00                7365
function.bcadd.php                                 30-Sep-2022 11:00                5575
function.bccomp.php                                30-Sep-2022 11:00                5503
function.bcdiv.php                                 30-Sep-2022 11:00                5056
function.bcmod.php                                 30-Sep-2022 11:00                7244
function.bcmul.php                                 30-Sep-2022 11:00                6965
function.bcpow.php                                 30-Sep-2022 11:00                6963
function.bcpowmod.php                              30-Sep-2022 11:00                7015
function.bcscale.php                               30-Sep-2022 11:00                5256
function.bcsqrt.php                                30-Sep-2022 11:00                4675
function.bcsub.php                                 30-Sep-2022 11:00                5581
function.bin2hex.php                               30-Sep-2022 11:01                4370
function.bind-textdomain-codeset.php               30-Sep-2022 11:00                4211
function.bindec.php                                30-Sep-2022 11:00               15472
function.bindtextdomain.php                        30-Sep-2022 11:00                5158
function.boolval.php                               30-Sep-2022 11:01               10602
function.bzclose.php                               30-Sep-2022 11:00                2805
function.bzcompress.php                            30-Sep-2022 11:00                4910
function.bzdecompress.php                          30-Sep-2022 11:00                6176
function.bzerrno.php                               30-Sep-2022 11:00                3002
function.bzerror.php                               30-Sep-2022 11:00                4252
function.bzerrstr.php                              30-Sep-2022 11:00                3008
function.bzflush.php                               30-Sep-2022 11:00                3126
function.bzopen.php                                30-Sep-2022 11:00                4889
function.bzread.php                                30-Sep-2022 11:00                6353
function.bzwrite.php                               30-Sep-2022 11:00                5983
function.cal-days-in-month.php                     30-Sep-2022 11:00                4453
function.cal-from-jd.php                           30-Sep-2022 11:00                6690
function.cal-info.php                              30-Sep-2022 11:00                5666
function.cal-to-jd.php                             30-Sep-2022 11:00                5373
function.call-user-func-array.php                  30-Sep-2022 11:01               14124
function.call-user-func.php                        30-Sep-2022 11:01               14915
function.ceil.php                                  30-Sep-2022 11:00                4875
function.chdir.php                                 30-Sep-2022 11:00                5246
function.checkdate.php                             30-Sep-2022 11:00                5211
function.checkdnsrr.php                            30-Sep-2022 11:01                4848
function.chgrp.php                                 30-Sep-2022 11:00                6425
function.chmod.php                                 30-Sep-2022 11:00                8708
function.chop.php                                  30-Sep-2022 11:01                1998
function.chown.php                                 30-Sep-2022 11:00                6491
function.chr.php                                   30-Sep-2022 11:01                8873
function.chroot.php                                30-Sep-2022 11:00                4397
function.chunk-split.php                           30-Sep-2022 11:01                5033
function.class-alias.php                           30-Sep-2022 11:01                7249
function.class-exists.php                          30-Sep-2022 11:01                7126
function.class-implements.php                      30-Sep-2022 11:01                6226
function.class-parents.php                         30-Sep-2022 11:01                5930
function.class-uses.php                            30-Sep-2022 11:01                6007
function.clearstatcache.php                        30-Sep-2022 11:00               10663
function.cli-get-process-title.php                 30-Sep-2022 11:00                4274
function.cli-set-process-title.php                 30-Sep-2022 11:00                5636
function.closedir.php                              30-Sep-2022 11:00                4835
function.closelog.php                              30-Sep-2022 11:01                2798
function.com-create-guid.php                       30-Sep-2022 11:01                2690
function.com-event-sink.php                        30-Sep-2022 11:01               10418
function.com-get-active-object.php                 30-Sep-2022 11:01                5401
function.com-load-typelib.php                      30-Sep-2022 11:01                4848
function.com-message-pump.php                      30-Sep-2022 11:01                3769
function.com-print-typeinfo.php                    30-Sep-2022 11:01                4620
function.commonmark-parse.php                      30-Sep-2022 11:01                3513
function.commonmark-render-html.php                30-Sep-2022 11:01                3929
function.commonmark-render-latex.php               30-Sep-2022 11:01                4205
function.commonmark-render-man.php                 30-Sep-2022 11:01                4187
function.commonmark-render-xml.php                 30-Sep-2022 11:01                3886
function.commonmark-render.php                     30-Sep-2022 11:01                4133
function.compact.php                               30-Sep-2022 11:01                7518
function.connection-aborted.php                    30-Sep-2022 11:01                2924
function.connection-status.php                     30-Sep-2022 11:01                3037
function.constant.php                              30-Sep-2022 11:01                7622
function.convert-cyr-string.php                    30-Sep-2022 11:01                4852
function.convert-uudecode.php                      30-Sep-2022 11:01                4239
function.convert-uuencode.php                      30-Sep-2022 11:01                5199
function.copy.php                                  30-Sep-2022 11:00                5691
function.cos.php                                   30-Sep-2022 11:00                3885
function.cosh.php                                  30-Sep-2022 11:00                3087
function.count-chars.php                           30-Sep-2022 11:01                7253
function.count.php                                 30-Sep-2022 11:01               16283
function.crc32.php                                 30-Sep-2022 11:01                6910
function.create-function.php                       30-Sep-2022 11:01               33269
function.crypt.php                                 30-Sep-2022 11:01               18669
function.ctype-alnum.php                           30-Sep-2022 11:01                6583
function.ctype-alpha.php                           30-Sep-2022 11:01                6920
function.ctype-cntrl.php                           30-Sep-2022 11:01                6580
function.ctype-digit.php                           30-Sep-2022 11:01                8974
function.ctype-graph.php                           30-Sep-2022 11:01                7319
function.ctype-lower.php                           30-Sep-2022 11:01                6691
function.ctype-print.php                           30-Sep-2022 11:01                7365
function.ctype-punct.php                           30-Sep-2022 11:01                6612
function.ctype-space.php                           30-Sep-2022 11:01                7469
function.ctype-upper.php                           30-Sep-2022 11:01                6701
function.ctype-xdigit.php                          30-Sep-2022 11:01                6481
function.cubrid-affected-rows.php                  30-Sep-2022 11:00                9296
function.cubrid-bind.php                           30-Sep-2022 11:00               21416
function.cubrid-client-encoding.php                30-Sep-2022 11:00                5142
function.cubrid-close-prepare.php                  30-Sep-2022 11:00                6668
function.cubrid-close-request.php                  30-Sep-2022 11:00                6679
function.cubrid-close.php                          30-Sep-2022 11:00                6499
function.cubrid-col-get.php                        30-Sep-2022 11:00                8463
function.cubrid-col-size.php                       30-Sep-2022 11:00                8554
function.cubrid-column-names.php                   30-Sep-2022 11:00                8608
function.cubrid-column-types.php                   30-Sep-2022 11:00                8588
function.cubrid-commit.php                         30-Sep-2022 11:00               16146
function.cubrid-connect-with-url.php               30-Sep-2022 11:00               15506
function.cubrid-connect.php                        30-Sep-2022 11:00               12098
function.cubrid-current-oid.php                    30-Sep-2022 11:00                5849
function.cubrid-data-seek.php                      30-Sep-2022 11:00                7231
function.cubrid-db-name.php                        30-Sep-2022 11:00                6379
function.cubrid-disconnect.php                     30-Sep-2022 11:00                7432
function.cubrid-drop.php                           30-Sep-2022 11:00               11513
function.cubrid-errno.php                          30-Sep-2022 11:00                6925
function.cubrid-error-code-facility.php            30-Sep-2022 11:00                5935
function.cubrid-error-code.php                     30-Sep-2022 11:00                5870
function.cubrid-error-msg.php                      30-Sep-2022 11:00                5268
function.cubrid-error.php                          30-Sep-2022 11:00                6483
function.cubrid-execute.php                        30-Sep-2022 11:00               14249
function.cubrid-fetch-array.php                    30-Sep-2022 11:00                9919
function.cubrid-fetch-assoc.php                    30-Sep-2022 11:00                9129
function.cubrid-fetch-field.php                    30-Sep-2022 11:00               14176
function.cubrid-fetch-lengths.php                  30-Sep-2022 11:00                6004
function.cubrid-fetch-object.php                   30-Sep-2022 11:00               12248
function.cubrid-fetch-row.php                      30-Sep-2022 11:00                9013
function.cubrid-fetch.php                          30-Sep-2022 11:00               10190
function.cubrid-field-flags.php                    30-Sep-2022 11:00                7671
function.cubrid-field-len.php                      30-Sep-2022 11:00                8252
function.cubrid-field-name.php                     30-Sep-2022 11:00                7086
function.cubrid-field-seek.php                     30-Sep-2022 11:00               10826
function.cubrid-field-table.php                    30-Sep-2022 11:00                7309
function.cubrid-field-type.php                     30-Sep-2022 11:00                7371
function.cubrid-free-result.php                    30-Sep-2022 11:00                5633
function.cubrid-get-autocommit.php                 30-Sep-2022 11:00                3528
function.cubrid-get-charset.php                    30-Sep-2022 11:00                4851
function.cubrid-get-class-name.php                 30-Sep-2022 11:00                6150
function.cubrid-get-client-info.php                30-Sep-2022 11:00                8223
function.cubrid-get-db-parameter.php               30-Sep-2022 11:00               14336
function.cubrid-get-query-timeout.php              30-Sep-2022 11:00                6584
function.cubrid-get-server-info.php                30-Sep-2022 11:00                8455
function.cubrid-get.php                            30-Sep-2022 11:00               10009
function.cubrid-insert-id.php                      30-Sep-2022 11:00                7075
function.cubrid-is-instance.php                    30-Sep-2022 11:00                7326
function.cubrid-list-dbs.php                       30-Sep-2022 11:00                4354
function.cubrid-load-from-glo.php                  30-Sep-2022 11:00                6779
function.cubrid-lob-close.php                      30-Sep-2022 11:00                7222
function.cubrid-lob-export.php                     30-Sep-2022 11:00                7679
function.cubrid-lob-get.php                        30-Sep-2022 11:00                7596
function.cubrid-lob-send.php                       30-Sep-2022 11:00                6885
function.cubrid-lob-size.php                       30-Sep-2022 11:00                5732
function.cubrid-lob2-bind.php                      30-Sep-2022 11:00                9630
function.cubrid-lob2-close.php                     30-Sep-2022 11:00                3153
function.cubrid-lob2-export.php                    30-Sep-2022 11:00                8647
function.cubrid-lob2-import.php                    30-Sep-2022 11:00                8511
function.cubrid-lob2-new.php                       30-Sep-2022 11:00                3669
function.cubrid-lob2-read.php                      30-Sep-2022 11:00               14394
function.cubrid-lob2-seek.php                      30-Sep-2022 11:00               11201
function.cubrid-lob2-seek64.php                    30-Sep-2022 11:00               12739
function.cubrid-lob2-size.php                      30-Sep-2022 11:00                4202
function.cubrid-lob2-size64.php                    30-Sep-2022 11:00                4380
function.cubrid-lob2-tell.php                      30-Sep-2022 11:00                4221
function.cubrid-lob2-tell64.php                    30-Sep-2022 11:00                4417
function.cubrid-lob2-write.php                     30-Sep-2022 11:00               14298
function.cubrid-lock-read.php                      30-Sep-2022 11:00                9099
function.cubrid-lock-write.php                     30-Sep-2022 11:00                9517
function.cubrid-move-cursor.php                    30-Sep-2022 11:00                9244
function.cubrid-new-glo.php                        30-Sep-2022 11:00                6934
function.cubrid-next-result.php                    30-Sep-2022 11:00               17179
function.cubrid-num-cols.php                       30-Sep-2022 11:00                5882
function.cubrid-num-fields.php                     30-Sep-2022 11:00                5571
function.cubrid-num-rows.php                       30-Sep-2022 11:00                7081
function.cubrid-pconnect-with-url.php              30-Sep-2022 11:00               14945
function.cubrid-pconnect.php                       30-Sep-2022 11:00               11986
function.cubrid-ping.php                           30-Sep-2022 11:00                6240
function.cubrid-prepare.php                        30-Sep-2022 11:00               10284
function.cubrid-put.php                            30-Sep-2022 11:00               11409
function.cubrid-query.php                          30-Sep-2022 11:00               15227
function.cubrid-real-escape-string.php             30-Sep-2022 11:00                8096
function.cubrid-result.php                         30-Sep-2022 11:00                7296
function.cubrid-rollback.php                       30-Sep-2022 11:00               15426
function.cubrid-save-to-glo.php                    30-Sep-2022 11:00                6692
function.cubrid-schema.php                         30-Sep-2022 11:00               20187
function.cubrid-send-glo.php                       30-Sep-2022 11:00                6125
function.cubrid-seq-drop.php                       30-Sep-2022 11:00                9618
function.cubrid-seq-insert.php                     30-Sep-2022 11:00               10073
function.cubrid-seq-put.php                        30-Sep-2022 11:00               10000
function.cubrid-set-add.php                        30-Sep-2022 11:00                9373
function.cubrid-set-autocommit.php                 30-Sep-2022 11:00                3906
function.cubrid-set-db-parameter.php               30-Sep-2022 11:00                7898
function.cubrid-set-drop.php                       30-Sep-2022 11:00                9350
function.cubrid-set-query-timeout.php              30-Sep-2022 11:00                3250
function.cubrid-unbuffered-query.php               30-Sep-2022 11:00                7102
function.cubrid-version.php                        30-Sep-2022 11:00                8860
function.curl-close.php                            30-Sep-2022 11:01                6028
function.curl-copy-handle.php                      30-Sep-2022 11:01                6280
function.curl-errno.php                            30-Sep-2022 11:01                5991
function.curl-error.php                            30-Sep-2022 11:01                5945
function.curl-escape.php                           30-Sep-2022 11:01                7405
function.curl-exec.php                             30-Sep-2022 11:01                6928
function.curl-getinfo.php                          30-Sep-2022 11:01               29288
function.curl-init.php                             30-Sep-2022 11:01                6997
function.curl-multi-add-handle.php                 30-Sep-2022 11:01               10285
function.curl-multi-close.php                      30-Sep-2022 11:01                9739
function.curl-multi-errno.php                      30-Sep-2022 11:01                3648
function.curl-multi-exec.php                       30-Sep-2022 11:01               10385
function.curl-multi-getcontent.php                 30-Sep-2022 11:01                3859
function.curl-multi-info-read.php                  30-Sep-2022 11:01               12133
function.curl-multi-init.php                       30-Sep-2022 11:01                8965
function.curl-multi-remove-handle.php              30-Sep-2022 11:01                5175
function.curl-multi-select.php                     30-Sep-2022 11:01                4123
function.curl-multi-setopt.php                     30-Sep-2022 11:01               10259
function.curl-multi-strerror.php                   30-Sep-2022 11:01                7213
function.curl-pause.php                            30-Sep-2022 11:01                3434
function.curl-reset.php                            30-Sep-2022 11:01                6393
function.curl-setopt-array.php                     30-Sep-2022 11:01                7489
function.curl-setopt.php                           30-Sep-2022 11:01              121659
function.curl-share-close.php                      30-Sep-2022 11:01                8113
function.curl-share-errno.php                      30-Sep-2022 11:01                3703
function.curl-share-init.php                       30-Sep-2022 11:01                7739
function.curl-share-setopt.php                     30-Sep-2022 11:01               10170
function.curl-share-strerror.php                   30-Sep-2022 11:01                3169
function.curl-strerror.php                         30-Sep-2022 11:01                6158
function.curl-unescape.php                         30-Sep-2022 11:01                7799
function.curl-version.php                          30-Sep-2022 11:01                7244
function.curl_upkeep.php                           30-Sep-2022 11:01                6797
function.current.php                               30-Sep-2022 11:01               10495
function.date-add.php                              30-Sep-2022 11:00                1687
function.date-create-from-format.php               30-Sep-2022 11:00                1862
function.date-create-immutable-from-format.php     30-Sep-2022 11:00                1974
function.date-create-immutable.php                 30-Sep-2022 11:00                1866
function.date-create.php                           30-Sep-2022 11:00                4157
function.date-date-set.php                         30-Sep-2022 11:00                1746
function.date-default-timezone-get.php             30-Sep-2022 11:00                6938
function.date-default-timezone-set.php             30-Sep-2022 11:00                5514
function.date-diff.php                             30-Sep-2022 11:00                1706
function.date-format.php                           30-Sep-2022 11:00                1714
function.date-get-last-errors.php                  30-Sep-2022 11:00                1843
function.date-interval-create-from-date-string.php 30-Sep-2022 11:00                1990
function.date-interval-format.php                  30-Sep-2022 11:00                1841
function.date-isodate-set.php                      30-Sep-2022 11:00                1769
function.date-modify.php                           30-Sep-2022 11:00                1718
function.date-offset-get.php                       30-Sep-2022 11:00                1762
function.date-parse-from-format.php                30-Sep-2022 11:00               13183
function.date-parse.php                            30-Sep-2022 11:00               19067
function.date-sub.php                              30-Sep-2022 11:00                2319
function.date-sun-info.php                         30-Sep-2022 11:00               16126
function.date-sunrise.php                          30-Sep-2022 11:00               13013
function.date-sunset.php                           30-Sep-2022 11:00               12993
function.date-time-set.php                         30-Sep-2022 11:00                1732
function.date-timestamp-get.php                    30-Sep-2022 11:00                1791
function.date-timestamp-set.php                    30-Sep-2022 11:00                1799
function.date-timezone-get.php                     30-Sep-2022 11:00                1788
function.date-timezone-set.php                     30-Sep-2022 11:00                1760
function.date.php                                  30-Sep-2022 11:00               22583
function.db2-autocommit.php                        30-Sep-2022 11:00               10902
function.db2-bind-param.php                        30-Sep-2022 11:00               22659
function.db2-client-info.php                       30-Sep-2022 11:00               12133
function.db2-close.php                             30-Sep-2022 11:00                5474
function.db2-column-privileges.php                 30-Sep-2022 11:00                7918
function.db2-columns.php                           30-Sep-2022 11:00                9814
function.db2-commit.php                            30-Sep-2022 11:00                3475
function.db2-conn-error.php                        30-Sep-2022 11:00                6636
function.db2-conn-errormsg.php                     30-Sep-2022 11:00                6408
function.db2-connect.php                           30-Sep-2022 11:00               40521
function.db2-cursor-type.php                       30-Sep-2022 11:00                3050
function.db2-escape-string.php                     30-Sep-2022 11:00                7957
function.db2-exec.php                              30-Sep-2022 11:00               28734
function.db2-execute.php                           30-Sep-2022 11:00               27632
function.db2-fetch-array.php                       30-Sep-2022 11:00               11373
function.db2-fetch-assoc.php                       30-Sep-2022 11:00               11389
function.db2-fetch-both.php                        30-Sep-2022 11:00               11922
function.db2-fetch-object.php                      30-Sep-2022 11:00                9007
function.db2-fetch-row.php                         30-Sep-2022 11:00               16669
function.db2-field-display-size.php                30-Sep-2022 11:00                4803
function.db2-field-name.php                        30-Sep-2022 11:00                4689
function.db2-field-num.php                         30-Sep-2022 11:00                4699
function.db2-field-precision.php                   30-Sep-2022 11:00                4731
function.db2-field-scale.php                       30-Sep-2022 11:00                4693
function.db2-field-type.php                        30-Sep-2022 11:00                4694
function.db2-field-width.php                       30-Sep-2022 11:00                4901
function.db2-foreign-keys.php                      30-Sep-2022 11:00                8535
function.db2-free-result.php                       30-Sep-2022 11:00                3118
function.db2-free-stmt.php                         30-Sep-2022 11:00                3106
function.db2-get-option.php                        30-Sep-2022 11:00               24904
function.db2-last-insert-id.php                    30-Sep-2022 11:00                8558
function.db2-lob-read.php                          30-Sep-2022 11:00               17729
function.db2-next-result.php                       30-Sep-2022 11:00                8964
function.db2-num-fields.php                        30-Sep-2022 11:00                7146
function.db2-num-rows.php                          30-Sep-2022 11:00                4239
function.db2-pclose.php                            30-Sep-2022 11:00                5662
function.db2-pconnect.php                          30-Sep-2022 11:00               32486
function.db2-prepare.php                           30-Sep-2022 11:00               10573
function.db2-primary-keys.php                      30-Sep-2022 11:00                7169
function.db2-procedure-columns.php                 30-Sep-2022 11:00               11224
function.db2-procedures.php                        30-Sep-2022 11:00                7607
function.db2-result.php                            30-Sep-2022 11:00                7874
function.db2-rollback.php                          30-Sep-2022 11:00                9776
function.db2-server-info.php                       30-Sep-2022 11:00               24263
function.db2-set-option.php                        30-Sep-2022 11:00               70498
function.db2-special-columns.php                   30-Sep-2022 11:00                9754
function.db2-statistics.php                        30-Sep-2022 11:00               11890
function.db2-stmt-error.php                        30-Sep-2022 11:00                4308
function.db2-stmt-errormsg.php                     30-Sep-2022 11:00                3939
function.db2-table-privileges.php                  30-Sep-2022 11:00                7698
function.db2-tables.php                            30-Sep-2022 11:00                7728
function.dba-close.php                             30-Sep-2022 11:00                3083
function.dba-delete.php                            30-Sep-2022 11:00                3795
function.dba-exists.php                            30-Sep-2022 11:00                3840
function.dba-fetch.php                             30-Sep-2022 11:00                5210
function.dba-firstkey.php                          30-Sep-2022 11:00                3442
function.dba-handlers.php                          30-Sep-2022 11:00                5372
function.dba-insert.php                            30-Sep-2022 11:00                4377
function.dba-key-split.php                         30-Sep-2022 11:00                3573
function.dba-list.php                              30-Sep-2022 11:00                2127
function.dba-nextkey.php                           30-Sep-2022 11:00                3364
function.dba-open.php                              30-Sep-2022 11:00               11279
function.dba-optimize.php                          30-Sep-2022 11:00                2948
function.dba-popen.php                             30-Sep-2022 11:00                6279
function.dba-replace.php                           30-Sep-2022 11:00                4205
function.dba-sync.php                              30-Sep-2022 11:00                2968
function.dbase-add-record.php                      30-Sep-2022 11:00                6743
function.dbase-close.php                           30-Sep-2022 11:00                4976
function.dbase-create.php                          30-Sep-2022 11:00                7959
function.dbase-delete-record.php                   30-Sep-2022 11:00                4563
function.dbase-get-header-info.php                 30-Sep-2022 11:00                6837
function.dbase-get-record-with-names.php           30-Sep-2022 11:00                8644
function.dbase-get-record.php                      30-Sep-2022 11:00                5253
function.dbase-numfields.php                       30-Sep-2022 11:00                5735
function.dbase-numrecords.php                      30-Sep-2022 11:00                7041
function.dbase-open.php                            30-Sep-2022 11:00                6157
function.dbase-pack.php                            30-Sep-2022 11:00                6153
function.dbase-replace-record.php                  30-Sep-2022 11:00                9294
function.dcgettext.php                             30-Sep-2022 11:00                3203
function.dcngettext.php                            30-Sep-2022 11:00                3745
function.debug-backtrace.php                       30-Sep-2022 11:00                9085
function.debug-print-backtrace.php                 30-Sep-2022 11:00                6412
function.debug-zval-dump.php                       30-Sep-2022 11:01                9748
function.decbin.php                                30-Sep-2022 11:00                8606
function.dechex.php                                30-Sep-2022 11:00                7059
function.decoct.php                                30-Sep-2022 11:00                4696
function.define.php                                30-Sep-2022 11:01               11137
function.defined.php                               30-Sep-2022 11:01                5178
function.deflate-add.php                           30-Sep-2022 11:00                5042
function.deflate-init.php                          30-Sep-2022 11:00                7098
function.deg2rad.php                               30-Sep-2022 11:00                3911
function.delete.php                                30-Sep-2022 11:00                2379
function.dgettext.php                              30-Sep-2022 11:00                3009
function.die.php                                   30-Sep-2022 11:01                1530
function.dio-close.php                             30-Sep-2022 11:00                3890
function.dio-fcntl.php                             30-Sep-2022 11:00                8866
function.dio-open.php                              30-Sep-2022 11:00                7471
function.dio-read.php                              30-Sep-2022 11:00                3310
function.dio-seek.php                              30-Sep-2022 11:00                7373
function.dio-stat.php                              30-Sep-2022 11:00                4072
function.dio-tcsetattr.php                         30-Sep-2022 11:00                6918
function.dio-truncate.php                          30-Sep-2022 11:00                3412
function.dio-write.php                             30-Sep-2022 11:00                3580
function.dir.php                                   30-Sep-2022 11:00                6843
function.dirname.php                               30-Sep-2022 11:00                9531
function.disk-free-space.php                       30-Sep-2022 11:00                5332
function.disk-total-space.php                      30-Sep-2022 11:00                5052
function.diskfreespace.php                         30-Sep-2022 11:00                1731
function.dl.php                                    30-Sep-2022 11:00                9802
function.dngettext.php                             30-Sep-2022 11:00                3563
function.dns-check-record.php                      30-Sep-2022 11:01                1703
function.dns-get-mx.php                            30-Sep-2022 11:01                1673
function.dns-get-record.php                        30-Sep-2022 11:01               22299
function.dom-import-simplexml.php                  30-Sep-2022 11:01                7108
function.doubleval.php                             30-Sep-2022 11:01                1656
function.each.php                                  30-Sep-2022 11:01               11415
function.easter-date.php                           30-Sep-2022 11:00               11602
function.easter-days.php                           30-Sep-2022 11:00                6910
function.echo.php                                  30-Sep-2022 11:01               19439
function.eio-busy.php                              30-Sep-2022 11:00                4379
function.eio-cancel.php                            30-Sep-2022 11:00                7266
function.eio-chmod.php                             30-Sep-2022 11:00                5595
function.eio-chown.php                             30-Sep-2022 11:00                5742
function.eio-close.php                             30-Sep-2022 11:00                5181
function.eio-custom.php                            30-Sep-2022 11:00               10242
function.eio-dup2.php                              30-Sep-2022 11:00                5265
function.eio-event-loop.php                        30-Sep-2022 11:00                5791
function.eio-fallocate.php                         30-Sep-2022 11:00                6706
function.eio-fchmod.php                            30-Sep-2022 11:00                5654
function.eio-fchown.php                            30-Sep-2022 11:00                5902
function.eio-fdatasync.php                         30-Sep-2022 11:00                5084
function.eio-fstat.php                             30-Sep-2022 11:00               11520
function.eio-fstatvfs.php                          30-Sep-2022 11:00                5223
function.eio-fsync.php                             30-Sep-2022 11:00                5197
function.eio-ftruncate.php                         30-Sep-2022 11:00                5672
function.eio-futime.php                            30-Sep-2022 11:00                5924
function.eio-get-event-stream.php                  30-Sep-2022 11:00                8479
function.eio-get-last-error.php                    30-Sep-2022 11:00                2974
function.eio-grp-add.php                           30-Sep-2022 11:00               12084
function.eio-grp-cancel.php                        30-Sep-2022 11:00                3020
function.eio-grp-limit.php                         30-Sep-2022 11:00                2865
function.eio-grp.php                               30-Sep-2022 11:00               12106
function.eio-init.php                              30-Sep-2022 11:00                2509
function.eio-link.php                              30-Sep-2022 11:00               12490
function.eio-lstat.php                             30-Sep-2022 11:00                9557
function.eio-mkdir.php                             30-Sep-2022 11:00                8876
function.eio-mknod.php                             30-Sep-2022 11:00               10769
function.eio-nop.php                               30-Sep-2022 11:00                4809
function.eio-npending.php                          30-Sep-2022 11:00                2936
function.eio-nready.php                            30-Sep-2022 11:00                2684
function.eio-nreqs.php                             30-Sep-2022 11:00                5554
function.eio-nthreads.php                          30-Sep-2022 11:00                3403
function.eio-open.php                              30-Sep-2022 11:00               11469
function.eio-poll.php                              30-Sep-2022 11:00                5713
function.eio-read.php                              30-Sep-2022 11:00               12784
function.eio-readahead.php                         30-Sep-2022 11:00                5645
function.eio-readdir.php                           30-Sep-2022 11:00               15576
function.eio-readlink.php                          30-Sep-2022 11:00               12171
function.eio-realpath.php                          30-Sep-2022 11:00                5100
function.eio-rename.php                            30-Sep-2022 11:00                8988
function.eio-rmdir.php                             30-Sep-2022 11:00                7916
function.eio-seek.php                              30-Sep-2022 11:00                6338
function.eio-sendfile.php                          30-Sep-2022 11:00                5914
function.eio-set-max-idle.php                      30-Sep-2022 11:00                3044
function.eio-set-max-parallel.php                  30-Sep-2022 11:00                3093
function.eio-set-max-poll-reqs.php                 30-Sep-2022 11:00                2370
function.eio-set-max-poll-time.php                 30-Sep-2022 11:00                2440
function.eio-set-min-parallel.php                  30-Sep-2022 11:00                3082
function.eio-stat.php                              30-Sep-2022 11:00                9529
function.eio-statvfs.php                           30-Sep-2022 11:00                7883
function.eio-symlink.php                           30-Sep-2022 11:00               10604
function.eio-sync-file-range.php                   30-Sep-2022 11:00                6501
function.eio-sync.php                              30-Sep-2022 11:00                2698
function.eio-syncfs.php                            30-Sep-2022 11:00                4767
function.eio-truncate.php                          30-Sep-2022 11:00                5548
function.eio-unlink.php                            30-Sep-2022 11:00                4772
function.eio-utime.php                             30-Sep-2022 11:00                5532
function.eio-write.php                             30-Sep-2022 11:00                6295
function.empty.php                                 30-Sep-2022 11:01                9414
function.enchant-broker-describe.php               30-Sep-2022 11:00                5888
function.enchant-broker-dict-exists.php            30-Sep-2022 11:00                5579
function.enchant-broker-free-dict.php              30-Sep-2022 11:00                4631
function.enchant-broker-free.php                   30-Sep-2022 11:00                4168
function.enchant-broker-get-dict-path.php          30-Sep-2022 11:00                4982
function.enchant-broker-get-error.php              30-Sep-2022 11:00                3508
function.enchant-broker-init.php                   30-Sep-2022 11:00                3386
function.enchant-broker-list-dicts.php             30-Sep-2022 11:00                6747
function.enchant-broker-request-dict.php           30-Sep-2022 11:00                6994
function.enchant-broker-request-pwl-dict.php       30-Sep-2022 11:00                5237
function.enchant-broker-set-dict-path.php          30-Sep-2022 11:00                5183
function.enchant-broker-set-ordering.php           30-Sep-2022 11:00                4489
function.enchant-dict-add-to-personal.php          30-Sep-2022 11:00                2158
function.enchant-dict-add-to-session.php           30-Sep-2022 11:00                4336
function.enchant-dict-add.php                      30-Sep-2022 11:00                6216
function.enchant-dict-check.php                    30-Sep-2022 11:00                3906
function.enchant-dict-describe.php                 30-Sep-2022 11:00                6381
function.enchant-dict-get-error.php                30-Sep-2022 11:00                3711
function.enchant-dict-is-added.php                 30-Sep-2022 11:00                4251
function.enchant-dict-is-in-session.php            30-Sep-2022 11:00                2144
function.enchant-dict-quick-check.php              30-Sep-2022 11:00                7971
function.enchant-dict-store-replacement.php        30-Sep-2022 11:00                4434
function.enchant-dict-suggest.php                  30-Sep-2022 11:00                7665
function.end.php                                   30-Sep-2022 11:01                5898
function.enum-exists.php                           30-Sep-2022 11:01                5078
function.error-clear-last.php                      30-Sep-2022 11:00                4543
function.error-get-last.php                        30-Sep-2022 11:00                4709
function.error-log.php                             30-Sep-2022 11:00               10430
function.error-reporting.php                       30-Sep-2022 11:00                8706
function.escapeshellarg.php                        30-Sep-2022 11:01                5209
function.escapeshellcmd.php                        30-Sep-2022 11:01                7519
function.eval.php                                  30-Sep-2022 11:01                8390
function.exec.php                                  30-Sep-2022 11:01                8947
function.exif-imagetype.php                        30-Sep-2022 11:00                8425
function.exif-read-data.php                        30-Sep-2022 11:00               21816
function.exif-tagname.php                          30-Sep-2022 11:00                4549
function.exif-thumbnail.php                        30-Sep-2022 11:00                8422
function.exit.php                                  30-Sep-2022 11:01                9291
function.exp.php                                   30-Sep-2022 11:00                4185
function.expect-expectl.php                        30-Sep-2022 11:00               11442
function.expect-popen.php                          30-Sep-2022 11:00                4511
function.explode.php                               30-Sep-2022 11:01               15152
function.expm1.php                                 30-Sep-2022 11:00                3273
function.extension-loaded.php                      30-Sep-2022 11:00                5446
function.extract.php                               30-Sep-2022 11:01               13000
function.ezmlm-hash.php                            30-Sep-2022 11:00                4476
function.fann-cascadetrain-on-data.php             30-Sep-2022 11:01                6074
function.fann-cascadetrain-on-file.php             30-Sep-2022 11:01                5145
function.fann-clear-scaling-params.php             30-Sep-2022 11:01                2468
function.fann-copy.php                             30-Sep-2022 11:01                3047
function.fann-create-from-file.php                 30-Sep-2022 11:01                3066
function.fann-create-shortcut-array.php            30-Sep-2022 11:01                3935
function.fann-create-shortcut.php                  30-Sep-2022 11:01                4847
function.fann-create-sparse-array.php              30-Sep-2022 11:01                4520
function.fann-create-sparse.php                    30-Sep-2022 11:01                5170
function.fann-create-standard-array.php            30-Sep-2022 11:01                4248
function.fann-create-standard.php                  30-Sep-2022 11:01                4915
function.fann-create-train-from-callback.php       30-Sep-2022 11:01                9138
function.fann-create-train.php                     30-Sep-2022 11:01                4311
function.fann-descale-input.php                    30-Sep-2022 11:01                3500
function.fann-descale-output.php                   30-Sep-2022 11:01                3516
function.fann-descale-train.php                    30-Sep-2022 11:01                3459
function.fann-destroy-train.php                    30-Sep-2022 11:01                2421
function.fann-destroy.php                          30-Sep-2022 11:01                2455
function.fann-duplicate-train-data.php             30-Sep-2022 11:01                2582
function.fann-get-activation-function.php          30-Sep-2022 11:01                5013
function.fann-get-activation-steepness.php         30-Sep-2022 11:01                5426
function.fann-get-bias-array.php                   30-Sep-2022 11:01                2442
function.fann-get-bit-fail-limit.php               30-Sep-2022 11:01                3561
function.fann-get-bit-fail.php                     30-Sep-2022 11:01                4784
function.fann-get-cascade-activation-functions-..> 30-Sep-2022 11:01                3673
function.fann-get-cascade-activation-functions.php 30-Sep-2022 11:01                4129
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:01                3729
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:01                3880
function.fann-get-cascade-candidate-change-frac..> 30-Sep-2022 11:01                5001
function.fann-get-cascade-candidate-limit.php      30-Sep-2022 11:01                3361
function.fann-get-cascade-candidate-stagnation-..> 30-Sep-2022 11:01                4112
function.fann-get-cascade-max-cand-epochs.php      30-Sep-2022 11:01                3243
function.fann-get-cascade-max-out-epochs.php       30-Sep-2022 11:01                3164
function.fann-get-cascade-min-cand-epochs.php      30-Sep-2022 11:01                3548
function.fann-get-cascade-min-out-epochs.php       30-Sep-2022 11:01                3505
function.fann-get-cascade-num-candidate-groups.php 30-Sep-2022 11:01                3641
function.fann-get-cascade-num-candidates.php       30-Sep-2022 11:01                5835
function.fann-get-cascade-output-change-fractio..> 30-Sep-2022 11:01                4929
function.fann-get-cascade-output-stagnation-epo..> 30-Sep-2022 11:01                4055
function.fann-get-cascade-weight-multiplier.php    30-Sep-2022 11:01                3319
function.fann-get-connection-array.php             30-Sep-2022 11:01                2469
function.fann-get-connection-rate.php              30-Sep-2022 11:01                2540
function.fann-get-errno.php                        30-Sep-2022 11:01                2980
function.fann-get-errstr.php                       30-Sep-2022 11:01                2983
function.fann-get-layer-array.php                  30-Sep-2022 11:01                2543
function.fann-get-learning-momentum.php            30-Sep-2022 11:01                3551
function.fann-get-learning-rate.php                30-Sep-2022 11:01                3407
function.fann-get-mse.php                          30-Sep-2022 11:01                3024
function.fann-get-network-type.php                 30-Sep-2022 11:01                2510
function.fann-get-num-input.php                    30-Sep-2022 11:01                2397
function.fann-get-num-layers.php                   30-Sep-2022 11:01                2452
function.fann-get-num-output.php                   30-Sep-2022 11:01                2416
function.fann-get-quickprop-decay.php              30-Sep-2022 11:01                3176
function.fann-get-quickprop-mu.php                 30-Sep-2022 11:01                3069
function.fann-get-rprop-decrease-factor.php        30-Sep-2022 11:01                3130
function.fann-get-rprop-delta-max.php              30-Sep-2022 11:01                3207
function.fann-get-rprop-delta-min.php              30-Sep-2022 11:01                3003
function.fann-get-rprop-delta-zero.php             30-Sep-2022 11:01                3406
function.fann-get-rprop-increase-factor.php        30-Sep-2022 11:01                3155
function.fann-get-sarprop-step-error-shift.php     30-Sep-2022 11:01                3465
function.fann-get-sarprop-step-error-threshold-..> 30-Sep-2022 11:01                3617
function.fann-get-sarprop-temperature.php          30-Sep-2022 11:01                3379
function.fann-get-sarprop-weight-decay-shift.php   30-Sep-2022 11:01                3446
function.fann-get-total-connections.php            30-Sep-2022 11:01                2589
function.fann-get-total-neurons.php                30-Sep-2022 11:01                2636
function.fann-get-train-error-function.php         30-Sep-2022 11:01                3346
function.fann-get-train-stop-function.php          30-Sep-2022 11:01                3334
function.fann-get-training-algorithm.php           30-Sep-2022 11:01                3506
function.fann-init-weights.php                     30-Sep-2022 11:01                4110
function.fann-length-train-data.php                30-Sep-2022 11:01                2584
function.fann-merge-train-data.php                 30-Sep-2022 11:01                2827
function.fann-num-input-train-data.php             30-Sep-2022 11:01                3311
function.fann-num-output-train-data.php            30-Sep-2022 11:01                3309
function.fann-print-error.php                      30-Sep-2022 11:01                2801
function.fann-randomize-weights.php                30-Sep-2022 11:01                3621
function.fann-read-train-from-file.php             30-Sep-2022 11:01                4897
function.fann-reset-errno.php                      30-Sep-2022 11:01                2992
function.fann-reset-errstr.php                     30-Sep-2022 11:01                2973
function.fann-reset-mse.php                        30-Sep-2022 11:01                3250
function.fann-run.php                              30-Sep-2022 11:01                2652
function.fann-save-train.php                       30-Sep-2022 11:01                3223
function.fann-save.php                             30-Sep-2022 11:01                4036
function.fann-scale-input-train-data.php           30-Sep-2022 11:01                3813
function.fann-scale-input.php                      30-Sep-2022 11:01                3514
function.fann-scale-output-train-data.php          30-Sep-2022 11:01                3841
function.fann-scale-output.php                     30-Sep-2022 11:01                3518
function.fann-scale-train-data.php                 30-Sep-2022 11:01                3811
function.fann-scale-train.php                      30-Sep-2022 11:01                3477
function.fann-set-activation-function-hidden.php   30-Sep-2022 11:01                4239
function.fann-set-activation-function-layer.php    30-Sep-2022 11:01                4699
function.fann-set-activation-function-output.php   30-Sep-2022 11:01                4255
function.fann-set-activation-function.php          30-Sep-2022 11:01                5963
function.fann-set-activation-steepness-hidden.php  30-Sep-2022 11:01                4540
function.fann-set-activation-steepness-layer.php   30-Sep-2022 11:01                4951
function.fann-set-activation-steepness-output.php  30-Sep-2022 11:01                4521
function.fann-set-activation-steepness.php         30-Sep-2022 11:01                5793
function.fann-set-bit-fail-limit.php               30-Sep-2022 11:01                3183
function.fann-set-callback.php                     30-Sep-2022 11:01                5237
function.fann-set-cascade-activation-functions.php 30-Sep-2022 11:01                3854
function.fann-set-cascade-activation-steepnesse..> 30-Sep-2022 11:01                4067
function.fann-set-cascade-candidate-change-frac..> 30-Sep-2022 11:01                3534
function.fann-set-cascade-candidate-limit.php      30-Sep-2022 11:01                3341
function.fann-set-cascade-candidate-stagnation-..> 30-Sep-2022 11:01                3596
function.fann-set-cascade-max-cand-epochs.php      30-Sep-2022 11:01                3342
function.fann-set-cascade-max-out-epochs.php       30-Sep-2022 11:01                3293
function.fann-set-cascade-min-cand-epochs.php      30-Sep-2022 11:01                3652
function.fann-set-cascade-min-out-epochs.php       30-Sep-2022 11:01                3634
function.fann-set-cascade-num-candidate-groups.php 30-Sep-2022 11:01                3427
function.fann-set-cascade-output-change-fractio..> 30-Sep-2022 11:01                3491
function.fann-set-cascade-output-stagnation-epo..> 30-Sep-2022 11:01                3557
function.fann-set-cascade-weight-multiplier.php    30-Sep-2022 11:01                3326
function.fann-set-error-log.php                    30-Sep-2022 11:01                2755
function.fann-set-input-scaling-params.php         30-Sep-2022 11:01                4114
function.fann-set-learning-momentum.php            30-Sep-2022 11:01                3582
function.fann-set-learning-rate.php                30-Sep-2022 11:01                3508
function.fann-set-output-scaling-params.php        30-Sep-2022 11:01                4134
function.fann-set-quickprop-decay.php              30-Sep-2022 11:01                3254
function.fann-set-quickprop-mu.php                 30-Sep-2022 11:01                3109
function.fann-set-rprop-decrease-factor.php        30-Sep-2022 11:01                3311
function.fann-set-rprop-delta-max.php              30-Sep-2022 11:01                3438
function.fann-set-rprop-delta-min.php              30-Sep-2022 11:01                3229
function.fann-set-rprop-delta-zero.php             30-Sep-2022 11:01                3641
function.fann-set-rprop-increase-factor.php        30-Sep-2022 11:01                3337
function.fann-set-sarprop-step-error-shift.php     30-Sep-2022 11:01                3702
function.fann-set-sarprop-step-error-threshold-..> 30-Sep-2022 11:01                3896
function.fann-set-sarprop-temperature.php          30-Sep-2022 11:01                3613
function.fann-set-sarprop-weight-decay-shift.php   30-Sep-2022 11:01                3696
function.fann-set-scaling-params.php               30-Sep-2022 11:01                5058
function.fann-set-train-error-function.php         30-Sep-2022 11:01                3523
function.fann-set-train-stop-function.php          30-Sep-2022 11:01                3511
function.fann-set-training-algorithm.php           30-Sep-2022 11:01                3459
function.fann-set-weight-array.php                 30-Sep-2022 11:01                2956
function.fann-set-weight.php                       30-Sep-2022 11:01                3296
function.fann-shuffle-train-data.php               30-Sep-2022 11:01                2621
function.fann-subset-train-data.php                30-Sep-2022 11:01                3852
function.fann-test-data.php                        30-Sep-2022 11:01                3965
function.fann-test.php                             30-Sep-2022 11:01                4259
function.fann-train-epoch.php                      30-Sep-2022 11:01                4324
function.fann-train-on-data.php                    30-Sep-2022 11:01                6097
function.fann-train-on-file.php                    30-Sep-2022 11:01                6093
function.fann-train.php                            30-Sep-2022 11:01                4285
function.fastcgi-finish-request.php                30-Sep-2022 11:01                2379
function.fbird-add-user.php                        30-Sep-2022 11:00                2308
function.fbird-affected-rows.php                   30-Sep-2022 11:00                2323
function.fbird-backup.php                          30-Sep-2022 11:00                1724
function.fbird-blob-add.php                        30-Sep-2022 11:00                2666
function.fbird-blob-cancel.php                     30-Sep-2022 11:00                3457
function.fbird-blob-close.php                      30-Sep-2022 11:00                2697
function.fbird-blob-create.php                     30-Sep-2022 11:00                2697
function.fbird-blob-echo.php                       30-Sep-2022 11:00                2485
function.fbird-blob-get.php                        30-Sep-2022 11:00                2478
function.fbird-blob-import.php                     30-Sep-2022 11:00                2693
function.fbird-blob-info.php                       30-Sep-2022 11:00                1756
function.fbird-blob-open.php                       30-Sep-2022 11:00                2475
function.fbird-close.php                           30-Sep-2022 11:00                2246
function.fbird-commit-ret.php                      30-Sep-2022 11:00                1749
function.fbird-commit.php                          30-Sep-2022 11:00                1717
function.fbird-connect.php                         30-Sep-2022 11:00                2252
function.fbird-db-info.php                         30-Sep-2022 11:00                1730
function.fbird-delete-user.php                     30-Sep-2022 11:00                2320
function.fbird-drop-db.php                         30-Sep-2022 11:00                2268
function.fbird-errcode.php                         30-Sep-2022 11:00                2076
function.fbird-errmsg.php                          30-Sep-2022 11:00                2069
function.fbird-execute.php                         30-Sep-2022 11:00                2081
function.fbird-fetch-assoc.php                     30-Sep-2022 11:00                2336
function.fbird-fetch-object.php                    30-Sep-2022 11:00                2347
function.fbird-fetch-row.php                       30-Sep-2022 11:00                2324
function.fbird-field-info.php                      30-Sep-2022 11:00                2151
function.fbird-free-event-handler.php              30-Sep-2022 11:00                2255
function.fbird-free-query.php                      30-Sep-2022 11:00                1785
function.fbird-free-result.php                     30-Sep-2022 11:00                1770
function.fbird-gen-id.php                          30-Sep-2022 11:00                1727
function.fbird-maintain-db.php                     30-Sep-2022 11:00                1772
function.fbird-modify-user.php                     30-Sep-2022 11:00                2336
function.fbird-name-result.php                     30-Sep-2022 11:00                2319
function.fbird-num-fields.php                      30-Sep-2022 11:00                2140
function.fbird-num-params.php                      30-Sep-2022 11:00                2314
function.fbird-param-info.php                      30-Sep-2022 11:00                2319
function.fbird-pconnect.php                        30-Sep-2022 11:00                2269
function.fbird-prepare.php                         30-Sep-2022 11:00                1720
function.fbird-query.php                           30-Sep-2022 11:00                2615
function.fbird-restore.php                         30-Sep-2022 11:00                1727
function.fbird-rollback-ret.php                    30-Sep-2022 11:00                1779
function.fbird-rollback.php                        30-Sep-2022 11:00                1751
function.fbird-server-info.php                     30-Sep-2022 11:00                1782
function.fbird-service-attach.php                  30-Sep-2022 11:00                1821
function.fbird-service-detach.php                  30-Sep-2022 11:00                1833
function.fbird-set-event-handler.php               30-Sep-2022 11:00                2429
function.fbird-trans.php                           30-Sep-2022 11:00                1726
function.fbird-wait-event.php                      30-Sep-2022 11:00                2354
function.fclose.php                                30-Sep-2022 11:00                4159
function.fdatasync.php                             30-Sep-2022 11:00                5780
function.fdf-add-doc-javascript.php                30-Sep-2022 11:00                5169
function.fdf-add-template.php                      30-Sep-2022 11:00                2504
function.fdf-close.php                             30-Sep-2022 11:00                2960
function.fdf-create.php                            30-Sep-2022 11:00                5530
function.fdf-enum-values.php                       30-Sep-2022 11:00                2354
function.fdf-errno.php                             30-Sep-2022 11:00                2666
function.fdf-error.php                             30-Sep-2022 11:00                3057
function.fdf-get-ap.php                            30-Sep-2022 11:00                3817
function.fdf-get-attachment.php                    30-Sep-2022 11:00                5918
function.fdf-get-encoding.php                      30-Sep-2022 11:00                3233
function.fdf-get-file.php                          30-Sep-2022 11:00                3053
function.fdf-get-flags.php                         30-Sep-2022 11:00                2116
function.fdf-get-opt.php                           30-Sep-2022 11:00                2254
function.fdf-get-status.php                        30-Sep-2022 11:00                3072
function.fdf-get-value.php                         30-Sep-2022 11:00                4360
function.fdf-get-version.php                       30-Sep-2022 11:00                3432
function.fdf-header.php                            30-Sep-2022 11:00                2254
function.fdf-next-field-name.php                   30-Sep-2022 11:00                5310
function.fdf-open-string.php                       30-Sep-2022 11:00                4710
function.fdf-open.php                              30-Sep-2022 11:00                5816
function.fdf-remove-item.php                       30-Sep-2022 11:00                2128
function.fdf-save-string.php                       30-Sep-2022 11:00                5470
function.fdf-save.php                              30-Sep-2022 11:00                3799
function.fdf-set-ap.php                            30-Sep-2022 11:00                3990
function.fdf-set-encoding.php                      30-Sep-2022 11:00                3441
function.fdf-set-file.php                          30-Sep-2022 11:00                6672
function.fdf-set-flags.php                         30-Sep-2022 11:00                3967
function.fdf-set-javascript-action.php             30-Sep-2022 11:00                4162
function.fdf-set-on-import-javascript.php          30-Sep-2022 11:00                2930
function.fdf-set-opt.php                           30-Sep-2022 11:00                4192
function.fdf-set-status.php                        30-Sep-2022 11:00                3488
function.fdf-set-submit-form-action.php            30-Sep-2022 11:00                4407
function.fdf-set-target-frame.php                  30-Sep-2022 11:00                3488
function.fdf-set-value.php                         30-Sep-2022 11:00                4931
function.fdf-set-version.php                       30-Sep-2022 11:00                3712
function.fdiv.php                                  30-Sep-2022 11:00                5953
function.feof.php                                  30-Sep-2022 11:00                7607
function.fflush.php                                30-Sep-2022 11:00                5371
function.fgetc.php                                 30-Sep-2022 11:00                6238
function.fgetcsv.php                               30-Sep-2022 11:00               12536
function.fgets.php                                 30-Sep-2022 11:00                8239
function.fgetss.php                                30-Sep-2022 11:00                9335
function.file-exists.php                           30-Sep-2022 11:00                6833
function.file-get-contents.php                     30-Sep-2022 11:00               17480
function.file-put-contents.php                     30-Sep-2022 11:00               12787
function.file.php                                  30-Sep-2022 11:00               11190
function.fileatime.php                             30-Sep-2022 11:00                6611
function.filectime.php                             30-Sep-2022 11:00                6662
function.filegroup.php                             30-Sep-2022 11:00                5372
function.fileinode.php                             30-Sep-2022 11:00                5061
function.filemtime.php                             30-Sep-2022 11:00                6471
function.fileowner.php                             30-Sep-2022 11:00                5277
function.fileperms.php                             30-Sep-2022 11:00               17822
function.filesize.php                              30-Sep-2022 11:00                5471
function.filetype.php                              30-Sep-2022 11:00                6293
function.filter-has-var.php                        30-Sep-2022 11:01                2807
function.filter-id.php                             30-Sep-2022 11:01                2752
function.filter-input-array.php                    30-Sep-2022 11:01               13579
function.filter-input.php                          30-Sep-2022 11:01                7635
function.filter-list.php                           30-Sep-2022 11:01                3552
function.filter-var-array.php                      30-Sep-2022 11:01               13245
function.filter-var.php                            30-Sep-2022 11:01               13537
function.finfo-buffer.php                          30-Sep-2022 11:00                7599
function.finfo-close.php                           30-Sep-2022 11:00                3339
function.finfo-file.php                            30-Sep-2022 11:00                8258
function.finfo-open.php                            30-Sep-2022 11:00                9687
function.finfo-set-flags.php                       30-Sep-2022 11:00                4359
function.floatval.php                              30-Sep-2022 11:01                6005
function.flock.php                                 30-Sep-2022 11:00               12484
function.floor.php                                 30-Sep-2022 11:00                4993
function.flush.php                                 30-Sep-2022 11:00                4645
function.fmod.php                                  30-Sep-2022 11:00                4916
function.fnmatch.php                               30-Sep-2022 11:00                7375
function.fopen.php                                 30-Sep-2022 11:00               22211
function.forward-static-call-array.php             30-Sep-2022 11:01                9967
function.forward-static-call.php                   30-Sep-2022 11:01                9449
function.fpassthru.php                             30-Sep-2022 11:00                7188
function.fpm-get-status.php                        30-Sep-2022 11:01                2454
function.fprintf.php                               30-Sep-2022 11:01               18512
function.fputcsv.php                               30-Sep-2022 11:00                9897
function.fputs.php                                 30-Sep-2022 11:00                1619
function.fread.php                                 30-Sep-2022 11:00               14610
function.frenchtojd.php                            30-Sep-2022 11:00                3824
function.fscanf.php                                30-Sep-2022 11:00                9149
function.fseek.php                                 30-Sep-2022 11:00                7412
function.fsockopen.php                             30-Sep-2022 11:01               16702
function.fstat.php                                 30-Sep-2022 11:00                5827
function.fsync.php                                 30-Sep-2022 11:00                5542
function.ftell.php                                 30-Sep-2022 11:00                5973
function.ftok.php                                  30-Sep-2022 11:01                3462
function.ftp-alloc.php                             30-Sep-2022 11:01                8217
function.ftp-append.php                            30-Sep-2022 11:01                4150
function.ftp-cdup.php                              30-Sep-2022 11:01                6666
function.ftp-chdir.php                             30-Sep-2022 11:01                7598
function.ftp-chmod.php                             30-Sep-2022 11:01                7038
function.ftp-close.php                             30-Sep-2022 11:01                5904
function.ftp-connect.php                           30-Sep-2022 11:01                6389
function.ftp-delete.php                            30-Sep-2022 11:01                6181
function.ftp-exec.php                              30-Sep-2022 11:01                6742
function.ftp-fget.php                              30-Sep-2022 11:01                9840
function.ftp-fput.php                              30-Sep-2022 11:01                9202
function.ftp-get-option.php                        30-Sep-2022 11:01                5774
function.ftp-get.php                               30-Sep-2022 11:01                9088
function.ftp-login.php                             30-Sep-2022 11:01                6788
function.ftp-mdtm.php                              30-Sep-2022 11:01                7251
function.ftp-mkdir.php                             30-Sep-2022 11:01                6893
function.ftp-mlsd.php                              30-Sep-2022 11:01                9050
function.ftp-nb-continue.php                       30-Sep-2022 11:01                5476
function.ftp-nb-fget.php                           30-Sep-2022 11:01               10288
function.ftp-nb-fput.php                           30-Sep-2022 11:01               10039
function.ftp-nb-get.php                            30-Sep-2022 11:01               14362
function.ftp-nb-put.php                            30-Sep-2022 11:01               11791
function.ftp-nlist.php                             30-Sep-2022 11:01                6752
function.ftp-pasv.php                              30-Sep-2022 11:01                7200
function.ftp-put.php                               30-Sep-2022 11:01                8744
function.ftp-pwd.php                               30-Sep-2022 11:01                6028
function.ftp-quit.php                              30-Sep-2022 11:01                1627
function.ftp-raw.php                               30-Sep-2022 11:01                5468
function.ftp-rawlist.php                           30-Sep-2022 11:01                7962
function.ftp-rename.php                            30-Sep-2022 11:01                7070
function.ftp-rmdir.php                             30-Sep-2022 11:01                6529
function.ftp-set-option.php                        30-Sep-2022 11:01                6886
function.ftp-site.php                              30-Sep-2022 11:01                6708
function.ftp-size.php                              30-Sep-2022 11:01                6886
function.ftp-ssl-connect.php                       30-Sep-2022 11:01                8856
function.ftp-systype.php                           30-Sep-2022 11:01                5534
function.ftruncate.php                             30-Sep-2022 11:00                6245
function.func-get-arg.php                          30-Sep-2022 11:01               11487
function.func-get-args.php                         30-Sep-2022 11:01               12296
function.func-num-args.php                         30-Sep-2022 11:01                5741
function.function-exists.php                       30-Sep-2022 11:01                5843
function.fwrite.php                                30-Sep-2022 11:00               15227
function.gc-collect-cycles.php                     30-Sep-2022 11:00                2445
function.gc-disable.php                            30-Sep-2022 11:00                2508
function.gc-enable.php                             30-Sep-2022 11:00                2481
function.gc-enabled.php                            30-Sep-2022 11:00                3206
function.gc-mem-caches.php                         30-Sep-2022 11:00                2385
function.gc-status.php                             30-Sep-2022 11:00                5915
function.gd-info.php                               30-Sep-2022 11:00                7888
function.geoip-asnum-by-name.php                   30-Sep-2022 11:01                4077
function.geoip-continent-code-by-name.php          30-Sep-2022 11:01                5609
function.geoip-country-code-by-name.php            30-Sep-2022 11:01                5344
function.geoip-country-code3-by-name.php           30-Sep-2022 11:01                4909
function.geoip-country-name-by-name.php            30-Sep-2022 11:01                4874
function.geoip-database-info.php                   30-Sep-2022 11:01                4098
function.geoip-db-avail.php                        30-Sep-2022 11:01                4237
function.geoip-db-filename.php                     30-Sep-2022 11:01                3974
function.geoip-db-get-all-info.php                 30-Sep-2022 11:01                6715
function.geoip-domain-by-name.php                  30-Sep-2022 11:01                4306
function.geoip-id-by-name.php                      30-Sep-2022 11:01                5842
function.geoip-isp-by-name.php                     30-Sep-2022 11:01                4330
function.geoip-netspeedcell-by-name.php            30-Sep-2022 11:01                5053
function.geoip-org-by-name.php                     30-Sep-2022 11:01                4349
function.geoip-record-by-name.php                  30-Sep-2022 11:01                7509
function.geoip-region-by-name.php                  30-Sep-2022 11:01                4967
function.geoip-region-name-by-code.php             30-Sep-2022 11:01                7073
function.geoip-setup-custom-directory.php          30-Sep-2022 11:01                4096
function.geoip-time-zone-by-country-and-region.php 30-Sep-2022 11:01                7283
function.get-browser.php                           30-Sep-2022 11:01                7863
function.get-called-class.php                      30-Sep-2022 11:01                4905
function.get-cfg-var.php                           30-Sep-2022 11:00                3606
function.get-class-methods.php                     30-Sep-2022 11:01                7131
function.get-class-vars.php                        30-Sep-2022 11:01               10294
function.get-class.php                             30-Sep-2022 11:01               12579
function.get-current-user.php                      30-Sep-2022 11:00                4238
function.get-debug-type.php                        30-Sep-2022 11:01                9660
function.get-declared-classes.php                  30-Sep-2022 11:01                5188
function.get-declared-interfaces.php               30-Sep-2022 11:01                4205
function.get-declared-traits.php                   30-Sep-2022 11:01                2820
function.get-defined-constants.php                 30-Sep-2022 11:00                7325
function.get-defined-functions.php                 30-Sep-2022 11:01                6863
function.get-defined-vars.php                      30-Sep-2022 11:01                6348
function.get-extension-funcs.php                   30-Sep-2022 11:00                5375
function.get-headers.php                           30-Sep-2022 11:01                8730
function.get-html-translation-table.php            30-Sep-2022 11:01               12763
function.get-include-path.php                      30-Sep-2022 11:00                4304
function.get-included-files.php                    30-Sep-2022 11:00                5982
function.get-loaded-extensions.php                 30-Sep-2022 11:00                5332
function.get-magic-quotes-gpc.php                  30-Sep-2022 11:00                4033
function.get-magic-quotes-runtime.php              30-Sep-2022 11:00                4806
function.get-mangled-object-vars.php               30-Sep-2022 11:01                8217
function.get-meta-tags.php                         30-Sep-2022 11:01                7773
function.get-object-vars.php                       30-Sep-2022 11:01                6219
function.get-parent-class.php                      30-Sep-2022 11:01                7770
function.get-required-files.php                    30-Sep-2022 11:00                1793
function.get-resource-id.php                       30-Sep-2022 11:01                4562
function.get-resource-type.php                     30-Sep-2022 11:01                5216
function.get-resources.php                         30-Sep-2022 11:00                7526
function.getallheaders.php                         30-Sep-2022 11:01                4599
function.getcwd.php                                30-Sep-2022 11:00                5145
function.getdate.php                               30-Sep-2022 11:00                9162
function.getenv.php                                30-Sep-2022 11:00                7709
function.gethostbyaddr.php                         30-Sep-2022 11:01                4211
function.gethostbyname.php                         30-Sep-2022 11:01                4452
function.gethostbynamel.php                        30-Sep-2022 11:01                4934
function.gethostname.php                           30-Sep-2022 11:01                3878
function.getimagesize.php                          30-Sep-2022 11:00               16914
function.getimagesizefromstring.php                30-Sep-2022 11:00                5485
function.getlastmod.php                            30-Sep-2022 11:00                5142
function.getmxrr.php                               30-Sep-2022 11:01                5664
function.getmygid.php                              30-Sep-2022 11:00                3268
function.getmyinode.php                            30-Sep-2022 11:00                3279
function.getmypid.php                              30-Sep-2022 11:00                3602
function.getmyuid.php                              30-Sep-2022 11:00                3242
function.getopt.php                                30-Sep-2022 11:00               15333
function.getprotobyname.php                        30-Sep-2022 11:01                4590
function.getprotobynumber.php                      30-Sep-2022 11:01                3093
function.getrandmax.php                            30-Sep-2022 11:00                2910
function.getrusage.php                             30-Sep-2022 11:00               11831
function.getservbyname.php                         30-Sep-2022 11:01                6390
function.getservbyport.php                         30-Sep-2022 11:01                3547
function.gettext.php                               30-Sep-2022 11:00                5835
function.gettimeofday.php                          30-Sep-2022 11:00                4456
function.gettype.php                               30-Sep-2022 11:01                9245
function.glob.php                                  30-Sep-2022 11:00                9309
function.gmdate.php                                30-Sep-2022 11:00                7398
function.gmmktime.php                              30-Sep-2022 11:00               10224
function.gmp-abs.php                               30-Sep-2022 11:00                4315
function.gmp-add.php                               30-Sep-2022 11:00                4477
function.gmp-and.php                               30-Sep-2022 11:00                4958
function.gmp-binomial.php                          30-Sep-2022 11:00                3680
function.gmp-clrbit.php                            30-Sep-2022 11:00                5511
function.gmp-cmp.php                               30-Sep-2022 11:00                5357
function.gmp-com.php                               30-Sep-2022 11:00                3783
function.gmp-div-q.php                             30-Sep-2022 11:00                9669
function.gmp-div-qr.php                            30-Sep-2022 11:00                6373
function.gmp-div-r.php                             30-Sep-2022 11:00                5778
function.gmp-div.php                               30-Sep-2022 11:00                1646
function.gmp-divexact.php                          30-Sep-2022 11:00                5609
function.gmp-export.php                            30-Sep-2022 11:00                5225
function.gmp-fact.php                              30-Sep-2022 11:00                4767
function.gmp-gcd.php                               30-Sep-2022 11:00                4871
function.gmp-gcdext.php                            30-Sep-2022 11:00                9360
function.gmp-hamdist.php                           30-Sep-2022 11:00                6186
function.gmp-import.php                            30-Sep-2022 11:00                5687
function.gmp-init.php                              30-Sep-2022 11:00                5153
function.gmp-intval.php                            30-Sep-2022 11:00                5057
function.gmp-invert.php                            30-Sep-2022 11:00                5034
function.gmp-jacobi.php                            30-Sep-2022 11:00                5349
function.gmp-kronecker.php                         30-Sep-2022 11:00                3659
function.gmp-lcm.php                               30-Sep-2022 11:00                3470
function.gmp-legendre.php                          30-Sep-2022 11:00                5368
function.gmp-mod.php                               30-Sep-2022 11:00                4599
function.gmp-mul.php                               30-Sep-2022 11:00                4681
function.gmp-neg.php                               30-Sep-2022 11:00                4264
function.gmp-nextprime.php                         30-Sep-2022 11:00                4984
function.gmp-or.php                                30-Sep-2022 11:00                5180
function.gmp-perfect-power.php                     30-Sep-2022 11:00                3045
function.gmp-perfect-square.php                    30-Sep-2022 11:00                5370
function.gmp-popcount.php                          30-Sep-2022 11:00                4683
function.gmp-pow.php                               30-Sep-2022 11:00                5628
function.gmp-powm.php                              30-Sep-2022 11:00                5406
function.gmp-prob-prime.php                        30-Sep-2022 11:00                5546
function.gmp-random-bits.php                       30-Sep-2022 11:00                4534
function.gmp-random-range.php                      30-Sep-2022 11:00                5453
function.gmp-random-seed.php                       30-Sep-2022 11:00                6654
function.gmp-random.php                            30-Sep-2022 11:00                5356
function.gmp-root.php                              30-Sep-2022 11:00                2981
function.gmp-rootrem.php                           30-Sep-2022 11:00                3089
function.gmp-scan0.php                             30-Sep-2022 11:00                5384
function.gmp-scan1.php                             30-Sep-2022 11:00                5396
function.gmp-setbit.php                            30-Sep-2022 11:00               11839
function.gmp-sign.php                              30-Sep-2022 11:00                4955
function.gmp-sqrt.php                              30-Sep-2022 11:00                4861
function.gmp-sqrtrem.php                           30-Sep-2022 11:00                6273
function.gmp-strval.php                            30-Sep-2022 11:00                4440
function.gmp-sub.php                               30-Sep-2022 11:00                4773
function.gmp-testbit.php                           30-Sep-2022 11:00                5553
function.gmp-xor.php                               30-Sep-2022 11:00                5181
function.gmstrftime.php                            30-Sep-2022 11:00                8726
function.gnupg-adddecryptkey.php                   30-Sep-2022 11:00                5022
function.gnupg-addencryptkey.php                   30-Sep-2022 11:00                4624
function.gnupg-addsignkey.php                      30-Sep-2022 11:00                5041
function.gnupg-cleardecryptkeys.php                30-Sep-2022 11:00                4224
function.gnupg-clearencryptkeys.php                30-Sep-2022 11:00                4229
function.gnupg-clearsignkeys.php                   30-Sep-2022 11:00                4171
function.gnupg-decrypt.php                         30-Sep-2022 11:00                5812
function.gnupg-decryptverify.php                   30-Sep-2022 11:00                6920
function.gnupg-deletekey.php                       30-Sep-2022 11:00                4861
function.gnupg-encrypt.php                         30-Sep-2022 11:00                5740
function.gnupg-encryptsign.php                     30-Sep-2022 11:00                6640
function.gnupg-export.php                          30-Sep-2022 11:00                4908
function.gnupg-getengineinfo.php                   30-Sep-2022 11:00                5443
function.gnupg-geterror.php                        30-Sep-2022 11:00                4102
function.gnupg-geterrorinfo.php                    30-Sep-2022 11:00                5586
function.gnupg-getprotocol.php                     30-Sep-2022 11:00                4232
function.gnupg-gettrustlist.php                    30-Sep-2022 11:00                4976
function.gnupg-import.php                          30-Sep-2022 11:00                5165
function.gnupg-init.php                            30-Sep-2022 11:00                7006
function.gnupg-keyinfo.php                         30-Sep-2022 11:00                5097
function.gnupg-listsignatures.php                  30-Sep-2022 11:00                5205
function.gnupg-setarmor.php                        30-Sep-2022 11:00                5466
function.gnupg-seterrormode.php                    30-Sep-2022 11:00                5427
function.gnupg-setsignmode.php                     30-Sep-2022 11:00                5313
function.gnupg-sign.php                            30-Sep-2022 11:00                5982
function.gnupg-verify.php                          30-Sep-2022 11:00                8103
function.grapheme-extract.php                      30-Sep-2022 11:00                8682
function.grapheme-stripos.php                      30-Sep-2022 11:00                8206
function.grapheme-stristr.php                      30-Sep-2022 11:00                7763
function.grapheme-strlen.php                       30-Sep-2022 11:00                5489
function.grapheme-strpos.php                       30-Sep-2022 11:00                7813
function.grapheme-strripos.php                     30-Sep-2022 11:00                7661
function.grapheme-strrpos.php                      30-Sep-2022 11:00                7260
function.grapheme-strstr.php                       30-Sep-2022 11:00                7305
function.grapheme-substr.php                       30-Sep-2022 11:00                7830
function.gregoriantojd.php                         30-Sep-2022 11:00                7500
function.gzclose.php                               30-Sep-2022 11:00                4075
function.gzcompress.php                            30-Sep-2022 11:00                5752
function.gzdecode.php                              30-Sep-2022 11:00                3448
function.gzdeflate.php                             30-Sep-2022 11:00                5386
function.gzencode.php                              30-Sep-2022 11:00                6562
function.gzeof.php                                 30-Sep-2022 11:00                3949
function.gzfile.php                                30-Sep-2022 11:00                4604
function.gzgetc.php                                30-Sep-2022 11:00                4554
function.gzgets.php                                30-Sep-2022 11:00                5911
function.gzgetss.php                               30-Sep-2022 11:00                5963
function.gzinflate.php                             30-Sep-2022 11:00                5245
function.gzopen.php                                30-Sep-2022 11:00                5428
function.gzpassthru.php                            30-Sep-2022 11:00                4675
function.gzputs.php                                30-Sep-2022 11:00                1613
function.gzread.php                                30-Sep-2022 11:00                6478
function.gzrewind.php                              30-Sep-2022 11:00                3069
function.gzseek.php                                30-Sep-2022 11:00                5966
function.gztell.php                                30-Sep-2022 11:00                3283
function.gzuncompress.php                          30-Sep-2022 11:00                5205
function.gzwrite.php                               30-Sep-2022 11:00                6248
function.halt-compiler.php                         30-Sep-2022 11:01                5108
function.hash-algos.php                            30-Sep-2022 11:00                5685
function.hash-copy.php                             30-Sep-2022 11:00                5451
function.hash-equals.php                           30-Sep-2022 11:00                6434
function.hash-file.php                             30-Sep-2022 11:00                7150
function.hash-final.php                            30-Sep-2022 11:00                6067
function.hash-hkdf.php                             30-Sep-2022 11:00                8874
function.hash-hmac-algos.php                       30-Sep-2022 11:00                5223
function.hash-hmac-file.php                        30-Sep-2022 11:00                7144
function.hash-hmac.php                             30-Sep-2022 11:00                6952
function.hash-init.php                             30-Sep-2022 11:00                8237
function.hash-pbkdf2.php                           30-Sep-2022 11:00               12020
function.hash-update-file.php                      30-Sep-2022 11:00                5498
function.hash-update-stream.php                    30-Sep-2022 11:00                7036
function.hash-update.php                           30-Sep-2022 11:00                4267
function.hash.php                                  30-Sep-2022 11:00                6866
function.header-register-callback.php              30-Sep-2022 11:01                6807
function.header-remove.php                         30-Sep-2022 11:01                6590
function.header.php                                30-Sep-2022 11:01               18500
function.headers-list.php                          30-Sep-2022 11:01                6149
function.headers-sent.php                          30-Sep-2022 11:01                8061
function.hebrev.php                                30-Sep-2022 11:01                3135
function.hebrevc.php                               30-Sep-2022 11:01                3588
function.hex2bin.php                               30-Sep-2022 11:01                4751
function.hexdec.php                                30-Sep-2022 11:00                6245
function.highlight-file.php                        30-Sep-2022 11:01                5117
function.highlight-string.php                      30-Sep-2022 11:01                5439
function.hrtime.php                                30-Sep-2022 11:01                4685
function.html-entity-decode.php                    30-Sep-2022 11:01               13610
function.htmlentities.php                          30-Sep-2022 11:01               16406
function.htmlspecialchars-decode.php               30-Sep-2022 11:01                8451
function.htmlspecialchars.php                      30-Sep-2022 11:01               19545
function.http-build-query.php                      30-Sep-2022 11:01               20072
function.http-response-code.php                    30-Sep-2022 11:01                6871
function.hypot.php                                 30-Sep-2022 11:00                2857
function.ibase-add-user.php                        30-Sep-2022 11:00                4647
function.ibase-affected-rows.php                   30-Sep-2022 11:00                3315
function.ibase-backup.php                          30-Sep-2022 11:00                9970
function.ibase-blob-add.php                        30-Sep-2022 11:00                3860
function.ibase-blob-cancel.php                     30-Sep-2022 11:00                3465
function.ibase-blob-close.php                      30-Sep-2022 11:00                3833
function.ibase-blob-create.php                     30-Sep-2022 11:00                3799
function.ibase-blob-echo.php                       30-Sep-2022 11:00                3817
function.ibase-blob-get.php                        30-Sep-2022 11:00                6491
function.ibase-blob-import.php                     30-Sep-2022 11:00                8258
function.ibase-blob-info.php                       30-Sep-2022 11:00                3180
function.ibase-blob-open.php                       30-Sep-2022 11:00                4024
function.ibase-close.php                           30-Sep-2022 11:00                3501
function.ibase-commit-ret.php                      30-Sep-2022 11:00                2994
function.ibase-commit.php                          30-Sep-2022 11:00                2795
function.ibase-connect.php                         30-Sep-2022 11:00               10066
function.ibase-db-info.php                         30-Sep-2022 11:00                2387
function.ibase-delete-user.php                     30-Sep-2022 11:00                3287
function.ibase-drop-db.php                         30-Sep-2022 11:00                3399
function.ibase-errcode.php                         30-Sep-2022 11:00                2541
function.ibase-errmsg.php                          30-Sep-2022 11:00                2532
function.ibase-execute.php                         30-Sep-2022 11:00                6933
function.ibase-fetch-assoc.php                     30-Sep-2022 11:00                4484
function.ibase-fetch-object.php                    30-Sep-2022 11:00                6528
function.ibase-fetch-row.php                       30-Sep-2022 11:00                4249
function.ibase-field-info.php                      30-Sep-2022 11:00                7058
function.ibase-free-event-handler.php              30-Sep-2022 11:00                3273
function.ibase-free-query.php                      30-Sep-2022 11:00                2561
function.ibase-free-result.php                     30-Sep-2022 11:00                2653
function.ibase-gen-id.php                          30-Sep-2022 11:00                2610
function.ibase-maintain-db.php                     30-Sep-2022 11:00                2705
function.ibase-modify-user.php                     30-Sep-2022 11:00                4652
function.ibase-name-result.php                     30-Sep-2022 11:00                5639
function.ibase-num-fields.php                      30-Sep-2022 11:00                6623
function.ibase-num-params.php                      30-Sep-2022 11:00                3305
function.ibase-param-info.php                      30-Sep-2022 11:00                3503
function.ibase-pconnect.php                        30-Sep-2022 11:00                7344
function.ibase-prepare.php                         30-Sep-2022 11:00                4021
function.ibase-query.php                           30-Sep-2022 11:00                6932
function.ibase-restore.php                         30-Sep-2022 11:00               10049
function.ibase-rollback-ret.php                    30-Sep-2022 11:00                3035
function.ibase-rollback.php                        30-Sep-2022 11:00                2840
function.ibase-server-info.php                     30-Sep-2022 11:00               10790
function.ibase-service-attach.php                  30-Sep-2022 11:00               12694
function.ibase-service-detach.php                  30-Sep-2022 11:00                6975
function.ibase-set-event-handler.php               30-Sep-2022 11:00                7734
function.ibase-trans.php                           30-Sep-2022 11:00                5427
function.ibase-wait-event.php                      30-Sep-2022 11:00                3908
function.iconv-get-encoding.php                    30-Sep-2022 11:00                5480
function.iconv-mime-decode-headers.php             30-Sep-2022 11:00               10330
function.iconv-mime-decode.php                     30-Sep-2022 11:00                8122
function.iconv-mime-encode.php                     30-Sep-2022 11:00               11610
function.iconv-set-encoding.php                    30-Sep-2022 11:00                4771
function.iconv-strlen.php                          30-Sep-2022 11:00                4697
function.iconv-strpos.php                          30-Sep-2022 11:00                6912
function.iconv-strrpos.php                         30-Sep-2022 11:00                6178
function.iconv-substr.php                          30-Sep-2022 11:00                7884
function.iconv.php                                 30-Sep-2022 11:00                8620
function.idate.php                                 30-Sep-2022 11:00               10730
function.idn-to-ascii.php                          30-Sep-2022 11:00                6851
function.idn-to-utf8.php                           30-Sep-2022 11:00                6839
function.igbinary-serialize.php                    30-Sep-2022 11:01                9579
function.igbinary-unserialize.php                  30-Sep-2022 11:01                9033
function.ignore-user-abort.php                     30-Sep-2022 11:01                7677
function.image-type-to-extension.php               30-Sep-2022 11:00                5099
function.image-type-to-mime-type.php               30-Sep-2022 11:00                7755
function.image2wbmp.php                            30-Sep-2022 11:00                6207
function.imageaffine.php                           30-Sep-2022 11:00                4430
function.imageaffinematrixconcat.php               30-Sep-2022 11:00                6460
function.imageaffinematrixget.php                  30-Sep-2022 11:00                5919
function.imagealphablending.php                    30-Sep-2022 11:00                7379
function.imageantialias.php                        30-Sep-2022 11:00               10936
function.imagearc.php                              30-Sep-2022 11:00               13658
function.imageavif.php                             30-Sep-2022 11:00                5491
function.imagebmp.php                              30-Sep-2022 11:00                7517
function.imagechar.php                             30-Sep-2022 11:00                9662
function.imagecharup.php                           30-Sep-2022 11:00                9557
function.imagecolorallocate.php                    30-Sep-2022 11:00                9715
function.imagecolorallocatealpha.php               30-Sep-2022 11:00               18370
function.imagecolorat.php                          30-Sep-2022 11:00               10017
function.imagecolorclosest.php                     30-Sep-2022 11:00               12360
function.imagecolorclosestalpha.php                30-Sep-2022 11:00               12915
function.imagecolorclosesthwb.php                  30-Sep-2022 11:00                6362
function.imagecolordeallocate.php                  30-Sep-2022 11:00                5678
function.imagecolorexact.php                       30-Sep-2022 11:00                8340
function.imagecolorexactalpha.php                  30-Sep-2022 11:00                9268
function.imagecolormatch.php                       30-Sep-2022 11:00                8523
function.imagecolorresolve.php                     30-Sep-2022 11:00                7479
function.imagecolorresolvealpha.php                30-Sep-2022 11:00                8175
function.imagecolorset.php                         30-Sep-2022 11:00                8547
function.imagecolorsforindex.php                   30-Sep-2022 11:00                7270
function.imagecolorstotal.php                      30-Sep-2022 11:00                5768
function.imagecolortransparent.php                 30-Sep-2022 11:00                9004
function.imageconvolution.php                      30-Sep-2022 11:00               11774
function.imagecopy.php                             30-Sep-2022 11:00                8998
function.imagecopymerge.php                        30-Sep-2022 11:00                9201
function.imagecopymergegray.php                    30-Sep-2022 11:00                9744
function.imagecopyresampled.php                    30-Sep-2022 11:00               19068
function.imagecopyresized.php                      30-Sep-2022 11:00               13665
function.imagecreate.php                           30-Sep-2022 11:00                8273
function.imagecreatefromavif.php                   30-Sep-2022 11:00                2726
function.imagecreatefrombmp.php                    30-Sep-2022 11:00                5445
function.imagecreatefromgd.php                     30-Sep-2022 11:00                6104
function.imagecreatefromgd2.php                    30-Sep-2022 11:00                6367
function.imagecreatefromgd2part.php                30-Sep-2022 11:00                8848
function.imagecreatefromgif.php                    30-Sep-2022 11:00               10238
function.imagecreatefromjpeg.php                   30-Sep-2022 11:00                9874
function.imagecreatefrompng.php                    30-Sep-2022 11:00                9818
function.imagecreatefromstring.php                 30-Sep-2022 11:00                8194
function.imagecreatefromtga.php                    30-Sep-2022 11:00                3367
function.imagecreatefromwbmp.php                   30-Sep-2022 11:00                9860
function.imagecreatefromwebp.php                   30-Sep-2022 11:00                5602
function.imagecreatefromxbm.php                    30-Sep-2022 11:00                5422
function.imagecreatefromxpm.php                    30-Sep-2022 11:00                6257
function.imagecreatetruecolor.php                  30-Sep-2022 11:00                7128
function.imagecrop.php                             30-Sep-2022 11:00                7685
function.imagecropauto.php                         30-Sep-2022 11:00               10610
function.imagedashedline.php                       30-Sep-2022 11:00               13387
function.imagedestroy.php                          30-Sep-2022 11:00                4963
function.imageellipse.php                          30-Sep-2022 11:00                9939
function.imagefill.php                             30-Sep-2022 11:00                7358
function.imagefilledarc.php                        30-Sep-2022 11:00               18429
function.imagefilledellipse.php                    30-Sep-2022 11:00                9590
function.imagefilledpolygon.php                    30-Sep-2022 11:00               12479
function.imagefilledrectangle.php                  30-Sep-2022 11:00                8077
function.imagefilltoborder.php                     30-Sep-2022 11:00               11162
function.imagefilter.php                           30-Sep-2022 11:00               33714
function.imageflip.php                             30-Sep-2022 11:00                9390
function.imagefontheight.php                       30-Sep-2022 11:00                6326
function.imagefontwidth.php                        30-Sep-2022 11:00                6279
function.imageftbbox.php                           30-Sep-2022 11:00               14199
function.imagefttext.php                           30-Sep-2022 11:00               15629
function.imagegammacorrect.php                     30-Sep-2022 11:00                5734
function.imagegd.php                               30-Sep-2022 11:00               10624
function.imagegd2.php                              30-Sep-2022 11:00               11213
function.imagegetclip.php                          30-Sep-2022 11:00                5983
function.imagegetinterpolation.php                 30-Sep-2022 11:00                3606
function.imagegif.php                              30-Sep-2022 11:00               17103
function.imagegrabscreen.php                       30-Sep-2022 11:00                4673
function.imagegrabwindow.php                       30-Sep-2022 11:00                9656
function.imageinterlace.php                        30-Sep-2022 11:00                6524
function.imageistruecolor.php                      30-Sep-2022 11:00                7594
function.imagejpeg.php                             30-Sep-2022 11:00               15086
function.imagelayereffect.php                      30-Sep-2022 11:00               11506
function.imageline.php                             30-Sep-2022 11:00               16233
function.imageloadfont.php                         30-Sep-2022 11:00                9427
function.imageopenpolygon.php                      30-Sep-2022 11:00               10309
function.imagepalettecopy.php                      30-Sep-2022 11:00                7710
function.imagepalettetotruecolor.php               30-Sep-2022 11:00               10266
function.imagepng.php                              30-Sep-2022 11:00                8231
function.imagepolygon.php                          30-Sep-2022 11:00               10608
function.imagerectangle.php                        30-Sep-2022 11:00               10402
function.imageresolution.php                       30-Sep-2022 11:00                7234
function.imagerotate.php                           30-Sep-2022 11:00                9155
function.imagesavealpha.php                        30-Sep-2022 11:00                6623
function.imagescale.php                            30-Sep-2022 11:00                6119
function.imagesetbrush.php                         30-Sep-2022 11:00                9235
function.imagesetclip.php                          30-Sep-2022 11:00                4834
function.imagesetinterpolation.php                 30-Sep-2022 11:00               10206
function.imagesetpixel.php                         30-Sep-2022 11:00               11516
function.imagesetstyle.php                         30-Sep-2022 11:00               12403
function.imagesetthickness.php                     30-Sep-2022 11:00                8418
function.imagesettile.php                          30-Sep-2022 11:00                8306
function.imagestring.php                           30-Sep-2022 11:00                9922
function.imagestringup.php                         30-Sep-2022 11:00                9024
function.imagesx.php                               30-Sep-2022 11:00                5064
function.imagesy.php                               30-Sep-2022 11:00                5086
function.imagetruecolortopalette.php               30-Sep-2022 11:00                6645
function.imagettfbbox.php                          30-Sep-2022 11:00               20064
function.imagettftext.php                          30-Sep-2022 11:00               18152
function.imagetypes.php                            30-Sep-2022 11:00                4509
function.imagewbmp.php                             30-Sep-2022 11:00               15219
function.imagewebp.php                             30-Sep-2022 11:00                7074
function.imagexbm.php                              30-Sep-2022 11:00               11737
function.imap-8bit.php                             30-Sep-2022 11:00                2939
function.imap-alerts.php                           30-Sep-2022 11:00                3094
function.imap-append.php                           30-Sep-2022 11:00                9803
function.imap-base64.php                           30-Sep-2022 11:00                3335
function.imap-binary.php                           30-Sep-2022 11:00                2902
function.imap-body.php                             30-Sep-2022 11:00                5153
function.imap-bodystruct.php                       30-Sep-2022 11:00                4456
function.imap-check.php                            30-Sep-2022 11:00                5883
function.imap-clearflag-full.php                   30-Sep-2022 11:00                5417
function.imap-close.php                            30-Sep-2022 11:00                4049
function.imap-create.php                           30-Sep-2022 11:00                1717
function.imap-createmailbox.php                    30-Sep-2022 11:00               15522
function.imap-delete.php                           30-Sep-2022 11:00                9621
function.imap-deletemailbox.php                    30-Sep-2022 11:00                4714
function.imap-errors.php                           30-Sep-2022 11:00                3296
function.imap-expunge.php                          30-Sep-2022 11:00                3440
function.imap-fetch-overview.php                   30-Sep-2022 11:00               11190
function.imap-fetchbody.php                        30-Sep-2022 11:00                5723
function.imap-fetchheader.php                      30-Sep-2022 11:00                5407
function.imap-fetchmime.php                        30-Sep-2022 11:00                5927
function.imap-fetchstructure.php                   30-Sep-2022 11:00                9120
function.imap-fetchtext.php                        30-Sep-2022 11:00                1698
function.imap-gc.php                               30-Sep-2022 11:00                4833
function.imap-get-quota.php                        30-Sep-2022 11:00               12623
function.imap-get-quotaroot.php                    30-Sep-2022 11:00                9367
function.imap-getacl.php                           30-Sep-2022 11:00                5655
function.imap-getmailboxes.php                     30-Sep-2022 11:00               11973
function.imap-getsubscribed.php                    30-Sep-2022 11:00                7207
function.imap-header.php                           30-Sep-2022 11:00                1922
function.imap-headerinfo.php                       30-Sep-2022 11:00               11473
function.imap-headers.php                          30-Sep-2022 11:00                3308
function.imap-last-error.php                       30-Sep-2022 11:00                3008
function.imap-list.php                             30-Sep-2022 11:00                8717
function.imap-listmailbox.php                      30-Sep-2022 11:00                1703
function.imap-listscan.php                         30-Sep-2022 11:00                6631
function.imap-listsubscribed.php                   30-Sep-2022 11:00                1724
function.imap-lsub.php                             30-Sep-2022 11:00                5732
function.imap-mail-compose.php                     30-Sep-2022 11:00               14661
function.imap-mail-copy.php                        30-Sep-2022 11:00                5803
function.imap-mail-move.php                        30-Sep-2022 11:00                6250
function.imap-mail.php                             30-Sep-2022 11:00                6497
function.imap-mailboxmsginfo.php                   30-Sep-2022 11:00               10068
function.imap-mime-header-decode.php               30-Sep-2022 11:00                6359
function.imap-msgno.php                            30-Sep-2022 11:00                4026
function.imap-mutf7-to-utf8.php                    30-Sep-2022 11:00                3124
function.imap-num-msg.php                          30-Sep-2022 11:00                3874
function.imap-num-recent.php                       30-Sep-2022 11:00                3759
function.imap-open.php                             30-Sep-2022 11:00               21989
function.imap-ping.php                             30-Sep-2022 11:00                4796
function.imap-qprint.php                           30-Sep-2022 11:00                2948
function.imap-rename.php                           30-Sep-2022 11:00                1720
function.imap-renamemailbox.php                    30-Sep-2022 11:00                5301
function.imap-reopen.php                           30-Sep-2022 11:00                8223
function.imap-rfc822-parse-adrlist.php             30-Sep-2022 11:00                8127
function.imap-rfc822-parse-headers.php             30-Sep-2022 11:00                3568
function.imap-rfc822-write-address.php             30-Sep-2022 11:00                5065
function.imap-savebody.php                         30-Sep-2022 11:00                5892
function.imap-scan.php                             30-Sep-2022 11:00                1685
function.imap-scanmailbox.php                      30-Sep-2022 11:00                1715
function.imap-search.php                           30-Sep-2022 11:00               13251
function.imap-set-quota.php                        30-Sep-2022 11:00                6551
function.imap-setacl.php                           30-Sep-2022 11:00                5128
function.imap-setflag-full.php                     30-Sep-2022 11:00                7719
function.imap-sort.php                             30-Sep-2022 11:00                7369
function.imap-status.php                           30-Sep-2022 11:00               10711
function.imap-subscribe.php                        30-Sep-2022 11:00                4192
function.imap-thread.php                           30-Sep-2022 11:00                7921
function.imap-timeout.php                          30-Sep-2022 11:00                4236
function.imap-uid.php                              30-Sep-2022 11:00                4410
function.imap-undelete.php                         30-Sep-2022 11:00                4732
function.imap-unsubscribe.php                      30-Sep-2022 11:00                4269
function.imap-utf7-decode.php                      30-Sep-2022 11:00                3536
function.imap-utf7-encode.php                      30-Sep-2022 11:00                3131
function.imap-utf8-to-mutf7.php                    30-Sep-2022 11:00                3127
function.imap-utf8.php                             30-Sep-2022 11:00                4113
function.implode.php                               30-Sep-2022 11:01                7436
function.in-array.php                              30-Sep-2022 11:01               11742
function.include-once.php                          30-Sep-2022 11:00                2218
function.include.php                               30-Sep-2022 11:00               20780
function.inet-ntop.php                             30-Sep-2022 11:01                6251
function.inet-pton.php                             30-Sep-2022 11:01                4719
function.inflate-add.php                           30-Sep-2022 11:00                5361
function.inflate-get-read-len.php                  30-Sep-2022 11:00                3236
function.inflate-get-status.php                    30-Sep-2022 11:00                3145
function.inflate-init.php                          30-Sep-2022 11:00                6410
function.ini-alter.php                             30-Sep-2022 11:00                1652
function.ini-get-all.php                           30-Sep-2022 11:00                9681
function.ini-get.php                               30-Sep-2022 11:00               10987
function.ini-restore.php                           30-Sep-2022 11:00                6467
function.ini-set.php                               30-Sep-2022 11:00                6243
function.inotify-add-watch.php                     30-Sep-2022 11:00                3908
function.inotify-init.php                          30-Sep-2022 11:00                9287
function.inotify-queue-len.php                     30-Sep-2022 11:00                3719
function.inotify-read.php                          30-Sep-2022 11:00                4340
function.inotify-rm-watch.php                      30-Sep-2022 11:00                3376
function.intdiv.php                                30-Sep-2022 11:00                7288
function.interface-exists.php                      30-Sep-2022 11:01                5288
function.intl-error-name.php                       30-Sep-2022 11:00                5036
function.intl-get-error-code.php                   30-Sep-2022 11:00                4581
function.intl-get-error-message.php                30-Sep-2022 11:00                4580
function.intl-is-failure.php                       30-Sep-2022 11:00                5482
function.intval.php                                30-Sep-2022 11:01               13874
function.ip2long.php                               30-Sep-2022 11:01                9479
function.iptcembed.php                             30-Sep-2022 11:00               12691
function.iptcparse.php                             30-Sep-2022 11:00                4492
function.is-a.php                                  30-Sep-2022 11:01                6706
function.is-array.php                              30-Sep-2022 11:01                5674
function.is-bool.php                               30-Sep-2022 11:01                5670
function.is-callable.php                           30-Sep-2022 11:01               11017
function.is-countable.php                          30-Sep-2022 11:01                6272
function.is-dir.php                                30-Sep-2022 11:00                6334
function.is-double.php                             30-Sep-2022 11:01                1656
function.is-executable.php                         30-Sep-2022 11:00                6230
function.is-file.php                               30-Sep-2022 11:00                5739
function.is-finite.php                             30-Sep-2022 11:00                3029
function.is-float.php                              30-Sep-2022 11:01                5059
function.is-infinite.php                           30-Sep-2022 11:00                3116
function.is-int.php                                30-Sep-2022 11:01                6617
function.is-integer.php                            30-Sep-2022 11:01                1649
function.is-iterable.php                           30-Sep-2022 11:01                5771
function.is-link.php                               30-Sep-2022 11:00                5471
function.is-long.php                               30-Sep-2022 11:01                1630
function.is-nan.php                                30-Sep-2022 11:00                4443
function.is-null.php                               30-Sep-2022 11:01                5826
function.is-numeric.php                            30-Sep-2022 11:01               12747
function.is-object.php                             30-Sep-2022 11:01                7228
function.is-readable.php                           30-Sep-2022 11:00                6019
function.is-real.php                               30-Sep-2022 11:01                1855
function.is-resource.php                           30-Sep-2022 11:01                4913
function.is-scalar.php                             30-Sep-2022 11:01                7827
function.is-soap-fault.php                         30-Sep-2022 11:01                8245
function.is-string.php                             30-Sep-2022 11:01                6732
function.is-subclass-of.php                        30-Sep-2022 11:01               13166
function.is-tainted.php                            30-Sep-2022 11:01                2222
function.is-uploaded-file.php                      30-Sep-2022 11:00                6702
function.is-writable.php                           30-Sep-2022 11:00                5762
function.is-writeable.php                          30-Sep-2022 11:00                1698
function.isset.php                                 30-Sep-2022 11:01               16587
function.iterator-apply.php                        30-Sep-2022 11:01                6569
function.iterator-count.php                        30-Sep-2022 11:01                7821
function.iterator-to-array.php                     30-Sep-2022 11:01                6259
function.jddayofweek.php                           30-Sep-2022 11:00                3513
function.jdmonthname.php                           30-Sep-2022 11:00                4411
function.jdtofrench.php                            30-Sep-2022 11:00                3014
function.jdtogregorian.php                         30-Sep-2022 11:00                3045
function.jdtojewish.php                            30-Sep-2022 11:00                7058
function.jdtojulian.php                            30-Sep-2022 11:00                3023
function.jdtounix.php                              30-Sep-2022 11:00                4219
function.jewishtojd.php                            30-Sep-2022 11:00                4407
function.join.php                                  30-Sep-2022 11:01                1607
function.jpeg2wbmp.php                             30-Sep-2022 11:00                6312
function.json-decode.php                           30-Sep-2022 11:01               19989
function.json-encode.php                           30-Sep-2022 11:01               30044
function.json-last-error-msg.php                   30-Sep-2022 11:01                2928
function.json-last-error.php                       30-Sep-2022 11:01               14739
function.juliantojd.php                            30-Sep-2022 11:00                4249
function.key-exists.php                            30-Sep-2022 11:01                1683
function.key.php                                   30-Sep-2022 11:01                7376
function.krsort.php                                30-Sep-2022 11:01                7553
function.ksort.php                                 30-Sep-2022 11:01                9484
function.lcfirst.php                               30-Sep-2022 11:01                5501
function.lcg-value.php                             30-Sep-2022 11:00                3427
function.lchgrp.php                                30-Sep-2022 11:00                5643
function.lchown.php                                30-Sep-2022 11:00                5499
function.ldap-8859-to-t61.php                      30-Sep-2022 11:01                3161
function.ldap-add-ext.php                          30-Sep-2022 11:01                5386
function.ldap-add.php                              30-Sep-2022 11:01               10498
function.ldap-bind-ext.php                         30-Sep-2022 11:01                5423
function.ldap-bind.php                             30-Sep-2022 11:01                9911
function.ldap-close.php                            30-Sep-2022 11:01                1668
function.ldap-compare.php                          30-Sep-2022 11:01               10859
function.ldap-connect.php                          30-Sep-2022 11:01                9567
function.ldap-control-paged-result-response.php    30-Sep-2022 11:01                5522
function.ldap-control-paged-result.php             30-Sep-2022 11:01               15652
function.ldap-count-entries.php                    30-Sep-2022 11:01                5831
function.ldap-count-references.php                 30-Sep-2022 11:01                4610
function.ldap-delete-ext.php                       30-Sep-2022 11:01                4990
function.ldap-delete.php                           30-Sep-2022 11:01                4938
function.ldap-dn2ufn.php                           30-Sep-2022 11:01                2531
function.ldap-err2str.php                          30-Sep-2022 11:01                4623
function.ldap-errno.php                            30-Sep-2022 11:01                7805
function.ldap-error.php                            30-Sep-2022 11:01                4432
function.ldap-escape.php                           30-Sep-2022 11:01                6340
function.ldap-exop-passwd.php                      30-Sep-2022 11:01               10655
function.ldap-exop-refresh.php                     30-Sep-2022 11:01                4881
function.ldap-exop-whoami.php                      30-Sep-2022 11:01                3765
function.ldap-exop.php                             30-Sep-2022 11:01               12463
function.ldap-explode-dn.php                       30-Sep-2022 11:01                3385
function.ldap-first-attribute.php                  30-Sep-2022 11:01                5946
function.ldap-first-entry.php                      30-Sep-2022 11:01                5682
function.ldap-first-reference.php                  30-Sep-2022 11:01                2350
function.ldap-free-result.php                      30-Sep-2022 11:01                3884
function.ldap-get-attributes.php                   30-Sep-2022 11:01                8495
function.ldap-get-dn.php                           30-Sep-2022 11:01                4120
function.ldap-get-entries.php                      30-Sep-2022 11:01                5923
function.ldap-get-option.php                       30-Sep-2022 11:01               12677
function.ldap-get-values-len.php                   30-Sep-2022 11:01                5280
function.ldap-get-values.php                       30-Sep-2022 11:01                8837
function.ldap-list.php                             30-Sep-2022 11:01               14417
function.ldap-mod-add.php                          30-Sep-2022 11:01                6397
function.ldap-mod-del.php                          30-Sep-2022 11:01                5962
function.ldap-mod-replace.php                      30-Sep-2022 11:01                6342
function.ldap-mod_add-ext.php                      30-Sep-2022 11:01                5401
function.ldap-mod_del-ext.php                      30-Sep-2022 11:01                5417
function.ldap-mod_replace-ext.php                  30-Sep-2022 11:01                5479
function.ldap-modify-batch.php                     30-Sep-2022 11:01               20666
function.ldap-modify.php                           30-Sep-2022 11:01                2085
function.ldap-next-attribute.php                   30-Sep-2022 11:01                5406
function.ldap-next-entry.php                       30-Sep-2022 11:01                5738
function.ldap-next-reference.php                   30-Sep-2022 11:01                2320
function.ldap-parse-exop.php                       30-Sep-2022 11:01                5520
function.ldap-parse-reference.php                  30-Sep-2022 11:01                2328
function.ldap-parse-result.php                     30-Sep-2022 11:01                9193
function.ldap-read.php                             30-Sep-2022 11:01               11534
function.ldap-rename-ext.php                       30-Sep-2022 11:01                5630
function.ldap-rename.php                           30-Sep-2022 11:01                6612
function.ldap-sasl-bind.php                        30-Sep-2022 11:01                5862
function.ldap-search.php                           30-Sep-2022 11:01               14628
function.ldap-set-option.php                       30-Sep-2022 11:01               15625
function.ldap-set-rebind-proc.php                  30-Sep-2022 11:01                3088
function.ldap-sort.php                             30-Sep-2022 11:01                7436
function.ldap-start-tls.php                        30-Sep-2022 11:01                1957
function.ldap-t61-to-8859.php                      30-Sep-2022 11:01                2022
function.ldap-unbind.php                           30-Sep-2022 11:01                3641
function.levenshtein.php                           30-Sep-2022 11:01               13178
function.libxml-clear-errors.php                   30-Sep-2022 11:01                2822
function.libxml-disable-entity-loader.php          30-Sep-2022 11:01                4605
function.libxml-get-errors.php                     30-Sep-2022 11:01               11951
function.libxml-get-last-error.php                 30-Sep-2022 11:01                3107
function.libxml-set-external-entity-loader.php     30-Sep-2022 11:01                9921
function.libxml-set-streams-context.php            30-Sep-2022 11:01                5144
function.libxml-use-internal-errors.php            30-Sep-2022 11:01                6510
function.link.php                                  30-Sep-2022 11:00                5691
function.linkinfo.php                              30-Sep-2022 11:00                4380
function.list.php                                  30-Sep-2022 11:01               17551
function.localeconv.php                            30-Sep-2022 11:01                9186
function.localtime.php                             30-Sep-2022 11:00                8719
function.log.php                                   30-Sep-2022 11:00                3640
function.log10.php                                 30-Sep-2022 11:00                2570
function.log1p.php                                 30-Sep-2022 11:00                3364
function.long2ip.php                               30-Sep-2022 11:01                4070
function.lstat.php                                 30-Sep-2022 11:00                6257
function.ltrim.php                                 30-Sep-2022 11:01                9631
function.lzf-compress.php                          30-Sep-2022 11:00                2788
function.lzf-decompress.php                        30-Sep-2022 11:00                2877
function.lzf-optimized-for.php                     30-Sep-2022 11:00                2158
function.mail.php                                  30-Sep-2022 11:00               26926
function.mailparse-determine-best-xfer-encoding..> 30-Sep-2022 11:00                4172
function.mailparse-msg-create.php                  30-Sep-2022 11:00                3318
function.mailparse-msg-extract-part-file.php       30-Sep-2022 11:00                5030
function.mailparse-msg-extract-part.php            30-Sep-2022 11:00                3981
function.mailparse-msg-extract-whole-part-file.php 30-Sep-2022 11:00                3973
function.mailparse-msg-free.php                    30-Sep-2022 11:00                3417
function.mailparse-msg-get-part-data.php           30-Sep-2022 11:00                2441
function.mailparse-msg-get-part.php                30-Sep-2022 11:00                2662
function.mailparse-msg-get-structure.php           30-Sep-2022 11:00                2461
function.mailparse-msg-parse-file.php              30-Sep-2022 11:00                4085
function.mailparse-msg-parse.php                   30-Sep-2022 11:00                3250
function.mailparse-rfc822-parse-addresses.php      30-Sep-2022 11:00                5450
function.mailparse-stream-encode.php               30-Sep-2022 11:00                5634
function.mailparse-uudecode-all.php                30-Sep-2022 11:00                6881
function.max.php                                   30-Sep-2022 11:00               12862
function.mb-check-encoding.php                     30-Sep-2022 11:00                4658
function.mb-chr.php                                30-Sep-2022 11:00                6800
function.mb-convert-case.php                       30-Sep-2022 11:00               11159
function.mb-convert-encoding.php                   30-Sep-2022 11:00               10436
function.mb-convert-kana.php                       30-Sep-2022 11:00                9121
function.mb-convert-variables.php                  30-Sep-2022 11:00                6372
function.mb-decode-mimeheader.php                  30-Sep-2022 11:00                2991
function.mb-decode-numericentity.php               30-Sep-2022 11:00               36146
function.mb-detect-encoding.php                    30-Sep-2022 11:00               15412
function.mb-detect-order.php                       30-Sep-2022 11:00                8593
function.mb-encode-mimeheader.php                  30-Sep-2022 11:00                9395
function.mb-encode-numericentity.php               30-Sep-2022 11:00               13122
function.mb-encoding-aliases.php                   30-Sep-2022 11:00                5628
function.mb-ereg-match.php                         30-Sep-2022 11:00                5167
function.mb-ereg-replace-callback.php              30-Sep-2022 11:00               12875
function.mb-ereg-replace.php                       30-Sep-2022 11:00                6581
function.mb-ereg-search-getpos.php                 30-Sep-2022 11:00                3835
function.mb-ereg-search-getregs.php                30-Sep-2022 11:00                4178
function.mb-ereg-search-init.php                   30-Sep-2022 11:00                5669
function.mb-ereg-search-pos.php                    30-Sep-2022 11:00                5567
function.mb-ereg-search-regs.php                   30-Sep-2022 11:00                5319
function.mb-ereg-search-setpos.php                 30-Sep-2022 11:00                4345
function.mb-ereg-search.php                        30-Sep-2022 11:00                5232
function.mb-ereg.php                               30-Sep-2022 11:00                6067
function.mb-eregi-replace.php                      30-Sep-2022 11:00                6465
function.mb-eregi.php                              30-Sep-2022 11:00                6111
function.mb-get-info.php                           30-Sep-2022 11:00                5861
function.mb-http-input.php                         30-Sep-2022 11:00                4668
function.mb-http-output.php                        30-Sep-2022 11:00                4623
function.mb-internal-encoding.php                  30-Sep-2022 11:00                6664
function.mb-language.php                           30-Sep-2022 11:00                6123
function.mb-list-encodings.php                     30-Sep-2022 11:00                5002
function.mb-ord.php                                30-Sep-2022 11:00                6448
function.mb-output-handler.php                     30-Sep-2022 11:00                5026
function.mb-parse-str.php                          30-Sep-2022 11:00                4297
function.mb-preferred-mime-name.php                30-Sep-2022 11:00                4267
function.mb-regex-encoding.php                     30-Sep-2022 11:00                4205
function.mb-regex-set-options.php                  30-Sep-2022 11:00                6918
function.mb-scrub.php                              30-Sep-2022 11:00                3129
function.mb-send-mail.php                          30-Sep-2022 11:00                9181
function.mb-split.php                              30-Sep-2022 11:00                4362
function.mb-str-split.php                          30-Sep-2022 11:00                4945
function.mb-strcut.php                             30-Sep-2022 11:00                7107
function.mb-strimwidth.php                         30-Sep-2022 11:00                7049
function.mb-stripos.php                            30-Sep-2022 11:00                6035
function.mb-stristr.php                            30-Sep-2022 11:00                6145
function.mb-strlen.php                             30-Sep-2022 11:00                4694
function.mb-strpos.php                             30-Sep-2022 11:00                5885
function.mb-strrchr.php                            30-Sep-2022 11:00                5993
function.mb-strrichr.php                           30-Sep-2022 11:00                6033
function.mb-strripos.php                           30-Sep-2022 11:00                5950
function.mb-strrpos.php                            30-Sep-2022 11:00                6159
function.mb-strstr.php                             30-Sep-2022 11:00                5950
function.mb-strtolower.php                         30-Sep-2022 11:00                7131
function.mb-strtoupper.php                         30-Sep-2022 11:00                7136
function.mb-strwidth.php                           30-Sep-2022 11:00                8849
function.mb-substitute-character.php               30-Sep-2022 11:00                6691
function.mb-substr-count.php                       30-Sep-2022 11:00                5648
function.mb-substr.php                             30-Sep-2022 11:00                6099
function.mcrypt-create-iv.php                      30-Sep-2022 11:00                6517
function.mcrypt-decrypt.php                        30-Sep-2022 11:00                5412
function.mcrypt-enc-get-algorithms-name.php        30-Sep-2022 11:00                5281
function.mcrypt-enc-get-block-size.php             30-Sep-2022 11:00                2916
function.mcrypt-enc-get-iv-size.php                30-Sep-2022 11:00                3041
function.mcrypt-enc-get-key-size.php               30-Sep-2022 11:00                2920
function.mcrypt-enc-get-modes-name.php             30-Sep-2022 11:00                5193
function.mcrypt-enc-get-supported-key-sizes.php    30-Sep-2022 11:00                4962
function.mcrypt-enc-is-block-algorithm-mode.php    30-Sep-2022 11:00                3283
function.mcrypt-enc-is-block-algorithm.php         30-Sep-2022 11:00                3107
function.mcrypt-enc-is-block-mode.php              30-Sep-2022 11:00                3111
function.mcrypt-enc-self-test.php                  30-Sep-2022 11:00                2944
function.mcrypt-encrypt.php                        30-Sep-2022 11:00               15713
function.mcrypt-generic-deinit.php                 30-Sep-2022 11:00                3855
function.mcrypt-generic-init.php                   30-Sep-2022 11:00                4992
function.mcrypt-generic.php                        30-Sep-2022 11:00                5766
function.mcrypt-get-block-size.php                 30-Sep-2022 11:00                6365
function.mcrypt-get-cipher-name.php                30-Sep-2022 11:00                4759
function.mcrypt-get-iv-size.php                    30-Sep-2022 11:00                6414
function.mcrypt-get-key-size.php                   30-Sep-2022 11:00                6506
function.mcrypt-list-algorithms.php                30-Sep-2022 11:00                4689
function.mcrypt-list-modes.php                     30-Sep-2022 11:00                4712
function.mcrypt-module-close.php                   30-Sep-2022 11:00                3276
function.mcrypt-module-get-algo-block-size.php     30-Sep-2022 11:00                3380
function.mcrypt-module-get-algo-key-size.php       30-Sep-2022 11:00                3447
function.mcrypt-module-get-supported-key-sizes.php 30-Sep-2022 11:00                4530
function.mcrypt-module-is-block-algorithm-mode.php 30-Sep-2022 11:00                3960
function.mcrypt-module-is-block-algorithm.php      30-Sep-2022 11:00                3707
function.mcrypt-module-is-block-mode.php           30-Sep-2022 11:00                3991
function.mcrypt-module-open.php                    30-Sep-2022 11:00               14853
function.mcrypt-module-self-test.php               30-Sep-2022 11:00                4807
function.md5-file.php                              30-Sep-2022 11:01                4985
function.md5.php                                   30-Sep-2022 11:01                5869
function.mdecrypt-generic.php                      30-Sep-2022 11:00               11866
function.memcache-debug.php                        30-Sep-2022 11:01                3196
function.memory-get-peak-usage.php                 30-Sep-2022 11:00                3457
function.memory-get-usage.php                      30-Sep-2022 11:00                5476
function.memory-reset-peak-usage.php               30-Sep-2022 11:00                4949
function.metaphone.php                             30-Sep-2022 11:01                7997
function.method-exists.php                         30-Sep-2022 11:01                6256
function.mhash-count.php                           30-Sep-2022 11:00                4745
function.mhash-get-block-size.php                  30-Sep-2022 11:00                4395
function.mhash-get-hash-name.php                   30-Sep-2022 11:00                4348
function.mhash-keygen-s2k.php                      30-Sep-2022 11:00                5337
function.mhash.php                                 30-Sep-2022 11:00                4460
function.microtime.php                             30-Sep-2022 11:00                7809
function.mime-content-type.php                     30-Sep-2022 11:00                4767
function.min.php                                   30-Sep-2022 11:00               13485
function.mkdir.php                                 30-Sep-2022 11:00                9133
function.mktime.php                                30-Sep-2022 11:00               18433
function.money-format.php                          30-Sep-2022 11:01               19078
function.mongodb.bson-fromjson.php                 30-Sep-2022 11:00                5836
function.mongodb.bson-fromphp.php                  30-Sep-2022 11:00                5819
function.mongodb.bson-tocanonicalextendedjson.php  30-Sep-2022 11:00               16219
function.mongodb.bson-tojson.php                   30-Sep-2022 11:00               17705
function.mongodb.bson-tophp.php                    30-Sep-2022 11:00                8724
function.mongodb.bson-torelaxedextendedjson.php    30-Sep-2022 11:00               15918
function.mongodb.driver.monitoring.addsubscribe..> 30-Sep-2022 11:00                5110
function.mongodb.driver.monitoring.removesubscr..> 30-Sep-2022 11:00                4967
function.move-uploaded-file.php                    30-Sep-2022 11:00                8596
function.mqseries-back.php                         30-Sep-2022 11:01                6448
function.mqseries-begin.php                        30-Sep-2022 11:01                7922
function.mqseries-close.php                        30-Sep-2022 11:01                6532
function.mqseries-cmit.php                         30-Sep-2022 11:01                6395
function.mqseries-conn.php                         30-Sep-2022 11:01                5920
function.mqseries-connx.php                        30-Sep-2022 11:01               14353
function.mqseries-disc.php                         30-Sep-2022 11:01                5648
function.mqseries-get.php                          30-Sep-2022 11:01               13134
function.mqseries-inq.php                          30-Sep-2022 11:01                9173
function.mqseries-open.php                         30-Sep-2022 11:01                7644
function.mqseries-put.php                          30-Sep-2022 11:01               14111
function.mqseries-put1.php                         30-Sep-2022 11:01                5905
function.mqseries-set.php                          30-Sep-2022 11:01                5642
function.mqseries-strerror.php                     30-Sep-2022 11:01                4300
function.msg-get-queue.php                         30-Sep-2022 11:01                5443
function.msg-queue-exists.php                      30-Sep-2022 11:01                3214
function.msg-receive.php                           30-Sep-2022 11:01               10496
function.msg-remove-queue.php                      30-Sep-2022 11:01                4415
function.msg-send.php                              30-Sep-2022 11:01                8278
function.msg-set-queue.php                         30-Sep-2022 11:01                5019
function.msg-stat-queue.php                        30-Sep-2022 11:01                6485
function.mt-getrandmax.php                         30-Sep-2022 11:00                5443
function.mt-rand.php                               30-Sep-2022 11:00                9932
function.mt-srand.php                              30-Sep-2022 11:00                7847
function.mysql-affected-rows.php                   30-Sep-2022 11:00               12200
function.mysql-client-encoding.php                 30-Sep-2022 11:00                6030
function.mysql-close.php                           30-Sep-2022 11:00                7093
function.mysql-connect.php                         30-Sep-2022 11:00               16955
function.mysql-create-db.php                       30-Sep-2022 11:00                8261
function.mysql-data-seek.php                       30-Sep-2022 11:00               12104
function.mysql-db-name.php                         30-Sep-2022 11:00                7627
function.mysql-db-query.php                        30-Sep-2022 11:00                9852
function.mysql-drop-db.php                         30-Sep-2022 11:00                7557
function.mysql-errno.php                           30-Sep-2022 11:00                8128
function.mysql-error.php                           30-Sep-2022 11:00                8032
function.mysql-escape-string.php                   30-Sep-2022 11:00                6722
function.mysql-fetch-array.php                     30-Sep-2022 11:00               15365
function.mysql-fetch-assoc.php                     30-Sep-2022 11:00               11931
function.mysql-fetch-field.php                     30-Sep-2022 11:00               13361
function.mysql-fetch-lengths.php                   30-Sep-2022 11:00                7459
function.mysql-fetch-object.php                    30-Sep-2022 11:00               11419
function.mysql-fetch-row.php                       30-Sep-2022 11:00                7508
function.mysql-field-flags.php                     30-Sep-2022 11:00                8342
function.mysql-field-len.php                       30-Sep-2022 11:00                6852
function.mysql-field-name.php                      30-Sep-2022 11:00                9016
function.mysql-field-seek.php                      30-Sep-2022 11:00                4688
function.mysql-field-table.php                     30-Sep-2022 11:00                7633
function.mysql-field-type.php                      30-Sep-2022 11:00               11863
function.mysql-free-result.php                     30-Sep-2022 11:00                7600
function.mysql-get-client-info.php                 30-Sep-2022 11:00                4893
function.mysql-get-host-info.php                   30-Sep-2022 11:00                6603
function.mysql-get-proto-info.php                  30-Sep-2022 11:00                6330
function.mysql-get-server-info.php                 30-Sep-2022 11:00                6679
function.mysql-info.php                            30-Sep-2022 11:00                5944
function.mysql-insert-id.php                       30-Sep-2022 11:00                8062
function.mysql-list-dbs.php                        30-Sep-2022 11:00                8569
function.mysql-list-fields.php                     30-Sep-2022 11:00                8628
function.mysql-list-processes.php                  30-Sep-2022 11:00                7338
function.mysql-list-tables.php                     30-Sep-2022 11:00                9419
function.mysql-num-fields.php                      30-Sep-2022 11:00                6445
function.mysql-num-rows.php                        30-Sep-2022 11:00                7890
function.mysql-pconnect.php                        30-Sep-2022 11:00                7703
function.mysql-ping.php                            30-Sep-2022 11:00                7926
function.mysql-query.php                           30-Sep-2022 11:00               14241
function.mysql-real-escape-string.php              30-Sep-2022 11:00               16331
function.mysql-result.php                          30-Sep-2022 11:00                9583
function.mysql-select-db.php                       30-Sep-2022 11:00                7498
function.mysql-set-charset.php                     30-Sep-2022 11:00                5506
function.mysql-stat.php                            30-Sep-2022 11:00                9000
function.mysql-tablename.php                       30-Sep-2022 11:00                7890
function.mysql-thread-id.php                       30-Sep-2022 11:00                6352
function.mysql-unbuffered-query.php                30-Sep-2022 11:00                6616
function.mysql-xdevapi-expression.php              30-Sep-2022 11:00                4772
function.mysql-xdevapi-getsession.php              30-Sep-2022 11:00               13198
function.mysqli-connect.php                        30-Sep-2022 11:00                2260
function.mysqli-escape-string.php                  30-Sep-2022 11:00                1911
function.mysqli-execute.php                        30-Sep-2022 11:00                2476
function.mysqli-get-client-stats.php               30-Sep-2022 11:00                8255
function.mysqli-get-links-stats.php                30-Sep-2022 11:00                3142
function.mysqli-report.php                         30-Sep-2022 11:00                1713
function.mysqli-set-opt.php                        30-Sep-2022 11:00                1800
function.natcasesort.php                           30-Sep-2022 11:01                7005
function.natsort.php                               30-Sep-2022 11:01               10306
function.net-get-interfaces.php                    30-Sep-2022 11:01                4466
function.next.php                                  30-Sep-2022 11:01                8793
function.ngettext.php                              30-Sep-2022 11:00                5657
function.nl-langinfo.php                           30-Sep-2022 11:01               14898
function.nl2br.php                                 30-Sep-2022 11:01                6689
function.number-format.php                         30-Sep-2022 11:01                8549
function.oauth-get-sbs.php                         30-Sep-2022 11:01                2901
function.oauth-urlencode.php                       30-Sep-2022 11:01                2452
function.ob-clean.php                              30-Sep-2022 11:00                3486
function.ob-end-clean.php                          30-Sep-2022 11:00                5182
function.ob-end-flush.php                          30-Sep-2022 11:00                5946
function.ob-flush.php                              30-Sep-2022 11:00                3701
function.ob-get-clean.php                          30-Sep-2022 11:00                5301
function.ob-get-contents.php                       30-Sep-2022 11:00                4667
function.ob-get-flush.php                          30-Sep-2022 11:00                5650
function.ob-get-length.php                         30-Sep-2022 11:00                4631
function.ob-get-level.php                          30-Sep-2022 11:00                2765
function.ob-get-status.php                         30-Sep-2022 11:00                6777
function.ob-gzhandler.php                          30-Sep-2022 11:00                5697
function.ob-iconv-handler.php                      30-Sep-2022 11:00                5012
function.ob-implicit-flush.php                     30-Sep-2022 11:00                4142
function.ob-list-handlers.php                      30-Sep-2022 11:00                5816
function.ob-start.php                              30-Sep-2022 11:00               16220
function.ob-tidyhandler.php                        30-Sep-2022 11:01                4201
function.oci-bind-array-by-name.php                30-Sep-2022 11:00               13817
function.oci-bind-by-name.php                      30-Sep-2022 11:00               84157
function.oci-cancel.php                            30-Sep-2022 11:00                2449
function.oci-client-version.php                    30-Sep-2022 11:00                3968
function.oci-close.php                             30-Sep-2022 11:00               20371
function.oci-commit.php                            30-Sep-2022 11:00               11414
function.oci-connect.php                           30-Sep-2022 11:00               38309
function.oci-define-by-name.php                    30-Sep-2022 11:00               25557
function.oci-error.php                             30-Sep-2022 11:00               11889
function.oci-execute.php                           30-Sep-2022 11:00               21941
function.oci-fetch-all.php                         30-Sep-2022 11:00               26808
function.oci-fetch-array.php                       30-Sep-2022 11:00               71412
function.oci-fetch-assoc.php                       30-Sep-2022 11:00                8794
function.oci-fetch-object.php                      30-Sep-2022 11:00               19670
function.oci-fetch-row.php                         30-Sep-2022 11:00                8737
function.oci-fetch.php                             30-Sep-2022 11:00               14098
function.oci-field-is-null.php                     30-Sep-2022 11:00                8489
function.oci-field-name.php                        30-Sep-2022 11:00               10988
function.oci-field-precision.php                   30-Sep-2022 11:00                9638
function.oci-field-scale.php                       30-Sep-2022 11:00                9600
function.oci-field-size.php                        30-Sep-2022 11:00               11702
function.oci-field-type-raw.php                    30-Sep-2022 11:00                8757
function.oci-field-type.php                        30-Sep-2022 11:00               11941
function.oci-free-descriptor.php                   30-Sep-2022 11:00                3353
function.oci-free-statement.php                    30-Sep-2022 11:00                2729
function.oci-get-implicit-resultset.php            30-Sep-2022 11:00               32353
function.oci-internal-debug.php                    30-Sep-2022 11:00                3567
function.oci-lob-copy.php                          30-Sep-2022 11:00                4271
function.oci-lob-is-equal.php                      30-Sep-2022 11:00                3110
function.oci-new-collection.php                    30-Sep-2022 11:00                5200
function.oci-new-connect.php                       30-Sep-2022 11:00               16470
function.oci-new-cursor.php                        30-Sep-2022 11:00                8553
function.oci-new-descriptor.php                    30-Sep-2022 11:00               21300
function.oci-num-fields.php                        30-Sep-2022 11:00                7723
function.oci-num-rows.php                          30-Sep-2022 11:00                8465
function.oci-parse.php                             30-Sep-2022 11:00               13182
function.oci-password-change.php                   30-Sep-2022 11:00               14214
function.oci-pconnect.php                          30-Sep-2022 11:00               14436
function.oci-register-taf-callback.php             30-Sep-2022 11:00                5286
function.oci-result.php                            30-Sep-2022 11:00                9382
function.oci-rollback.php                          30-Sep-2022 11:00               14997
function.oci-server-version.php                    30-Sep-2022 11:00                5218
function.oci-set-action.php                        30-Sep-2022 11:00                8297
function.oci-set-call-timout.php                   30-Sep-2022 11:00                5695
function.oci-set-client-identifier.php             30-Sep-2022 11:00                8076
function.oci-set-client-info.php                   30-Sep-2022 11:00                8234
function.oci-set-db-operation.php                  30-Sep-2022 11:00                7665
function.oci-set-edition.php                       30-Sep-2022 11:00                9764
function.oci-set-module-name.php                   30-Sep-2022 11:00                8353
function.oci-set-prefetch-lob.php                  30-Sep-2022 11:00                8854
function.oci-set-prefetch.php                      30-Sep-2022 11:00               22831
function.oci-statement-type.php                    30-Sep-2022 11:00                7072
function.oci-unregister-taf-callback.php           30-Sep-2022 11:00                3401
function.ocibindbyname.php                         30-Sep-2022 11:00                1957
function.ocicancel.php                             30-Sep-2022 11:00                1899
function.ocicloselob.php                           30-Sep-2022 11:00                1898
function.ocicollappend.php                         30-Sep-2022 11:00                1963
function.ocicollassign.php                         30-Sep-2022 11:00                1968
function.ocicollassignelem.php                     30-Sep-2022 11:00                2013
function.ocicollgetelem.php                        30-Sep-2022 11:00                1980
function.ocicollmax.php                            30-Sep-2022 11:00                1932
function.ocicollsize.php                           30-Sep-2022 11:00                1935
function.ocicolltrim.php                           30-Sep-2022 11:00                1945
function.ocicolumnisnull.php                       30-Sep-2022 11:00                1969
function.ocicolumnname.php                         30-Sep-2022 11:00                1961
function.ocicolumnprecision.php                    30-Sep-2022 11:00                2004
function.ocicolumnscale.php                        30-Sep-2022 11:00                1968
function.ocicolumnsize.php                         30-Sep-2022 11:00                1949
function.ocicolumntype.php                         30-Sep-2022 11:00                1953
function.ocicolumntyperaw.php                      30-Sep-2022 11:00                1976
function.ocicommit.php                             30-Sep-2022 11:00                1913
function.ocidefinebyname.php                       30-Sep-2022 11:00                1959
function.ocierror.php                              30-Sep-2022 11:00                1890
function.ociexecute.php                            30-Sep-2022 11:00                1894
function.ocifetch.php                              30-Sep-2022 11:00                1884
function.ocifetchinto.php                          30-Sep-2022 11:00                2631
function.ocifetchstatement.php                     30-Sep-2022 11:00                1977
function.ocifreecollection.php                     30-Sep-2022 11:00                1995
function.ocifreecursor.php                         30-Sep-2022 11:00                1967
function.ocifreedesc.php                           30-Sep-2022 11:00                1911
function.ocifreestatement.php                      30-Sep-2022 11:00                1986
function.ociinternaldebug.php                      30-Sep-2022 11:00                2000
function.ociloadlob.php                            30-Sep-2022 11:00                1896
function.ocilogoff.php                             30-Sep-2022 11:00                1883
function.ocilogon.php                              30-Sep-2022 11:00                1898
function.ocinewcollection.php                      30-Sep-2022 11:00                1984
function.ocinewcursor.php                          30-Sep-2022 11:00                1952
function.ocinewdescriptor.php                      30-Sep-2022 11:00                1974
function.ocinlogon.php                             30-Sep-2022 11:00                1923
function.ocinumcols.php                            30-Sep-2022 11:00                1908
function.ociparse.php                              30-Sep-2022 11:00                1878
function.ociplogon.php                             30-Sep-2022 11:00                1893
function.ociresult.php                             30-Sep-2022 11:00                1891
function.ocirollback.php                           30-Sep-2022 11:00                1913
function.ocirowcount.php                           30-Sep-2022 11:00                1915
function.ocisavelob.php                            30-Sep-2022 11:00                1896
function.ocisavelobfile.php                        30-Sep-2022 11:00                1934
function.ociserverversion.php                      30-Sep-2022 11:00                1988
function.ocisetprefetch.php                        30-Sep-2022 11:00                1974
function.ocistatementtype.php                      30-Sep-2022 11:00                1994
function.ociwritelobtofile.php                     30-Sep-2022 11:00                1975
function.ociwritetemporarylob.php                  30-Sep-2022 11:00                1998
function.octdec.php                                30-Sep-2022 11:00                5617
function.odbc-autocommit.php                       30-Sep-2022 11:00                4078
function.odbc-binmode.php                          30-Sep-2022 11:00                6460
function.odbc-close-all.php                        30-Sep-2022 11:00                2529
function.odbc-close.php                            30-Sep-2022 11:00                2792
function.odbc-columnprivileges.php                 30-Sep-2022 11:00                8440
function.odbc-columns.php                          30-Sep-2022 11:00               11145
function.odbc-commit.php                           30-Sep-2022 11:00                2481
function.odbc-connect.php                          30-Sep-2022 11:00                8638
function.odbc-cursor.php                           30-Sep-2022 11:00                2444
function.odbc-data-source.php                      30-Sep-2022 11:00                5635
function.odbc-do.php                               30-Sep-2022 11:00                1647
function.odbc-error.php                            30-Sep-2022 11:00                3933
function.odbc-errormsg.php                         30-Sep-2022 11:00                3986
function.odbc-exec.php                             30-Sep-2022 11:00                3823
function.odbc-execute.php                          30-Sep-2022 11:00                6781
function.odbc-fetch-array.php                      30-Sep-2022 11:00                4055
function.odbc-fetch-into.php                       30-Sep-2022 11:00                4796
function.odbc-fetch-object.php                     30-Sep-2022 11:00                4097
function.odbc-fetch-row.php                        30-Sep-2022 11:00                4507
function.odbc-field-len.php                        30-Sep-2022 11:00                3212
function.odbc-field-name.php                       30-Sep-2022 11:00                2810
function.odbc-field-num.php                        30-Sep-2022 11:00                2830
function.odbc-field-precision.php                  30-Sep-2022 11:00                2188
function.odbc-field-scale.php                      30-Sep-2022 11:00                2827
function.odbc-field-type.php                       30-Sep-2022 11:00                2810
function.odbc-foreignkeys.php                      30-Sep-2022 11:00                8571
function.odbc-free-result.php                      30-Sep-2022 11:00                3193
function.odbc-gettypeinfo.php                      30-Sep-2022 11:00                4322
function.odbc-longreadlen.php                      30-Sep-2022 11:00                3702
function.odbc-next-result.php                      30-Sep-2022 11:00                9011
function.odbc-num-fields.php                       30-Sep-2022 11:00                2482
function.odbc-num-rows.php                         30-Sep-2022 11:00                3119
function.odbc-pconnect.php                         30-Sep-2022 11:00                4385
function.odbc-prepare.php                          30-Sep-2022 11:00                6219
function.odbc-primarykeys.php                      30-Sep-2022 11:00                7689
function.odbc-procedurecolumns.php                 30-Sep-2022 11:00               11357
function.odbc-procedures.php                       30-Sep-2022 11:00                9258
function.odbc-result-all.php                       30-Sep-2022 11:00                3958
function.odbc-result.php                           30-Sep-2022 11:00                5365
function.odbc-rollback.php                         30-Sep-2022 11:00                2500
function.odbc-setoption.php                        30-Sep-2022 11:00                7081
function.odbc-specialcolumns.php                   30-Sep-2022 11:00                7028
function.odbc-statistics.php                       30-Sep-2022 11:00                9474
function.odbc-tableprivileges.php                  30-Sep-2022 11:00                8076
function.odbc-tables.php                           30-Sep-2022 11:00               12094
function.opcache-compile-file.php                  30-Sep-2022 11:00                3575
function.opcache-get-configuration.php             30-Sep-2022 11:00                3194
function.opcache-get-status.php                    30-Sep-2022 11:00                3584
function.opcache-invalidate.php                    30-Sep-2022 11:00                3964
function.opcache-is-script-cached.php              30-Sep-2022 11:00                3213
function.opcache-reset.php                         30-Sep-2022 11:00                2858
function.openal-buffer-create.php                  30-Sep-2022 11:00                2758
function.openal-buffer-data.php                    30-Sep-2022 11:00                4366
function.openal-buffer-destroy.php                 30-Sep-2022 11:00                2954
function.openal-buffer-get.php                     30-Sep-2022 11:00                3512
function.openal-buffer-loadwav.php                 30-Sep-2022 11:00                3471
function.openal-context-create.php                 30-Sep-2022 11:00                3222
function.openal-context-current.php                30-Sep-2022 11:00                3009
function.openal-context-destroy.php                30-Sep-2022 11:00                2995
function.openal-context-process.php                30-Sep-2022 11:00                3413
function.openal-context-suspend.php                30-Sep-2022 11:00                3407
function.openal-device-close.php                   30-Sep-2022 11:00                2961
function.openal-device-open.php                    30-Sep-2022 11:00                3219
function.openal-listener-get.php                   30-Sep-2022 11:00                3127
function.openal-listener-set.php                   30-Sep-2022 11:00                3420
function.openal-source-create.php                  30-Sep-2022 11:00                2966
function.openal-source-destroy.php                 30-Sep-2022 11:00                2962
function.openal-source-get.php                     30-Sep-2022 11:00                4621
function.openal-source-pause.php                   30-Sep-2022 11:00                3293
function.openal-source-play.php                    30-Sep-2022 11:00                3292
function.openal-source-rewind.php                  30-Sep-2022 11:00                3302
function.openal-source-set.php                     30-Sep-2022 11:00                5145
function.openal-source-stop.php                    30-Sep-2022 11:00                3274
function.openal-stream.php                         30-Sep-2022 11:00                3865
function.opendir.php                               30-Sep-2022 11:00                7912
function.openlog.php                               30-Sep-2022 11:01                8357
function.openssl-cipher-iv-length.php              30-Sep-2022 11:00                4278
function.openssl-cipher-key-length.php             30-Sep-2022 11:00                4147
function.openssl-cms-decrypt.php                   30-Sep-2022 11:00                4547
function.openssl-cms-encrypt.php                   30-Sep-2022 11:00                5541
function.openssl-cms-read.php                      30-Sep-2022 11:00                2934
function.openssl-cms-sign.php                      30-Sep-2022 11:00                7217
function.openssl-cms-verify.php                    30-Sep-2022 11:00                6077
function.openssl-csr-export-to-file.php            30-Sep-2022 11:00                8235
function.openssl-csr-export.php                    30-Sep-2022 11:00                8016
function.openssl-csr-get-public-key.php            30-Sep-2022 11:00                8768
function.openssl-csr-get-subject.php               30-Sep-2022 11:00                9552
function.openssl-csr-new.php                       30-Sep-2022 11:00               21687
function.openssl-csr-sign.php                      30-Sep-2022 11:00               13188
function.openssl-decrypt.php                       30-Sep-2022 11:00                7080
function.openssl-dh-compute-key.php                30-Sep-2022 11:00               16408
function.openssl-digest.php                        30-Sep-2022 11:00                4173
function.openssl-encrypt.php                       30-Sep-2022 11:00               18008
function.openssl-error-string.php                  30-Sep-2022 11:00                3757
function.openssl-free-key.php                      30-Sep-2022 11:00                3736
function.openssl-get-cert-locations.php            30-Sep-2022 11:00                3958
function.openssl-get-cipher-methods.php            30-Sep-2022 11:00               14298
function.openssl-get-curve-names.php               30-Sep-2022 11:00                6979
function.openssl-get-md-methods.php                30-Sep-2022 11:00                6850
function.openssl-get-privatekey.php                30-Sep-2022 11:00                1872
function.openssl-get-publickey.php                 30-Sep-2022 11:00                1843
function.openssl-open.php                          30-Sep-2022 11:00                9958
function.openssl-pbkdf2.php                        30-Sep-2022 11:00                7223
function.openssl-pkcs12-export-to-file.php         30-Sep-2022 11:00                6701
function.openssl-pkcs12-export.php                 30-Sep-2022 11:00                6644
function.openssl-pkcs12-read.php                   30-Sep-2022 11:00                5380
function.openssl-pkcs7-decrypt.php                 30-Sep-2022 11:00                7450
function.openssl-pkcs7-encrypt.php                 30-Sep-2022 11:00               10603
function.openssl-pkcs7-read.php                    30-Sep-2022 11:00                6855
function.openssl-pkcs7-sign.php                    30-Sep-2022 11:00               11811
function.openssl-pkcs7-verify.php                  30-Sep-2022 11:00                7459
function.openssl-pkey-derive.php                   30-Sep-2022 11:00                7853
function.openssl-pkey-export-to-file.php           30-Sep-2022 11:00                5953
function.openssl-pkey-export.php                   30-Sep-2022 11:00                5816
function.openssl-pkey-free.php                     30-Sep-2022 11:00                3968
function.openssl-pkey-get-details.php              30-Sep-2022 11:00                9027
function.openssl-pkey-get-private.php              30-Sep-2022 11:00                5688
function.openssl-pkey-get-public.php               30-Sep-2022 11:00                5240
function.openssl-pkey-new.php                      30-Sep-2022 11:00                6858
function.openssl-private-decrypt.php               30-Sep-2022 11:00                6109
function.openssl-private-encrypt.php               30-Sep-2022 11:00                5938
function.openssl-public-decrypt.php                30-Sep-2022 11:00                5992
function.openssl-public-encrypt.php                30-Sep-2022 11:00                6193
function.openssl-random-pseudo-bytes.php           30-Sep-2022 11:00                9208
function.openssl-seal.php                          30-Sep-2022 11:00               11130
function.openssl-sign.php                          30-Sep-2022 11:00               12367
function.openssl-spki-export-challenge.php         30-Sep-2022 11:00                7589
function.openssl-spki-export.php                   30-Sep-2022 11:00                8217
function.openssl-spki-new.php                      30-Sep-2022 11:00                8976
function.openssl-spki-verify.php                   30-Sep-2022 11:00                7852
function.openssl-verify.php                        30-Sep-2022 11:00               13270
function.openssl-x509-check-private-key.php        30-Sep-2022 11:00                5481
function.openssl-x509-checkpurpose.php             30-Sep-2022 11:00                6918
function.openssl-x509-export-to-file.php           30-Sep-2022 11:00                4603
function.openssl-x509-export.php                   30-Sep-2022 11:00                4522
function.openssl-x509-fingerprint.php              30-Sep-2022 11:00                4892
function.openssl-x509-free.php                     30-Sep-2022 11:00                3993
function.openssl-x509-parse.php                    30-Sep-2022 11:00                4506
function.openssl-x509-read.php                     30-Sep-2022 11:00                4385
function.openssl-x509-verify.php                   30-Sep-2022 11:00               12845
function.ord.php                                   30-Sep-2022 11:01                7368
function.output-add-rewrite-var.php                30-Sep-2022 11:00                8101
function.output-reset-rewrite-vars.php             30-Sep-2022 11:00                6398
function.pack.php                                  30-Sep-2022 11:01               11959
function.parse-ini-file.php                        30-Sep-2022 11:00               19478
function.parse-ini-string.php                      30-Sep-2022 11:00                6503
function.parse-str.php                             30-Sep-2022 11:01               10116
function.parse-url.php                             30-Sep-2022 11:01               15455
function.passthru.php                              30-Sep-2022 11:01                5640
function.password-algos.php                        30-Sep-2022 11:00                3173
function.password-get-info.php                     30-Sep-2022 11:00                3397
function.password-hash.php                         30-Sep-2022 11:00               21498
function.password-needs-rehash.php                 30-Sep-2022 11:00                7716
function.password-verify.php                       30-Sep-2022 11:00                6133
function.pathinfo.php                              30-Sep-2022 11:00               11521
function.pclose.php                                30-Sep-2022 11:00                4727
function.pcntl-alarm.php                           30-Sep-2022 11:00                2783
function.pcntl-async-signals.php                   30-Sep-2022 11:00                3886
function.pcntl-errno.php                           30-Sep-2022 11:00                1735
function.pcntl-exec.php                            30-Sep-2022 11:00                3522
function.pcntl-fork.php                            30-Sep-2022 11:00                5234
function.pcntl-get-last-error.php                  30-Sep-2022 11:00                2692
function.pcntl-getpriority.php                     30-Sep-2022 11:00                4999
function.pcntl-rfork.php                           30-Sep-2022 11:00                7542
function.pcntl-setpriority.php                     30-Sep-2022 11:00                4924
function.pcntl-signal-dispatch.php                 30-Sep-2022 11:00                5621
function.pcntl-signal-get-handler.php              30-Sep-2022 11:00                6672
function.pcntl-signal.php                          30-Sep-2022 11:00               11853
function.pcntl-sigprocmask.php                     30-Sep-2022 11:00                5661
function.pcntl-sigtimedwait.php                    30-Sep-2022 11:00                4815
function.pcntl-sigwaitinfo.php                     30-Sep-2022 11:00                7234
function.pcntl-strerror.php                        30-Sep-2022 11:00                2845
function.pcntl-unshare.php                         30-Sep-2022 11:00                4235
function.pcntl-wait.php                            30-Sep-2022 11:00                7863
function.pcntl-waitpid.php                         30-Sep-2022 11:00                9190
function.pcntl-wexitstatus.php                     30-Sep-2022 11:00                3538
function.pcntl-wifexited.php                       30-Sep-2022 11:00                3285
function.pcntl-wifsignaled.php                     30-Sep-2022 11:00                3337
function.pcntl-wifstopped.php                      30-Sep-2022 11:00                3338
function.pcntl-wstopsig.php                        30-Sep-2022 11:00                3543
function.pcntl-wtermsig.php                        30-Sep-2022 11:00                3733
function.pfsockopen.php                            30-Sep-2022 11:01                5060
function.pg-affected-rows.php                      30-Sep-2022 11:00                6864
function.pg-cancel-query.php                       30-Sep-2022 11:00                7675
function.pg-client-encoding.php                    30-Sep-2022 11:00                6729
function.pg-close.php                              30-Sep-2022 11:00                6478
function.pg-connect-poll.php                       30-Sep-2022 11:00                3687
function.pg-connect.php                            30-Sep-2022 11:00               11190
function.pg-connection-busy.php                    30-Sep-2022 11:00                5829
function.pg-connection-reset.php                   30-Sep-2022 11:00                5823
function.pg-connection-status.php                  30-Sep-2022 11:00                5635
function.pg-consume-input.php                      30-Sep-2022 11:00                3453
function.pg-convert.php                            30-Sep-2022 11:00                8572
function.pg-copy-from.php                          30-Sep-2022 11:00                7872
function.pg-copy-to.php                            30-Sep-2022 11:00                7307
function.pg-dbname.php                             30-Sep-2022 11:00                5184
function.pg-delete.php                             30-Sep-2022 11:00                8948
function.pg-end-copy.php                           30-Sep-2022 11:00                7272
function.pg-escape-bytea.php                       30-Sep-2022 11:00                7908
function.pg-escape-identifier.php                  30-Sep-2022 11:00                7827
function.pg-escape-literal.php                     30-Sep-2022 11:00                8332
function.pg-escape-string.php                      30-Sep-2022 11:00                7787
function.pg-execute.php                            30-Sep-2022 11:00               10558
function.pg-fetch-all-columns.php                  30-Sep-2022 11:00                7083
function.pg-fetch-all.php                          30-Sep-2022 11:00                8754
function.pg-fetch-array.php                        30-Sep-2022 11:00               12293
function.pg-fetch-assoc.php                        30-Sep-2022 11:00                9105
function.pg-fetch-object.php                       30-Sep-2022 11:00               10732
function.pg-fetch-result.php                       30-Sep-2022 11:00                8731
function.pg-fetch-row.php                          30-Sep-2022 11:00                9226
function.pg-field-is-null.php                      30-Sep-2022 11:00                8434
function.pg-field-name.php                         30-Sep-2022 11:00                9375
function.pg-field-num.php                          30-Sep-2022 11:00                6604
function.pg-field-prtlen.php                       30-Sep-2022 11:00               10774
function.pg-field-size.php                         30-Sep-2022 11:00                9622
function.pg-field-table.php                        30-Sep-2022 11:00                8355
function.pg-field-type-oid.php                     30-Sep-2022 11:00                7505
function.pg-field-type.php                         30-Sep-2022 11:00                7290
function.pg-flush.php                              30-Sep-2022 11:00                3448
function.pg-free-result.php                        30-Sep-2022 11:00                7331
function.pg-get-notify.php                         30-Sep-2022 11:00                7092
function.pg-get-pid.php                            30-Sep-2022 11:00                5195
function.pg-get-result.php                         30-Sep-2022 11:00                8970
function.pg-host.php                               30-Sep-2022 11:00                6293
function.pg-insert.php                             30-Sep-2022 11:00                9441
function.pg-last-error.php                         30-Sep-2022 11:00                7355
function.pg-last-notice.php                        30-Sep-2022 11:00                7730
function.pg-last-oid.php                           30-Sep-2022 11:00                7525
function.pg-lo-close.php                           30-Sep-2022 11:00                7244
function.pg-lo-create.php                          30-Sep-2022 11:00                8789
function.pg-lo-export.php                          30-Sep-2022 11:00                8150
function.pg-lo-import.php                          30-Sep-2022 11:00                7465
function.pg-lo-open.php                            30-Sep-2022 11:00                9084
function.pg-lo-read-all.php                        30-Sep-2022 11:00                6503
function.pg-lo-read.php                            30-Sep-2022 11:00                7037
function.pg-lo-seek.php                            30-Sep-2022 11:00                7748
function.pg-lo-tell.php                            30-Sep-2022 11:00                7141
function.pg-lo-truncate.php                        30-Sep-2022 11:00                6638
function.pg-lo-unlink.php                          30-Sep-2022 11:00                7063
function.pg-lo-write.php                           30-Sep-2022 11:00                8121
function.pg-meta-data.php                          30-Sep-2022 11:00                7339
function.pg-num-fields.php                         30-Sep-2022 11:00                5993
function.pg-num-rows.php                           30-Sep-2022 11:00                5961
function.pg-options.php                            30-Sep-2022 11:00                5532
function.pg-parameter-status.php                   30-Sep-2022 11:00                8274
function.pg-pconnect.php                           30-Sep-2022 11:00                9778
function.pg-ping.php                               30-Sep-2022 11:00                5937
function.pg-port.php                               30-Sep-2022 11:00                5774
function.pg-prepare.php                            30-Sep-2022 11:00               10503
function.pg-put-line.php                           30-Sep-2022 11:00                8700
function.pg-query-params.php                       30-Sep-2022 11:00               10869
function.pg-query.php                              30-Sep-2022 11:00               12580
function.pg-result-error-field.php                 30-Sep-2022 11:00                8695
function.pg-result-error.php                       30-Sep-2022 11:00                8136
function.pg-result-seek.php                        30-Sep-2022 11:00                7339
function.pg-result-status.php                      30-Sep-2022 11:00                7855
function.pg-select.php                             30-Sep-2022 11:00                9624
function.pg-send-execute.php                       30-Sep-2022 11:00               10752
function.pg-send-prepare.php                       30-Sep-2022 11:00               11125
function.pg-send-query-params.php                  30-Sep-2022 11:00                8106
function.pg-send-query.php                         30-Sep-2022 11:00                9950
function.pg-set-client-encoding.php                30-Sep-2022 11:00                9055
function.pg-set-error-verbosity.php                30-Sep-2022 11:00                8497
function.pg-socket.php                             30-Sep-2022 11:00                3598
function.pg-trace.php                              30-Sep-2022 11:00                8121
function.pg-transaction-status.php                 30-Sep-2022 11:00                6530
function.pg-tty.php                                30-Sep-2022 11:00                6061
function.pg-unescape-bytea.php                     30-Sep-2022 11:00                6362
function.pg-untrace.php                            30-Sep-2022 11:00                6499
function.pg-update.php                             30-Sep-2022 11:00                9822
function.pg-version.php                            30-Sep-2022 11:00                6508
function.php-ini-loaded-file.php                   30-Sep-2022 11:00                4594
function.php-ini-scanned-files.php                 30-Sep-2022 11:00                6455
function.php-sapi-name.php                         30-Sep-2022 11:00                5830
function.php-strip-whitespace.php                  30-Sep-2022 11:01                4655
function.php-uname.php                             30-Sep-2022 11:00                9388
function.phpcredits.php                            30-Sep-2022 11:00                7894
function.phpdbg-break-file.php                     30-Sep-2022 11:00                3632
function.phpdbg-break-function.php                 30-Sep-2022 11:00                3422
function.phpdbg-break-method.php                   30-Sep-2022 11:00                3700
function.phpdbg-break-next.php                     30-Sep-2022 11:00                3114
function.phpdbg-clear.php                          30-Sep-2022 11:00                3374
function.phpdbg-color.php                          30-Sep-2022 11:00                3523
function.phpdbg-end-oplog.php                      30-Sep-2022 11:00                2427
function.phpdbg-exec.php                           30-Sep-2022 11:00                2750
function.phpdbg-get-executable.php                 30-Sep-2022 11:00                2426
function.phpdbg-prompt.php                         30-Sep-2022 11:00                2720
function.phpdbg-start-oplog.php                    30-Sep-2022 11:00                2210
function.phpinfo.php                               30-Sep-2022 11:00                9331
function.phpversion.php                            30-Sep-2022 11:00               11004
function.pi.php                                    30-Sep-2022 11:00                2943
function.png2wbmp.php                              30-Sep-2022 11:00                6289
function.popen.php                                 30-Sep-2022 11:00                8349
function.pos.php                                   30-Sep-2022 11:01                1579
function.posix-access.php                          30-Sep-2022 11:00                6167
function.posix-ctermid.php                         30-Sep-2022 11:00                4250
function.posix-errno.php                           30-Sep-2022 11:00                1751
function.posix-get-last-error.php                  30-Sep-2022 11:01                4144
function.posix-getcwd.php                          30-Sep-2022 11:01                4113
function.posix-getegid.php                         30-Sep-2022 11:01                5248
function.posix-geteuid.php                         30-Sep-2022 11:01                5189
function.posix-getgid.php                          30-Sep-2022 11:01                4694
function.posix-getgrgid.php                        30-Sep-2022 11:01                6233
function.posix-getgrnam.php                        30-Sep-2022 11:01                6099
function.posix-getgroups.php                       30-Sep-2022 11:01                4010
function.posix-getlogin.php                        30-Sep-2022 11:01                3447
function.posix-getpgid.php                         30-Sep-2022 11:01                4427
function.posix-getpgrp.php                         30-Sep-2022 11:01                2450
function.posix-getpid.php                          30-Sep-2022 11:01                3245
function.posix-getppid.php                         30-Sep-2022 11:01                2873
function.posix-getpwnam.php                        30-Sep-2022 11:01                6569
function.posix-getpwuid.php                        30-Sep-2022 11:01                6570
function.posix-getrlimit.php                       30-Sep-2022 11:01                7001
function.posix-getsid.php                          30-Sep-2022 11:01                4513
function.posix-getuid.php                          30-Sep-2022 11:01                3281
function.posix-initgroups.php                      30-Sep-2022 11:01                3006
function.posix-isatty.php                          30-Sep-2022 11:01                3549
function.posix-kill.php                            30-Sep-2022 11:01                3189
function.posix-mkfifo.php                          30-Sep-2022 11:01                3242
function.posix-mknod.php                           30-Sep-2022 11:01                7053
function.posix-setegid.php                         30-Sep-2022 11:01                5026
function.posix-seteuid.php                         30-Sep-2022 11:01                3322
function.posix-setgid.php                          30-Sep-2022 11:01                5229
function.posix-setpgid.php                         30-Sep-2022 11:01                3110
function.posix-setrlimit.php                       30-Sep-2022 11:01                4120
function.posix-setsid.php                          30-Sep-2022 11:01                2434
function.posix-setuid.php                          30-Sep-2022 11:01                5342
function.posix-strerror.php                        30-Sep-2022 11:01                4681
function.posix-times.php                           30-Sep-2022 11:01                4506
function.posix-ttyname.php                         30-Sep-2022 11:01                3109
function.posix-uname.php                           30-Sep-2022 11:01                4638
function.pow.php                                   30-Sep-2022 11:00                6711
function.preg-filter.php                           30-Sep-2022 11:01                9319
function.preg-grep.php                             30-Sep-2022 11:01                5733
function.preg-last-error-msg.php                   30-Sep-2022 11:01                4019
function.preg-last-error.php                       30-Sep-2022 11:01                4746
function.preg-match-all.php                        30-Sep-2022 11:01               25511
function.preg-match.php                            30-Sep-2022 11:01               23557
function.preg-quote.php                            30-Sep-2022 11:01                8834
function.preg-replace-callback-array.php           30-Sep-2022 11:01               10218
function.preg-replace-callback.php                 30-Sep-2022 11:01               17663
function.preg-replace.php                          30-Sep-2022 11:01               23692
function.preg-split.php                            30-Sep-2022 11:01               12326
function.prev.php                                  30-Sep-2022 11:01                8411
function.print-r.php                               30-Sep-2022 11:01                8819
function.print.php                                 30-Sep-2022 11:01               14136
function.printf.php                                30-Sep-2022 11:01               24245
function.proc-close.php                            30-Sep-2022 11:01                3471
function.proc-get-status.php                       30-Sep-2022 11:01                5625
function.proc-nice.php                             30-Sep-2022 11:01                7452
function.proc-open.php                             30-Sep-2022 11:01               22040
function.proc-terminate.php                        30-Sep-2022 11:01                4527
function.property-exists.php                       30-Sep-2022 11:01                8460
function.ps-add-bookmark.php                       30-Sep-2022 11:00                4844
function.ps-add-launchlink.php                     30-Sep-2022 11:00                5331
function.ps-add-locallink.php                      30-Sep-2022 11:00                6061
function.ps-add-note.php                           30-Sep-2022 11:00                6690
function.ps-add-pdflink.php                        30-Sep-2022 11:00                6378
function.ps-add-weblink.php                        30-Sep-2022 11:00                5417
function.ps-arc.php                                30-Sep-2022 11:00                4807
function.ps-arcn.php                               30-Sep-2022 11:00                4813
function.ps-begin-page.php                         30-Sep-2022 11:00                6660
function.ps-begin-pattern.php                      30-Sep-2022 11:00               13260
function.ps-begin-template.php                     30-Sep-2022 11:00               11329
function.ps-circle.php                             30-Sep-2022 11:00                4449
function.ps-clip.php                               30-Sep-2022 11:00                2875
function.ps-close-image.php                        30-Sep-2022 11:00                3741
function.ps-close.php                              30-Sep-2022 11:00                3528
function.ps-closepath-stroke.php                   30-Sep-2022 11:00                2948
function.ps-closepath.php                          30-Sep-2022 11:00                3124
function.ps-continue-text.php                      30-Sep-2022 11:00                3895
function.ps-curveto.php                            30-Sep-2022 11:00                4628
function.ps-delete.php                             30-Sep-2022 11:00                3392
function.ps-end-page.php                           30-Sep-2022 11:00                3118
function.ps-end-pattern.php                        30-Sep-2022 11:00                3049
function.ps-end-template.php                       30-Sep-2022 11:00                3056
function.ps-fill-stroke.php                        30-Sep-2022 11:00                3169
function.ps-fill.php                               30-Sep-2022 11:00                3102
function.ps-findfont.php                           30-Sep-2022 11:00                6827
function.ps-get-buffer.php                         30-Sep-2022 11:00                3120
function.ps-get-parameter.php                      30-Sep-2022 11:00                7546
function.ps-get-value.php                          30-Sep-2022 11:00                9308
function.ps-hyphenate.php                          30-Sep-2022 11:00                7125
function.ps-include-file.php                       30-Sep-2022 11:00                2886
function.ps-lineto.php                             30-Sep-2022 11:00                8144
function.ps-makespotcolor.php                      30-Sep-2022 11:00               10261
function.ps-moveto.php                             30-Sep-2022 11:00                3578
function.ps-new.php                                30-Sep-2022 11:00                2888
function.ps-open-file.php                          30-Sep-2022 11:00                3471
function.ps-open-image-file.php                    30-Sep-2022 11:00                4665
function.ps-open-image.php                         30-Sep-2022 11:00                6480
function.ps-open-memory-image.php                  30-Sep-2022 11:00                2685
function.ps-place-image.php                        30-Sep-2022 11:00                4886
function.ps-rect.php                               30-Sep-2022 11:00                4621
function.ps-restore.php                            30-Sep-2022 11:00                3231
function.ps-rotate.php                             30-Sep-2022 11:00               12314
function.ps-save.php                               30-Sep-2022 11:00                2978
function.ps-scale.php                              30-Sep-2022 11:00                3502
function.ps-set-border-color.php                   30-Sep-2022 11:00                4566
function.ps-set-border-dash.php                    30-Sep-2022 11:00                4208
function.ps-set-border-style.php                   30-Sep-2022 11:00                4270
function.ps-set-info.php                           30-Sep-2022 11:00                5740
function.ps-set-parameter.php                      30-Sep-2022 11:00                3678
function.ps-set-text-pos.php                       30-Sep-2022 11:00                9306
function.ps-set-value.php                          30-Sep-2022 11:00                4513
function.ps-setcolor.php                           30-Sep-2022 11:00                5449
function.ps-setdash.php                            30-Sep-2022 11:00                3374
function.ps-setflat.php                            30-Sep-2022 11:00                2875
function.ps-setfont.php                            30-Sep-2022 11:00                3807
function.ps-setgray.php                            30-Sep-2022 11:00                3101
function.ps-setlinecap.php                         30-Sep-2022 11:00                3657
function.ps-setlinejoin.php                        30-Sep-2022 11:00                3675
function.ps-setlinewidth.php                       30-Sep-2022 11:00                3539
function.ps-setmiterlimit.php                      30-Sep-2022 11:00                3959
function.ps-setoverprintmode.php                   30-Sep-2022 11:00                2912
function.ps-setpolydash.php                        30-Sep-2022 11:00                7709
function.ps-shading-pattern.php                    30-Sep-2022 11:00                4022
function.ps-shading.php                            30-Sep-2022 11:00                6499
function.ps-shfill.php                             30-Sep-2022 11:00                3765
function.ps-show-boxed.php                         30-Sep-2022 11:00               12082
function.ps-show-xy.php                            30-Sep-2022 11:00                3934
function.ps-show-xy2.php                           30-Sep-2022 11:00                2700
function.ps-show.php                               30-Sep-2022 11:00                5587
function.ps-show2.php                              30-Sep-2022 11:00                3027
function.ps-string-geometry.php                    30-Sep-2022 11:00                4655
function.ps-stringwidth.php                        30-Sep-2022 11:00                4117
function.ps-stroke.php                             30-Sep-2022 11:00                3314
function.ps-symbol-name.php                        30-Sep-2022 11:00                3714
function.ps-symbol-width.php                       30-Sep-2022 11:00                4206
function.ps-symbol.php                             30-Sep-2022 11:00                3511
function.ps-translate.php                          30-Sep-2022 11:00               14349
function.pspell-add-to-personal.php                30-Sep-2022 11:00                6238
function.pspell-add-to-session.php                 30-Sep-2022 11:00                3847
function.pspell-check.php                          30-Sep-2022 11:00                4908
function.pspell-clear-session.php                  30-Sep-2022 11:00                5746
function.pspell-config-create.php                  30-Sep-2022 11:00                7892
function.pspell-config-data-dir.php                30-Sep-2022 11:00                3144
function.pspell-config-dict-dir.php                30-Sep-2022 11:00                3143
function.pspell-config-ignore.php                  30-Sep-2022 11:00                5581
function.pspell-config-mode.php                    30-Sep-2022 11:00                6202
function.pspell-config-personal.php                30-Sep-2022 11:00                6321
function.pspell-config-repl.php                    30-Sep-2022 11:00                6629
function.pspell-config-runtogether.php             30-Sep-2022 11:00                6085
function.pspell-config-save-repl.php               30-Sep-2022 11:00                4978
function.pspell-new-config.php                     30-Sep-2022 11:00                6312
function.pspell-new-personal.php                   30-Sep-2022 11:00               10195
function.pspell-new.php                            30-Sep-2022 11:00                8839
function.pspell-save-wordlist.php                  30-Sep-2022 11:00                5899
function.pspell-store-replacement.php              30-Sep-2022 11:00                7472
function.pspell-suggest.php                        30-Sep-2022 11:00                5587
function.putenv.php                                30-Sep-2022 11:00                3846
function.quoted-printable-decode.php               30-Sep-2022 11:01                5013
function.quoted-printable-encode.php               30-Sep-2022 11:01                4964
function.quotemeta.php                             30-Sep-2022 11:01                5623
function.rad2deg.php                               30-Sep-2022 11:00                3481
function.radius-acct-open.php                      30-Sep-2022 11:00                3157
function.radius-add-server.php                     30-Sep-2022 11:00                7364
function.radius-auth-open.php                      30-Sep-2022 11:00                3166
function.radius-close.php                          30-Sep-2022 11:00                2416
function.radius-config.php                         30-Sep-2022 11:00                3788
function.radius-create-request.php                 30-Sep-2022 11:00                4968
function.radius-cvt-addr.php                       30-Sep-2022 11:00                6733
function.radius-cvt-int.php                        30-Sep-2022 11:00                5970
function.radius-cvt-string.php                     30-Sep-2022 11:00                6027
function.radius-demangle-mppe-key.php              30-Sep-2022 11:00                2986
function.radius-demangle.php                       30-Sep-2022 11:00                2717
function.radius-get-attr.php                       30-Sep-2022 11:00                6764
function.radius-get-tagged-attr-data.php           30-Sep-2022 11:00                6726
function.radius-get-tagged-attr-tag.php            30-Sep-2022 11:00                6781
function.radius-get-vendor-attr.php                30-Sep-2022 11:00                8825
function.radius-put-addr.php                       30-Sep-2022 11:00                4928
function.radius-put-attr.php                       30-Sep-2022 11:00                8352
function.radius-put-int.php                        30-Sep-2022 11:00                7021
function.radius-put-string.php                     30-Sep-2022 11:00                7409
function.radius-put-vendor-addr.php                30-Sep-2022 11:00                4939
function.radius-put-vendor-attr.php                30-Sep-2022 11:00                7192
function.radius-put-vendor-int.php                 30-Sep-2022 11:00                5614
function.radius-put-vendor-string.php              30-Sep-2022 11:00                6005
function.radius-request-authenticator.php          30-Sep-2022 11:00                2981
function.radius-salt-encrypt-attr.php              30-Sep-2022 11:00                3956
function.radius-send-request.php                   30-Sep-2022 11:00                3601
function.radius-server-secret.php                  30-Sep-2022 11:00                2501
function.radius-strerror.php                       30-Sep-2022 11:00                2446
function.rand.php                                  30-Sep-2022 11:00                9708
function.random-bytes.php                          30-Sep-2022 11:00                7677
function.random-int.php                            30-Sep-2022 11:00                7796
function.range.php                                 30-Sep-2022 11:01                8067
function.rar-wrapper-cache-stats.php               30-Sep-2022 11:00                2252
function.rawurldecode.php                          30-Sep-2022 11:01                4536
function.rawurlencode.php                          30-Sep-2022 11:01                6197
function.read-exif-data.php                        30-Sep-2022 11:00                2451
function.readdir.php                               30-Sep-2022 11:00               10584
function.readfile.php                              30-Sep-2022 11:00                9655
function.readgzfile.php                            30-Sep-2022 11:00                4246
function.readline-add-history.php                  30-Sep-2022 11:00                2533
function.readline-callback-handler-install.php     30-Sep-2022 11:00                9943
function.readline-callback-handler-remove.php      30-Sep-2022 11:00                3725
function.readline-callback-read-char.php           30-Sep-2022 11:00                3777
function.readline-clear-history.php                30-Sep-2022 11:00                2309
function.readline-completion-function.php          30-Sep-2022 11:00                2860
function.readline-info.php                         30-Sep-2022 11:00                4453
function.readline-list-history.php                 30-Sep-2022 11:00                2247
function.readline-on-new-line.php                  30-Sep-2022 11:00                2608
function.readline-read-history.php                 30-Sep-2022 11:00                3151
function.readline-redisplay.php                    30-Sep-2022 11:00                2185
function.readline-write-history.php                30-Sep-2022 11:00                3107
function.readline.php                              30-Sep-2022 11:00                5001
function.readlink.php                              30-Sep-2022 11:00                4328
function.realpath-cache-get.php                    30-Sep-2022 11:00                4114
function.realpath-cache-size.php                   30-Sep-2022 11:00                3601
function.realpath.php                              30-Sep-2022 11:00                8305
function.recode-file.php                           30-Sep-2022 11:00                5427
function.recode-string.php                         30-Sep-2022 11:00                4910
function.recode.php                                30-Sep-2022 11:00                1684
function.register-shutdown-function.php            30-Sep-2022 11:01                8125
function.register-tick-function.php                30-Sep-2022 11:01                5408
function.rename.php                                30-Sep-2022 11:00                5453
function.require-once.php                          30-Sep-2022 11:00                1767
function.require.php                               30-Sep-2022 11:00                1817
function.reset.php                                 30-Sep-2022 11:01                8868
function.restore-error-handler.php                 30-Sep-2022 11:00                5718
function.restore-exception-handler.php             30-Sep-2022 11:00                6854
function.restore-include-path.php                  30-Sep-2022 11:00                5311
function.return.php                                30-Sep-2022 11:00                4092
function.rewind.php                                30-Sep-2022 11:00                6143
function.rewinddir.php                             30-Sep-2022 11:00                3303
function.rmdir.php                                 30-Sep-2022 11:00                4770
function.round.php                                 30-Sep-2022 11:00               23763
function.rpmaddtag.php                             30-Sep-2022 11:00                3096
function.rpmdbinfo.php                             30-Sep-2022 11:00                4684
function.rpmdbsearch.php                           30-Sep-2022 11:00                5469
function.rpminfo.php                               30-Sep-2022 11:00                4868
function.rpmvercmp.php                             30-Sep-2022 11:00                2538
function.rrd-create.php                            30-Sep-2022 11:01                2620
function.rrd-error.php                             30-Sep-2022 11:01                1994
function.rrd-fetch.php                             30-Sep-2022 11:01                2730
function.rrd-first.php                             30-Sep-2022 11:01                2649
function.rrd-graph.php                             30-Sep-2022 11:01                2901
function.rrd-info.php                              30-Sep-2022 11:01                2288
function.rrd-last.php                              30-Sep-2022 11:01                2297
function.rrd-lastupdate.php                        30-Sep-2022 11:01                2418
function.rrd-restore.php                           30-Sep-2022 11:01                2950
function.rrd-tune.php                              30-Sep-2022 11:01                2688
function.rrd-update.php                            30-Sep-2022 11:01                2761
function.rrd-version.php                           30-Sep-2022 11:01                2088
function.rrd-xport.php                             30-Sep-2022 11:01                2464
function.rrdc-disconnect.php                       30-Sep-2022 11:01                2473
function.rsort.php                                 30-Sep-2022 11:01                7845
function.rtrim.php                                 30-Sep-2022 11:01                9636
function.runkit7-constant-add.php                  30-Sep-2022 11:00                4182
function.runkit7-constant-redefine.php             30-Sep-2022 11:00                4058
function.runkit7-constant-remove.php               30-Sep-2022 11:00                3398
function.runkit7-function-add.php                  30-Sep-2022 11:00                8798
function.runkit7-function-copy.php                 30-Sep-2022 11:00                5230
function.runkit7-function-redefine.php             30-Sep-2022 11:00                9164
function.runkit7-function-remove.php               30-Sep-2022 11:00                3858
function.runkit7-function-rename.php               30-Sep-2022 11:00                4079
function.runkit7-import.php                        30-Sep-2022 11:00                3516
function.runkit7-method-add.php                    30-Sep-2022 11:00               10677
function.runkit7-method-copy.php                   30-Sep-2022 11:00                7029
function.runkit7-method-redefine.php               30-Sep-2022 11:00               11143
function.runkit7-method-remove.php                 30-Sep-2022 11:00                6415
function.runkit7-method-rename.php                 30-Sep-2022 11:00                6466
function.runkit7-object-id.php                     30-Sep-2022 11:00                3602
function.runkit7-superglobals.php                  30-Sep-2022 11:00                2536
function.runkit7-zval-inspect.php                  30-Sep-2022 11:00                5030
function.sapi-windows-cp-conv.php                  30-Sep-2022 11:01                4262
function.sapi-windows-cp-get.php                   30-Sep-2022 11:01                3307
function.sapi-windows-cp-is-utf8.php               30-Sep-2022 11:01                2639
function.sapi-windows-cp-set.php                   30-Sep-2022 11:01                2806
function.sapi-windows-generate-ctrl-event.php      30-Sep-2022 11:01                7628
function.sapi-windows-set-ctrl-handler.php         30-Sep-2022 11:01                7384
function.sapi-windows-vt100-support.php            30-Sep-2022 11:01                9867
function.scandir.php                               30-Sep-2022 11:00                8248
function.scoutapm-get-calls.php                    30-Sep-2022 11:01                4337
function.scoutapm-list-instrumented-functions.php  30-Sep-2022 11:01                3674
function.seaslog-get-author.php                    30-Sep-2022 11:01                2992
function.seaslog-get-version.php                   30-Sep-2022 11:01                2990
function.sem-acquire.php                           30-Sep-2022 11:01                4817
function.sem-get.php                               30-Sep-2022 11:01                6599
function.sem-release.php                           30-Sep-2022 11:01                4043
function.sem-remove.php                            30-Sep-2022 11:01                4024
function.serialize.php                             30-Sep-2022 11:01               11043
function.session-abort.php                         30-Sep-2022 11:01                3915
function.session-cache-expire.php                  30-Sep-2022 11:01                7411
function.session-cache-limiter.php                 30-Sep-2022 11:01                8714
function.session-commit.php                        30-Sep-2022 11:01                1786
function.session-create-id.php                     30-Sep-2022 11:01               10916
function.session-decode.php                        30-Sep-2022 11:01                3527
function.session-destroy.php                       30-Sep-2022 11:01                9536
function.session-encode.php                        30-Sep-2022 11:01                3728
function.session-gc.php                            30-Sep-2022 11:01                8070
function.session-get-cookie-params.php             30-Sep-2022 11:01                5497
function.session-id.php                            30-Sep-2022 11:01                5715
function.session-module-name.php                   30-Sep-2022 11:01                3999
function.session-name.php                          30-Sep-2022 11:01                7410
function.session-regenerate-id.php                 30-Sep-2022 11:01               17997
function.session-register-shutdown.php             30-Sep-2022 11:01                2611
function.session-reset.php                         30-Sep-2022 11:01                4002
function.session-save-path.php                     30-Sep-2022 11:01                4356
function.session-set-cookie-params.php             30-Sep-2022 11:01                9612
function.session-set-save-handler.php              30-Sep-2022 11:01               21634
function.session-start.php                         30-Sep-2022 11:01               14690
function.session-status.php                        30-Sep-2022 11:01                2985
function.session-unset.php                         30-Sep-2022 11:01                4180
function.session-write-close.php                   30-Sep-2022 11:01                3773
function.set-error-handler.php                     30-Sep-2022 11:00               27605
function.set-exception-handler.php                 30-Sep-2022 11:00                6802
function.set-file-buffer.php                       30-Sep-2022 11:00                1751
function.set-include-path.php                      30-Sep-2022 11:00                6071
function.set-time-limit.php                        30-Sep-2022 11:00                4433
function.setcookie.php                             30-Sep-2022 11:01               25369
function.setlocale.php                             30-Sep-2022 11:01               14674
function.setrawcookie.php                          30-Sep-2022 11:01                5373
function.settype.php                               30-Sep-2022 11:01                6283
function.sha1-file.php                             30-Sep-2022 11:01                5533
function.sha1.php                                  30-Sep-2022 11:01                5726
function.shell-exec.php                            30-Sep-2022 11:01                5328
function.shm-attach.php                            30-Sep-2022 11:01                5597
function.shm-detach.php                            30-Sep-2022 11:01                4285
function.shm-get-var.php                           30-Sep-2022 11:01                4261
function.shm-has-var.php                           30-Sep-2022 11:01                4081
function.shm-put-var.php                           30-Sep-2022 11:01                5109
function.shm-remove-var.php                        30-Sep-2022 11:01                3944
function.shm-remove.php                            30-Sep-2022 11:01                3725
function.shmop-close.php                           30-Sep-2022 11:01                4746
function.shmop-delete.php                          30-Sep-2022 11:01                3983
function.shmop-open.php                            30-Sep-2022 11:01                8125
function.shmop-read.php                            30-Sep-2022 11:01                5203
function.shmop-size.php                            30-Sep-2022 11:01                4125
function.shmop-write.php                           30-Sep-2022 11:01                5397
function.show-source.php                           30-Sep-2022 11:01                1708
function.shuffle.php                               30-Sep-2022 11:01                5645
function.similar-text.php                          30-Sep-2022 11:01                7101
function.simplexml-import-dom.php                  30-Sep-2022 11:01                6386
function.simplexml-load-file.php                   30-Sep-2022 11:01                9620
function.simplexml-load-string.php                 30-Sep-2022 11:01                9263
function.sin.php                                   30-Sep-2022 11:00                4594
function.sinh.php                                  30-Sep-2022 11:00                3075
function.sizeof.php                                30-Sep-2022 11:01                1599
function.sleep.php                                 30-Sep-2022 11:01                6990
function.snmp-get-quick-print.php                  30-Sep-2022 11:01                3519
function.snmp-get-valueretrieval.php               30-Sep-2022 11:01                4364
function.snmp-read-mib.php                         30-Sep-2022 11:01                4656
function.snmp-set-enum-print.php                   30-Sep-2022 11:01                4580
function.snmp-set-oid-numeric-print.php            30-Sep-2022 11:01                2296
function.snmp-set-oid-output-format.php            30-Sep-2022 11:01                6654
function.snmp-set-quick-print.php                  30-Sep-2022 11:01                6419
function.snmp-set-valueretrieval.php               30-Sep-2022 11:01                9130
function.snmp2-get.php                             30-Sep-2022 11:01                5452
function.snmp2-getnext.php                         30-Sep-2022 11:01                5835
function.snmp2-real-walk.php                       30-Sep-2022 11:01                6106
function.snmp2-set.php                             30-Sep-2022 11:01               10350
function.snmp2-walk.php                            30-Sep-2022 11:01                6613
function.snmp3-get.php                             30-Sep-2022 11:01                8293
function.snmp3-getnext.php                         30-Sep-2022 11:01                8636
function.snmp3-real-walk.php                       30-Sep-2022 11:01                9149
function.snmp3-set.php                             30-Sep-2022 11:01               12909
function.snmp3-walk.php                            30-Sep-2022 11:01                9569
function.snmpget.php                               30-Sep-2022 11:01                5446
function.snmpgetnext.php                           30-Sep-2022 11:01                5710
function.snmprealwalk.php                          30-Sep-2022 11:01                5981
function.snmpset.php                               30-Sep-2022 11:01               10381
function.snmpwalk.php                              30-Sep-2022 11:01                6639
function.snmpwalkoid.php                           30-Sep-2022 11:01                7319
function.socket-accept.php                         30-Sep-2022 11:01                6628
function.socket-addrinfo-bind.php                  30-Sep-2022 11:01                5235
function.socket-addrinfo-connect.php               30-Sep-2022 11:01                5028
function.socket-addrinfo-explain.php               30-Sep-2022 11:01                4352
function.socket-addrinfo-lookup.php                30-Sep-2022 11:01                5534
function.socket-bind.php                           30-Sep-2022 11:01               10861
function.socket-clear-error.php                    30-Sep-2022 11:01                4448
function.socket-close.php                          30-Sep-2022 11:01                4506
function.socket-cmsg-space.php                     30-Sep-2022 11:01                3463
function.socket-connect.php                        30-Sep-2022 11:01                7036
function.socket-create-listen.php                  30-Sep-2022 11:01                6893
function.socket-create-pair.php                    30-Sep-2022 11:01               20527
function.socket-create.php                         30-Sep-2022 11:01               11656
function.socket-export-stream.php                  30-Sep-2022 11:01                3269
function.socket-get-option.php                     30-Sep-2022 11:01               26914
function.socket-get-status.php                     30-Sep-2022 11:01                1784
function.socket-getopt.php                         30-Sep-2022 11:01                1765
function.socket-getpeername.php                    30-Sep-2022 11:01                7586
function.socket-getsockname.php                    30-Sep-2022 11:01                6905
function.socket-import-stream.php                  30-Sep-2022 11:01                4985
function.socket-last-error.php                     30-Sep-2022 11:01                7174
function.socket-listen.php                         30-Sep-2022 11:01                6991
function.socket-read.php                           30-Sep-2022 11:01                7578
function.socket-recv.php                           30-Sep-2022 11:01               16555
function.socket-recvfrom.php                       30-Sep-2022 11:01               12819
function.socket-recvmsg.php                        30-Sep-2022 11:01                4157
function.socket-select.php                         30-Sep-2022 11:01               15389
function.socket-send.php                           30-Sep-2022 11:01                6271
function.socket-sendmsg.php                        30-Sep-2022 11:01                4227
function.socket-sendto.php                         30-Sep-2022 11:01                9517
function.socket-set-block.php                      30-Sep-2022 11:01                5889
function.socket-set-blocking.php                   30-Sep-2022 11:01                1804
function.socket-set-nonblock.php                   30-Sep-2022 11:01                6268
function.socket-set-option.php                     30-Sep-2022 11:01               11438
function.socket-set-timeout.php                    30-Sep-2022 11:01                1772
function.socket-setopt.php                         30-Sep-2022 11:01                1759
function.socket-shutdown.php                       30-Sep-2022 11:01                4669
function.socket-strerror.php                       30-Sep-2022 11:01                7201
function.socket-write.php                          30-Sep-2022 11:01                6962
function.socket-wsaprotocol-info-export.php        30-Sep-2022 11:01                4794
function.socket-wsaprotocol-info-import.php        30-Sep-2022 11:01                4218
function.socket-wsaprotocol-info-release.php       30-Sep-2022 11:01                3380
function.sodium-add.php                            30-Sep-2022 11:00                3004
function.sodium-base642bin.php                     30-Sep-2022 11:00                4199
function.sodium-bin2base64.php                     30-Sep-2022 11:00                3845
function.sodium-bin2hex.php                        30-Sep-2022 11:00                2536
function.sodium-compare.php                        30-Sep-2022 11:00                3009
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-Sep-2022 11:00                4231
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-Sep-2022 11:00                4024
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-Sep-2022 11:00                2628
function.sodium-crypto-aead-aes256gcm-keygen.php   30-Sep-2022 11:00                2720
function.sodium-crypto-aead-chacha20poly1305-de..> 30-Sep-2022 11:00                4147
function.sodium-crypto-aead-chacha20poly1305-en..> 30-Sep-2022 11:00                3892
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:00                4377
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:00                4058
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:00                2914
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-Sep-2022 11:00                2849
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:00                4555
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:00                4276
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:00                2890
function.sodium-crypto-auth-keygen.php             30-Sep-2022 11:00                2541
function.sodium-crypto-auth-verify.php             30-Sep-2022 11:00                3498
function.sodium-crypto-auth.php                    30-Sep-2022 11:00                3136
function.sodium-crypto-box-keypair-from-secretk..> 30-Sep-2022 11:00                3215
function.sodium-crypto-box-keypair.php             30-Sep-2022 11:00                2822
function.sodium-crypto-box-open.php                30-Sep-2022 11:00                3638
function.sodium-crypto-box-publickey-from-secre..> 30-Sep-2022 11:00                3102
function.sodium-crypto-box-publickey.php           30-Sep-2022 11:00                2815
function.sodium-crypto-box-seal-open.php           30-Sep-2022 11:00                5887
function.sodium-crypto-box-seal.php                30-Sep-2022 11:00                7073
function.sodium-crypto-box-secretkey.php           30-Sep-2022 11:00                2782
function.sodium-crypto-box-seed-keypair.php        30-Sep-2022 11:00                2841
function.sodium-crypto-box.php                     30-Sep-2022 11:00                3949
function.sodium-crypto-core-ristretto255-add.php   30-Sep-2022 11:00                5908
function.sodium-crypto-core-ristretto255-from-h..> 30-Sep-2022 11:00                5339
function.sodium-crypto-core-ristretto255-is-val..> 30-Sep-2022 11:00                5413
function.sodium-crypto-core-ristretto255-random..> 30-Sep-2022 11:00                5524
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:00                6176
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:00                3427
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:00                5289
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:00                3630
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:00                5273
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:00                5684
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:00                3371
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:00                6167
function.sodium-crypto-core-ristretto255-sub.php   30-Sep-2022 11:00                5945
function.sodium-crypto-generichash-final.php       30-Sep-2022 11:00                6716
function.sodium-crypto-generichash-init.php        30-Sep-2022 11:00                6665
function.sodium-crypto-generichash-keygen.php      30-Sep-2022 11:00                2351
function.sodium-crypto-generichash-update.php      30-Sep-2022 11:00                6467
function.sodium-crypto-generichash.php             30-Sep-2022 11:00                3411
function.sodium-crypto-kdf-derive-from-key.php     30-Sep-2022 11:00                3644
function.sodium-crypto-kdf-keygen.php              30-Sep-2022 11:00                2453
function.sodium-crypto-kx-client-session-keys.php  30-Sep-2022 11:00                3170
function.sodium-crypto-kx-keypair.php              30-Sep-2022 11:00                4953
function.sodium-crypto-kx-publickey.php            30-Sep-2022 11:00                2634
function.sodium-crypto-kx-secretkey.php            30-Sep-2022 11:00                2645
function.sodium-crypto-kx-seed-keypair.php         30-Sep-2022 11:00                2576
function.sodium-crypto-kx-server-session-keys.php  30-Sep-2022 11:00                3236
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:00                3126
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:00                3276
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:00                5552
function.sodium-crypto-pwhash-str-needs-rehash.php 30-Sep-2022 11:00                3654
function.sodium-crypto-pwhash-str-verify.php       30-Sep-2022 11:00                4500
function.sodium-crypto-pwhash-str.php              30-Sep-2022 11:00                7906
function.sodium-crypto-pwhash.php                  30-Sep-2022 11:00                9410
function.sodium-crypto-scalarmult-base.php         30-Sep-2022 11:00                2012
function.sodium-crypto-scalarmult-ristretto255-..> 30-Sep-2022 11:00                3340
function.sodium-crypto-scalarmult-ristretto255.php 30-Sep-2022 11:00                3633
function.sodium-crypto-scalarmult.php              30-Sep-2022 11:00                2857
function.sodium-crypto-secretbox-keygen.php        30-Sep-2022 11:00                6269
function.sodium-crypto-secretbox-open.php          30-Sep-2022 11:00                8560
function.sodium-crypto-secretbox.php               30-Sep-2022 11:00                8501
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:00               11630
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:00               10782
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:00                2617
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:00                5492
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:00                5591
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:00                2855
function.sodium-crypto-shorthash-keygen.php        30-Sep-2022 11:00                2594
function.sodium-crypto-shorthash.php               30-Sep-2022 11:00                2969
function.sodium-crypto-sign-detached.php           30-Sep-2022 11:00                2962
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-Sep-2022 11:00                2802
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-Sep-2022 11:00                2858
function.sodium-crypto-sign-keypair-from-secret..> 30-Sep-2022 11:00                3041
function.sodium-crypto-sign-keypair.php            30-Sep-2022 11:00                2339
function.sodium-crypto-sign-open.php               30-Sep-2022 11:00                3060
function.sodium-crypto-sign-publickey-from-secr..> 30-Sep-2022 11:00                2660
function.sodium-crypto-sign-publickey.php          30-Sep-2022 11:00                2670
function.sodium-crypto-sign-secretkey.php          30-Sep-2022 11:00                2646
function.sodium-crypto-sign-seed-keypair.php       30-Sep-2022 11:00                2879
function.sodium-crypto-sign-verify-detached.php    30-Sep-2022 11:00                3275
function.sodium-crypto-sign.php                    30-Sep-2022 11:00                3040
function.sodium-crypto-stream-keygen.php           30-Sep-2022 11:00                2522
function.sodium-crypto-stream-xchacha20-keygen.php 30-Sep-2022 11:00                2680
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-Sep-2022 11:00                9432
function.sodium-crypto-stream-xchacha20-xor.php    30-Sep-2022 11:00                4441
function.sodium-crypto-stream-xchacha20.php        30-Sep-2022 11:00                3442
function.sodium-crypto-stream-xor.php              30-Sep-2022 11:00                3226
function.sodium-crypto-stream.php                  30-Sep-2022 11:00                3161
function.sodium-hex2bin.php                        30-Sep-2022 11:00                3088
function.sodium-increment.php                      30-Sep-2022 11:00                2395
function.sodium-memcmp.php                         30-Sep-2022 11:00                3196
function.sodium-memzero.php                        30-Sep-2022 11:00                2390
function.sodium-pad.php                            30-Sep-2022 11:00                2539
function.sodium-unpad.php                          30-Sep-2022 11:00                2494
function.solr-get-version.php                      30-Sep-2022 11:01                3804
function.sort.php                                  30-Sep-2022 11:01               11114
function.soundex.php                               30-Sep-2022 11:01                7370
function.spl-autoload-call.php                     30-Sep-2022 11:01                2524
function.spl-autoload-extensions.php               30-Sep-2022 11:01                4712
function.spl-autoload-functions.php                30-Sep-2022 11:01                2434
function.spl-autoload-register.php                 30-Sep-2022 11:01               10582
function.spl-autoload-unregister.php               30-Sep-2022 11:01                2889
function.spl-autoload.php                          30-Sep-2022 11:01                4272
function.spl-classes.php                           30-Sep-2022 11:01                3630
function.spl-object-hash.php                       30-Sep-2022 11:01                4486
function.spl-object-id.php                         30-Sep-2022 11:01                4014
function.sprintf.php                               30-Sep-2022 11:01               25307
function.sqlsrv-begin-transaction.php              30-Sep-2022 11:00               12028
function.sqlsrv-cancel.php                         30-Sep-2022 11:00               10707
function.sqlsrv-client-info.php                    30-Sep-2022 11:00                6897
function.sqlsrv-close.php                          30-Sep-2022 11:00                5527
function.sqlsrv-commit.php                         30-Sep-2022 11:00               11872
function.sqlsrv-configure.php                      30-Sep-2022 11:00                4441
function.sqlsrv-connect.php                        30-Sep-2022 11:00               12717
function.sqlsrv-errors.php                         30-Sep-2022 11:00               10654
function.sqlsrv-execute.php                        30-Sep-2022 11:00               10825
function.sqlsrv-fetch-array.php                    30-Sep-2022 11:00               15220
function.sqlsrv-fetch-object.php                   30-Sep-2022 11:00               12446
function.sqlsrv-fetch.php                          30-Sep-2022 11:00               11175
function.sqlsrv-field-metadata.php                 30-Sep-2022 11:00                8989
function.sqlsrv-free-stmt.php                      30-Sep-2022 11:00                7732
function.sqlsrv-get-config.php                     30-Sep-2022 11:00                3251
function.sqlsrv-get-field.php                      30-Sep-2022 11:00               10693
function.sqlsrv-has-rows.php                       30-Sep-2022 11:00                6454
function.sqlsrv-next-result.php                    30-Sep-2022 11:00                9617
function.sqlsrv-num-fields.php                     30-Sep-2022 11:00                8574
function.sqlsrv-num-rows.php                       30-Sep-2022 11:00                8089
function.sqlsrv-prepare.php                        30-Sep-2022 11:00               14941
function.sqlsrv-query.php                          30-Sep-2022 11:00               11679
function.sqlsrv-rollback.php                       30-Sep-2022 11:00               11342
function.sqlsrv-rows-affected.php                  30-Sep-2022 11:00                8206
function.sqlsrv-send-stream-data.php               30-Sep-2022 11:00                8959
function.sqlsrv-server-info.php                    30-Sep-2022 11:00                6324
function.sqrt.php                                  30-Sep-2022 11:00                4297
function.srand.php                                 30-Sep-2022 11:00                6514
function.sscanf.php                                30-Sep-2022 11:01               11709
function.ssdeep-fuzzy-compare.php                  30-Sep-2022 11:01                3024
function.ssdeep-fuzzy-hash-filename.php            30-Sep-2022 11:01                2800
function.ssdeep-fuzzy-hash.php                     30-Sep-2022 11:01                2642
function.ssh2-auth-agent.php                       30-Sep-2022 11:01                4530
function.ssh2-auth-hostbased-file.php              30-Sep-2022 11:01                7706
function.ssh2-auth-none.php                        30-Sep-2022 11:01                4803
function.ssh2-auth-password.php                    30-Sep-2022 11:01                4741
function.ssh2-auth-pubkey-file.php                 30-Sep-2022 11:01                7129
function.ssh2-connect.php                          30-Sep-2022 11:01               15823
function.ssh2-disconnect.php                       30-Sep-2022 11:01                2851
function.ssh2-exec.php                             30-Sep-2022 11:01                7036
function.ssh2-fetch-stream.php                     30-Sep-2022 11:01                5379
function.ssh2-fingerprint.php                      30-Sep-2022 11:01                5293
function.ssh2-forward-accept.php                   30-Sep-2022 11:01                2829
function.ssh2-forward-listen.php                   30-Sep-2022 11:01                4121
function.ssh2-methods-negotiated.php               30-Sep-2022 11:01                8128
function.ssh2-poll.php                             30-Sep-2022 11:01                3356
function.ssh2-publickey-add.php                    30-Sep-2022 11:01                8031
function.ssh2-publickey-init.php                   30-Sep-2022 11:01                4438
function.ssh2-publickey-list.php                   30-Sep-2022 11:01                8873
function.ssh2-publickey-remove.php                 30-Sep-2022 11:01                4394
function.ssh2-scp-recv.php                         30-Sep-2022 11:01                5169
function.ssh2-scp-send.php                         30-Sep-2022 11:01                5731
function.ssh2-send-eof.php                         30-Sep-2022 11:01                3204
function.ssh2-sftp-chmod.php                       30-Sep-2022 11:01                5706
function.ssh2-sftp-lstat.php                       30-Sep-2022 11:01                7272
function.ssh2-sftp-mkdir.php                       30-Sep-2022 11:01                6425
function.ssh2-sftp-readlink.php                    30-Sep-2022 11:01                5260
function.ssh2-sftp-realpath.php                    30-Sep-2022 11:01                5494
function.ssh2-sftp-rename.php                      30-Sep-2022 11:01                5264
function.ssh2-sftp-rmdir.php                       30-Sep-2022 11:01                5342
function.ssh2-sftp-stat.php                        30-Sep-2022 11:01                7170
function.ssh2-sftp-symlink.php                     30-Sep-2022 11:01                5477
function.ssh2-sftp-unlink.php                      30-Sep-2022 11:01                4784
function.ssh2-sftp.php                             30-Sep-2022 11:01                5347
function.ssh2-shell.php                            30-Sep-2022 11:01                7490
function.ssh2-tunnel.php                           30-Sep-2022 11:01                5162
function.stat.php                                  30-Sep-2022 11:00               16654
function.stats-absolute-deviation.php              30-Sep-2022 11:00                2640
function.stats-cdf-beta.php                        30-Sep-2022 11:00                4894
function.stats-cdf-binomial.php                    30-Sep-2022 11:00                4879
function.stats-cdf-cauchy.php                      30-Sep-2022 11:00                4914
function.stats-cdf-chisquare.php                   30-Sep-2022 11:00                4287
function.stats-cdf-exponential.php                 30-Sep-2022 11:00                4318
function.stats-cdf-f.php                           30-Sep-2022 11:00                4819
function.stats-cdf-gamma.php                       30-Sep-2022 11:00                4878
function.stats-cdf-laplace.php                     30-Sep-2022 11:00                4899
function.stats-cdf-logistic.php                    30-Sep-2022 11:00                4934
function.stats-cdf-negative-binomial.php           30-Sep-2022 11:00                5022
function.stats-cdf-noncentral-chisquare.php        30-Sep-2022 11:00                5124
function.stats-cdf-noncentral-f.php                30-Sep-2022 11:00                5644
function.stats-cdf-noncentral-t.php                30-Sep-2022 11:00                4984
function.stats-cdf-normal.php                      30-Sep-2022 11:00                4916
function.stats-cdf-poisson.php                     30-Sep-2022 11:00                4252
function.stats-cdf-t.php                           30-Sep-2022 11:00                4180
function.stats-cdf-uniform.php                     30-Sep-2022 11:00                4879
function.stats-cdf-weibull.php                     30-Sep-2022 11:00                4916
function.stats-covariance.php                      30-Sep-2022 11:00                2783
function.stats-dens-beta.php                       30-Sep-2022 11:00                3215
function.stats-dens-cauchy.php                     30-Sep-2022 11:00                3273
function.stats-dens-chisquare.php                  30-Sep-2022 11:00                2997
function.stats-dens-exponential.php                30-Sep-2022 11:00                2987
function.stats-dens-f.php                          30-Sep-2022 11:00                3213
function.stats-dens-gamma.php                      30-Sep-2022 11:00                3266
function.stats-dens-laplace.php                    30-Sep-2022 11:00                3300
function.stats-dens-logistic.php                   30-Sep-2022 11:00                3312
function.stats-dens-normal.php                     30-Sep-2022 11:00                3283
function.stats-dens-pmf-binomial.php               30-Sep-2022 11:00                3337
function.stats-dens-pmf-hypergeometric.php         30-Sep-2022 11:00                3935
function.stats-dens-pmf-negative-binomial.php      30-Sep-2022 11:00                3466
function.stats-dens-pmf-poisson.php                30-Sep-2022 11:00                2988
function.stats-dens-t.php                          30-Sep-2022 11:00                2901
function.stats-dens-uniform.php                    30-Sep-2022 11:00                3248
function.stats-dens-weibull.php                    30-Sep-2022 11:00                3280
function.stats-harmonic-mean.php                   30-Sep-2022 11:00                2627
function.stats-kurtosis.php                        30-Sep-2022 11:00                2544
function.stats-rand-gen-beta.php                   30-Sep-2022 11:00                2848
function.stats-rand-gen-chisquare.php              30-Sep-2022 11:00                2575
function.stats-rand-gen-exponential.php            30-Sep-2022 11:00                2573
function.stats-rand-gen-f.php                      30-Sep-2022 11:00                2902
function.stats-rand-gen-funiform.php               30-Sep-2022 11:00                2829
function.stats-rand-gen-gamma.php                  30-Sep-2022 11:00                2915
function.stats-rand-gen-ibinomial-negative.php     30-Sep-2022 11:00                2995
function.stats-rand-gen-ibinomial.php              30-Sep-2022 11:00                2919
function.stats-rand-gen-int.php                    30-Sep-2022 11:00                2194
function.stats-rand-gen-ipoisson.php               30-Sep-2022 11:00                2548
function.stats-rand-gen-iuniform.php               30-Sep-2022 11:00                2896
function.stats-rand-gen-noncentral-chisquare.php   30-Sep-2022 11:00                3037
function.stats-rand-gen-noncentral-f.php           30-Sep-2022 11:00                3336
function.stats-rand-gen-noncentral-t.php           30-Sep-2022 11:00                2950
function.stats-rand-gen-normal.php                 30-Sep-2022 11:00                2863
function.stats-rand-gen-t.php                      30-Sep-2022 11:00                2467
function.stats-rand-get-seeds.php                  30-Sep-2022 11:00                2237
function.stats-rand-phrase-to-seeds.php            30-Sep-2022 11:00                2554
function.stats-rand-ranf.php                       30-Sep-2022 11:00                2238
function.stats-rand-setall.php                     30-Sep-2022 11:00                2804
function.stats-skew.php                            30-Sep-2022 11:00                2510
function.stats-standard-deviation.php              30-Sep-2022 11:00                3406
function.stats-stat-binomial-coef.php              30-Sep-2022 11:00                2808
function.stats-stat-correlation.php                30-Sep-2022 11:00                2963
function.stats-stat-factorial.php                  30-Sep-2022 11:00                2435
function.stats-stat-independent-t.php              30-Sep-2022 11:00                3074
function.stats-stat-innerproduct.php               30-Sep-2022 11:00                2905
function.stats-stat-paired-t.php                   30-Sep-2022 11:00                2842
function.stats-stat-percentile.php                 30-Sep-2022 11:00                2760
function.stats-stat-powersum.php                   30-Sep-2022 11:00                2752
function.stats-variance.php                        30-Sep-2022 11:00                2964
function.stomp-connect-error.php                   30-Sep-2022 11:01                3600
function.stomp-version.php                         30-Sep-2022 11:01                3024
function.str-contains.php                          30-Sep-2022 11:01                8403
function.str-ends-with.php                         30-Sep-2022 11:01                8278
function.str-getcsv.php                            30-Sep-2022 11:01                7415
function.str-ireplace.php                          30-Sep-2022 11:01                8320
function.str-pad.php                               30-Sep-2022 11:01                7833
function.str-repeat.php                            30-Sep-2022 11:01                4543
function.str-replace.php                           30-Sep-2022 11:01               17575
function.str-rot13.php                             30-Sep-2022 11:01                3496
function.str-shuffle.php                           30-Sep-2022 11:01                5450
function.str-split.php                             30-Sep-2022 11:01                8108
function.str-starts-with.php                       30-Sep-2022 11:01                8308
function.str-word-count.php                        30-Sep-2022 11:01                8925
function.strcasecmp.php                            30-Sep-2022 11:01                5617
function.strchr.php                                30-Sep-2022 11:01                1622
function.strcmp.php                                30-Sep-2022 11:01                5444
function.strcoll.php                               30-Sep-2022 11:01                4980
function.strcspn.php                               30-Sep-2022 11:01               11283
function.stream-bucket-append.php                  30-Sep-2022 11:01                2104
function.stream-bucket-make-writeable.php          30-Sep-2022 11:01                4068
function.stream-bucket-new.php                     30-Sep-2022 11:01                2100
function.stream-bucket-prepend.php                 30-Sep-2022 11:01                6604
function.stream-context-create.php                 30-Sep-2022 11:01                7530
function.stream-context-get-default.php            30-Sep-2022 11:01                9166
function.stream-context-get-options.php            30-Sep-2022 11:01                4458
function.stream-context-get-params.php             30-Sep-2022 11:01                5308
function.stream-context-set-default.php            30-Sep-2022 11:01                6448
function.stream-context-set-option.php             30-Sep-2022 11:01                5022
function.stream-context-set-params.php             30-Sep-2022 11:01                4384
function.stream-copy-to-stream.php                 30-Sep-2022 11:01                7347
function.stream-filter-append.php                  30-Sep-2022 11:01               10867
function.stream-filter-prepend.php                 30-Sep-2022 11:01                7632
function.stream-filter-register.php                30-Sep-2022 11:01               19775
function.stream-filter-remove.php                  30-Sep-2022 11:01                6540
function.stream-get-contents.php                   30-Sep-2022 11:01                8239
function.stream-get-filters.php                    30-Sep-2022 11:01                3983
function.stream-get-line.php                       30-Sep-2022 11:01                4715
function.stream-get-meta-data.php                  30-Sep-2022 11:01               14893
function.stream-get-transports.php                 30-Sep-2022 11:01                3969
function.stream-get-wrappers.php                   30-Sep-2022 11:01                4868
function.stream-is-local.php                       30-Sep-2022 11:01                3870
function.stream-isatty.php                         30-Sep-2022 11:01                3751
function.stream-notification-callback.php          30-Sep-2022 11:01               25257
function.stream-register-wrapper.php               30-Sep-2022 11:01                1887
function.stream-resolve-include-path.php           30-Sep-2022 11:01                4067
function.stream-select.php                         30-Sep-2022 11:01               15847
function.stream-set-blocking.php                   30-Sep-2022 11:01                4418
function.stream-set-chunk-size.php                 30-Sep-2022 11:01                3178
function.stream-set-read-buffer.php                30-Sep-2022 11:01                3555
function.stream-set-timeout.php                    30-Sep-2022 11:01                8090
function.stream-set-write-buffer.php               30-Sep-2022 11:01                5816
function.stream-socket-accept.php                  30-Sep-2022 11:01                7208
function.stream-socket-client.php                  30-Sep-2022 11:01               17187
function.stream-socket-enable-crypto.php           30-Sep-2022 11:01               11197
function.stream-socket-get-name.php                30-Sep-2022 11:01                3521
function.stream-socket-pair.php                    30-Sep-2022 11:01                9085
function.stream-socket-recvfrom.php                30-Sep-2022 11:01               10712
function.stream-socket-sendto.php                  30-Sep-2022 11:01                7293
function.stream-socket-server.php                  30-Sep-2022 11:01               15116
function.stream-socket-shutdown.php                30-Sep-2022 11:01                6179
function.stream-supports-lock.php                  30-Sep-2022 11:01                2983
function.stream-wrapper-register.php               30-Sep-2022 11:01                9099
function.stream-wrapper-restore.php                30-Sep-2022 11:01                2674
function.stream-wrapper-unregister.php             30-Sep-2022 11:01                2875
function.strftime.php                              30-Sep-2022 11:00               60944
function.strip-tags.php                            30-Sep-2022 11:01                9041
function.stripcslashes.php                         30-Sep-2022 11:01                3937
function.stripos.php                               30-Sep-2022 11:01               11516
function.stripslashes.php                          30-Sep-2022 11:01                7758
function.stristr.php                               30-Sep-2022 11:01                9825
function.strlen.php                                30-Sep-2022 11:01                5336
function.strnatcasecmp.php                         30-Sep-2022 11:01                6857
function.strnatcmp.php                             30-Sep-2022 11:01                8162
function.strncasecmp.php                           30-Sep-2022 11:01                6209
function.strncmp.php                               30-Sep-2022 11:01                6202
function.strpbrk.php                               30-Sep-2022 11:01                5238
function.strpos.php                                30-Sep-2022 11:01               14189
function.strptime.php                              30-Sep-2022 11:00               11380
function.strrchr.php                               30-Sep-2022 11:01                7087
function.strrev.php                                30-Sep-2022 11:01                3081
function.strripos.php                              30-Sep-2022 11:01               10078
function.strrpos.php                               30-Sep-2022 11:01               13247
function.strspn.php                                30-Sep-2022 11:01               10658
function.strstr.php                                30-Sep-2022 11:01                8215
function.strtok.php                                30-Sep-2022 11:01               12582
function.strtolower.php                            30-Sep-2022 11:01                4954
function.strtotime.php                             30-Sep-2022 11:00               12748
function.strtoupper.php                            30-Sep-2022 11:01                4944
function.strtr.php                                 30-Sep-2022 11:01               11087
function.strval.php                                30-Sep-2022 11:01                6251
function.substr-compare.php                        30-Sep-2022 11:01               10340
function.substr-count.php                          30-Sep-2022 11:01                9544
function.substr-replace.php                        30-Sep-2022 11:01               16231
function.substr.php                                30-Sep-2022 11:01               23371
function.svn-add.php                               30-Sep-2022 11:01                5895
function.svn-auth-get-parameter.php                30-Sep-2022 11:01                3826
function.svn-auth-set-parameter.php                30-Sep-2022 11:01                5320
function.svn-blame.php                             30-Sep-2022 11:01                4789
function.svn-cat.php                               30-Sep-2022 11:01                4665
function.svn-checkout.php                          30-Sep-2022 11:01                7123
function.svn-cleanup.php                           30-Sep-2022 11:01                4997
function.svn-client-version.php                    30-Sep-2022 11:01                3414
function.svn-commit.php                            30-Sep-2022 11:01                7725
function.svn-delete.php                            30-Sep-2022 11:01                4317
function.svn-diff.php                              30-Sep-2022 11:01               13314
function.svn-export.php                            30-Sep-2022 11:01                4912
function.svn-fs-abort-txn.php                      30-Sep-2022 11:01                2967
function.svn-fs-apply-text.php                     30-Sep-2022 11:01                2595
function.svn-fs-begin-txn2.php                     30-Sep-2022 11:01                2540
function.svn-fs-change-node-prop.php               30-Sep-2022 11:01                2951
function.svn-fs-check-path.php                     30-Sep-2022 11:01                2646
function.svn-fs-contents-changed.php               30-Sep-2022 11:01                2952
function.svn-fs-copy.php                           30-Sep-2022 11:01                3788
function.svn-fs-delete.php                         30-Sep-2022 11:01                3189
function.svn-fs-dir-entries.php                    30-Sep-2022 11:01                2659
function.svn-fs-file-contents.php                  30-Sep-2022 11:01                2676
function.svn-fs-file-length.php                    30-Sep-2022 11:01                2605
function.svn-fs-is-dir.php                         30-Sep-2022 11:01                3249
function.svn-fs-is-file.php                        30-Sep-2022 11:01                3237
function.svn-fs-make-dir.php                       30-Sep-2022 11:01                3213
function.svn-fs-make-file.php                      30-Sep-2022 11:01                3230
function.svn-fs-node-created-rev.php               30-Sep-2022 11:01                2648
function.svn-fs-node-prop.php                      30-Sep-2022 11:01                2684
function.svn-fs-props-changed.php                  30-Sep-2022 11:01                2939
function.svn-fs-revision-prop.php                  30-Sep-2022 11:01                2699
function.svn-fs-revision-root.php                  30-Sep-2022 11:01                2623
function.svn-fs-txn-root.php                       30-Sep-2022 11:01                2446
function.svn-fs-youngest-rev.php                   30-Sep-2022 11:01                2494
function.svn-import.php                            30-Sep-2022 11:01                5734
function.svn-log.php                               30-Sep-2022 11:01                8718
function.svn-ls.php                                30-Sep-2022 11:01                6987
function.svn-mkdir.php                             30-Sep-2022 11:01                2992
function.svn-repos-create.php                      30-Sep-2022 11:01                2754
function.svn-repos-fs-begin-txn-for-commit.php     30-Sep-2022 11:01                3008
function.svn-repos-fs-commit-txn.php               30-Sep-2022 11:01                2549
function.svn-repos-fs.php                          30-Sep-2022 11:01                2443
function.svn-repos-hotcopy.php                     30-Sep-2022 11:01                2702
function.svn-repos-open.php                        30-Sep-2022 11:01                2419
function.svn-repos-recover.php                     30-Sep-2022 11:01                2468
function.svn-revert.php                            30-Sep-2022 11:01                3282
function.svn-status.php                            30-Sep-2022 11:01               14519
function.svn-update.php                            30-Sep-2022 11:01                5870
function.swoole-async-dns-lookup.php               30-Sep-2022 11:01                3541
function.swoole-async-read.php                     30-Sep-2022 11:01                4157
function.swoole-async-readfile.php                 30-Sep-2022 11:01                3563
function.swoole-async-set.php                      30-Sep-2022 11:01                2314
function.swoole-async-write.php                    30-Sep-2022 11:01                3403
function.swoole-async-writefile.php                30-Sep-2022 11:01                3431
function.swoole-clear-error.php                    30-Sep-2022 11:01                2225
function.swoole-client-select.php                  30-Sep-2022 11:01                3204
function.swoole-cpu-num.php                        30-Sep-2022 11:01                2046
function.swoole-errno.php                          30-Sep-2022 11:01                2023
function.swoole-error-log.php                      30-Sep-2022 11:01                2981
function.swoole-event-add.php                      30-Sep-2022 11:01                3327
function.swoole-event-defer.php                    30-Sep-2022 11:01                2452
function.swoole-event-del.php                      30-Sep-2022 11:01                2360
function.swoole-event-exit.php                     30-Sep-2022 11:01                2122
function.swoole-event-set.php                      30-Sep-2022 11:01                3314
function.swoole-event-wait.php                     30-Sep-2022 11:01                2093
function.swoole-event-write.php                    30-Sep-2022 11:01                2576
function.swoole-get-local-ip.php                   30-Sep-2022 11:01                2117
function.swoole-last-error.php                     30-Sep-2022 11:01                2072
function.swoole-load-module.php                    30-Sep-2022 11:01                2269
function.swoole-select.php                         30-Sep-2022 11:01                3171
function.swoole-set-process-name.php               30-Sep-2022 11:01                2479
function.swoole-strerror.php                       30-Sep-2022 11:01                2400
function.swoole-timer-after.php                    30-Sep-2022 11:01                2933
function.swoole-timer-exists.php                   30-Sep-2022 11:01                2296
function.swoole-timer-tick.php                     30-Sep-2022 11:01                2806
function.swoole-version.php                        30-Sep-2022 11:01                2049
function.symlink.php                               30-Sep-2022 11:00                5226
function.sys-get-temp-dir.php                      30-Sep-2022 11:00                4132
function.sys-getloadavg.php                        30-Sep-2022 11:01                4069
function.syslog.php                                30-Sep-2022 11:01                9027
function.system.php                                30-Sep-2022 11:01                7665
function.taint.php                                 30-Sep-2022 11:01                2482
function.tan.php                                   30-Sep-2022 11:00                4226
function.tanh.php                                  30-Sep-2022 11:00                3085
function.tcpwrap-check.php                         30-Sep-2022 11:01                5368
function.tempnam.php                               30-Sep-2022 11:00                6939
function.textdomain.php                            30-Sep-2022 11:00                3017
function.tidy-access-count.php                     30-Sep-2022 11:01                6521
function.tidy-config-count.php                     30-Sep-2022 11:01                4348
function.tidy-error-count.php                      30-Sep-2022 11:01                5306
function.tidy-get-output.php                       30-Sep-2022 11:01                4205
function.tidy-warning-count.php                    30-Sep-2022 11:01                4909
function.time-nanosleep.php                        30-Sep-2022 11:01                8803
function.time-sleep-until.php                      30-Sep-2022 11:01                5592
function.time.php                                  30-Sep-2022 11:00                4530
function.timezone-abbreviations-list.php           30-Sep-2022 11:00                1886
function.timezone-identifiers-list.php             30-Sep-2022 11:00                1902
function.timezone-location-get.php                 30-Sep-2022 11:00                1858
function.timezone-name-from-abbr.php               30-Sep-2022 11:00                5963
function.timezone-name-get.php                     30-Sep-2022 11:00                1802
function.timezone-offset-get.php                   30-Sep-2022 11:00                1800
function.timezone-open.php                         30-Sep-2022 11:00                1788
function.timezone-transitions-get.php              30-Sep-2022 11:00                1861
function.timezone-version-get.php                  30-Sep-2022 11:00                4216
function.tmpfile.php                               30-Sep-2022 11:00                5309
function.token-get-all.php                         30-Sep-2022 11:01               12048
function.token-name.php                            30-Sep-2022 11:01                4212
function.touch.php                                 30-Sep-2022 11:00                7718
function.trader-acos.php                           30-Sep-2022 11:00                2340
function.trader-ad.php                             30-Sep-2022 11:00                3092
function.trader-add.php                            30-Sep-2022 11:00                2617
function.trader-adosc.php                          30-Sep-2022 11:00                3844
function.trader-adx.php                            30-Sep-2022 11:00                3178
function.trader-adxr.php                           30-Sep-2022 11:00                3189
function.trader-apo.php                            30-Sep-2022 11:00                3378
function.trader-aroon.php                          30-Sep-2022 11:00                2800
function.trader-aroonosc.php                       30-Sep-2022 11:00                2837
function.trader-asin.php                           30-Sep-2022 11:00                2355
function.trader-atan.php                           30-Sep-2022 11:00                2348
function.trader-atr.php                            30-Sep-2022 11:00                3168
function.trader-avgprice.php                       30-Sep-2022 11:00                3149
function.trader-bbands.php                         30-Sep-2022 11:00                4083
function.trader-beta.php                           30-Sep-2022 11:00                2768
function.trader-bop.php                            30-Sep-2022 11:00                3098
function.trader-cci.php                            30-Sep-2022 11:00                3173
function.trader-cdl2crows.php                      30-Sep-2022 11:00                3171
function.trader-cdl3blackcrows.php                 30-Sep-2022 11:00                3233
function.trader-cdl3inside.php                     30-Sep-2022 11:00                3214
function.trader-cdl3linestrike.php                 30-Sep-2022 11:00                3237
function.trader-cdl3outside.php                    30-Sep-2022 11:00                3229
function.trader-cdl3starsinsouth.php               30-Sep-2022 11:00                3278
function.trader-cdl3whitesoldiers.php              30-Sep-2022 11:00                3302
function.trader-cdlabandonedbaby.php               30-Sep-2022 11:00                3636
function.trader-cdladvanceblock.php                30-Sep-2022 11:00                3255
function.trader-cdlbelthold.php                    30-Sep-2022 11:00                3211
function.trader-cdlbreakaway.php                   30-Sep-2022 11:00                3225
function.trader-cdlclosingmarubozu.php             30-Sep-2022 11:00                3296
function.trader-cdlconcealbabyswall.php            30-Sep-2022 11:00                3319
function.trader-cdlcounterattack.php               30-Sep-2022 11:00                3283
function.trader-cdldarkcloudcover.php              30-Sep-2022 11:00                3630
function.trader-cdldoji.php                        30-Sep-2022 11:00                3168
function.trader-cdldojistar.php                    30-Sep-2022 11:00                3203
function.trader-cdldragonflydoji.php               30-Sep-2022 11:00                3258
function.trader-cdlengulfing.php                   30-Sep-2022 11:00                3243
function.trader-cdleveningdojistar.php             30-Sep-2022 11:00                3647
function.trader-cdleveningstar.php                 30-Sep-2022 11:00                3624
function.trader-cdlgapsidesidewhite.php            30-Sep-2022 11:00                3326
function.trader-cdlgravestonedoji.php              30-Sep-2022 11:00                3279
function.trader-cdlhammer.php                      30-Sep-2022 11:00                3194
function.trader-cdlhangingman.php                  30-Sep-2022 11:00                3215
function.trader-cdlharami.php                      30-Sep-2022 11:00                3196
function.trader-cdlharamicross.php                 30-Sep-2022 11:00                3238
function.trader-cdlhighwave.php                    30-Sep-2022 11:00                3212
function.trader-cdlhikkake.php                     30-Sep-2022 11:00                3201
function.trader-cdlhikkakemod.php                  30-Sep-2022 11:00                3242
function.trader-cdlhomingpigeon.php                30-Sep-2022 11:00                3263
function.trader-cdlidentical3crows.php             30-Sep-2022 11:00                3287
function.trader-cdlinneck.php                      30-Sep-2022 11:00                3213
function.trader-cdlinvertedhammer.php              30-Sep-2022 11:00                3261
function.trader-cdlkicking.php                     30-Sep-2022 11:00                3215
function.trader-cdlkickingbylength.php             30-Sep-2022 11:00                3321
function.trader-cdlladderbottom.php                30-Sep-2022 11:00                3271
function.trader-cdllongleggeddoji.php              30-Sep-2022 11:00                3276
function.trader-cdllongline.php                    30-Sep-2022 11:00                3220
function.trader-cdlmarubozu.php                    30-Sep-2022 11:00                3206
function.trader-cdlmatchinglow.php                 30-Sep-2022 11:00                3232
function.trader-cdlmathold.php                     30-Sep-2022 11:00                3570
function.trader-cdlmorningdojistar.php             30-Sep-2022 11:00                3643
function.trader-cdlmorningstar.php                 30-Sep-2022 11:00                3604
function.trader-cdlonneck.php                      30-Sep-2022 11:00                3193
function.trader-cdlpiercing.php                    30-Sep-2022 11:00                3210
function.trader-cdlrickshawman.php                 30-Sep-2022 11:00                3250
function.trader-cdlrisefall3methods.php            30-Sep-2022 11:00                3320
function.trader-cdlseparatinglines.php             30-Sep-2022 11:00                3302
function.trader-cdlshootingstar.php                30-Sep-2022 11:00                3261
function.trader-cdlshortline.php                   30-Sep-2022 11:00                3233
function.trader-cdlspinningtop.php                 30-Sep-2022 11:00                3248
function.trader-cdlstalledpattern.php              30-Sep-2022 11:00                3283
function.trader-cdlsticksandwich.php               30-Sep-2022 11:00                3264
function.trader-cdltakuri.php                      30-Sep-2022 11:00                3235
function.trader-cdltasukigap.php                   30-Sep-2022 11:00                3210
function.trader-cdlthrusting.php                   30-Sep-2022 11:00                3219
function.trader-cdltristar.php                     30-Sep-2022 11:00                3207
function.trader-cdlunique3river.php                30-Sep-2022 11:00                3258
function.trader-cdlupsidegap2crows.php             30-Sep-2022 11:00                3306
function.trader-cdlxsidegap3methods.php            30-Sep-2022 11:00                3305
function.trader-ceil.php                           30-Sep-2022 11:00                2372
function.trader-cmo.php                            30-Sep-2022 11:00                2535
function.trader-correl.php                         30-Sep-2022 11:00                2820
function.trader-cos.php                            30-Sep-2022 11:00                2338
function.trader-cosh.php                           30-Sep-2022 11:00                2354
function.trader-dema.php                           30-Sep-2022 11:00                2546
function.trader-div.php                            30-Sep-2022 11:00                2633
function.trader-dx.php                             30-Sep-2022 11:00                3154
function.trader-ema.php                            30-Sep-2022 11:00                2529
function.trader-errno.php                          30-Sep-2022 11:00                2116
function.trader-exp.php                            30-Sep-2022 11:00                2382
function.trader-floor.php                          30-Sep-2022 11:00                2364
function.trader-get-compat.php                     30-Sep-2022 11:00                2306
function.trader-get-unstable-period.php            30-Sep-2022 11:00                2586
function.trader-ht-dcperiod.php                    30-Sep-2022 11:00                2352
function.trader-ht-dcphase.php                     30-Sep-2022 11:00                2323
function.trader-ht-phasor.php                      30-Sep-2022 11:00                2304
function.trader-ht-sine.php                        30-Sep-2022 11:00                2283
function.trader-ht-trendline.php                   30-Sep-2022 11:00                2344
function.trader-ht-trendmode.php                   30-Sep-2022 11:00                2334
function.trader-kama.php                           30-Sep-2022 11:00                2584
function.trader-linearreg-angle.php                30-Sep-2022 11:00                2678
function.trader-linearreg-intercept.php            30-Sep-2022 11:00                2736
function.trader-linearreg-slope.php                30-Sep-2022 11:00                2688
function.trader-linearreg.php                      30-Sep-2022 11:00                2600
function.trader-ln.php                             30-Sep-2022 11:00                2340
function.trader-log10.php                          30-Sep-2022 11:00                2344
function.trader-ma.php                             30-Sep-2022 11:00                2896
function.trader-macd.php                           30-Sep-2022 11:00                3363
function.trader-macdext.php                        30-Sep-2022 11:00                4694
function.trader-macdfix.php                        30-Sep-2022 11:00                2630
function.trader-mama.php                           30-Sep-2022 11:00                2917
function.trader-mavp.php                           30-Sep-2022 11:00                3716
function.trader-max.php                            30-Sep-2022 11:00                2550
function.trader-maxindex.php                       30-Sep-2022 11:00                2607
function.trader-medprice.php                       30-Sep-2022 11:00                2521
function.trader-mfi.php                            30-Sep-2022 11:00                3463
function.trader-midpoint.php                       30-Sep-2022 11:00                2581
function.trader-midprice.php                       30-Sep-2022 11:00                2851
function.trader-min.php                            30-Sep-2022 11:00                2557
function.trader-minindex.php                       30-Sep-2022 11:00                2602
function.trader-minmax.php                         30-Sep-2022 11:00                2606
function.trader-minmaxindex.php                    30-Sep-2022 11:00                2657
function.trader-minus-di.php                       30-Sep-2022 11:00                3241
function.trader-minus-dm.php                       30-Sep-2022 11:00                2851
function.trader-mom.php                            30-Sep-2022 11:00                2521
function.trader-mult.php                           30-Sep-2022 11:00                2633
function.trader-natr.php                           30-Sep-2022 11:00                3179
function.trader-obv.php                            30-Sep-2022 11:00                2474
function.trader-plus-di.php                        30-Sep-2022 11:00                3212
function.trader-plus-dm.php                        30-Sep-2022 11:00                2838
function.trader-ppo.php                            30-Sep-2022 11:00                3382
function.trader-roc.php                            30-Sep-2022 11:00                2545
function.trader-rocp.php                           30-Sep-2022 11:00                2573
function.trader-rocr.php                           30-Sep-2022 11:00                2558
function.trader-rocr100.php                        30-Sep-2022 11:00                2598
function.trader-rsi.php                            30-Sep-2022 11:00                2526
function.trader-sar.php                            30-Sep-2022 11:00                3428
function.trader-sarext.php                         30-Sep-2022 11:00                6516
function.trader-set-compat.php                     30-Sep-2022 11:00                2523
function.trader-set-unstable-period.php            30-Sep-2022 11:00                3057
function.trader-sin.php                            30-Sep-2022 11:00                2362
function.trader-sinh.php                           30-Sep-2022 11:00                2350
function.trader-sma.php                            30-Sep-2022 11:00                2526
function.trader-sqrt.php                           30-Sep-2022 11:00                2343
function.trader-stddev.php                         30-Sep-2022 11:00                2816
function.trader-stoch.php                          30-Sep-2022 11:00                4830
function.trader-stochf.php                         30-Sep-2022 11:00                4045
function.trader-stochrsi.php                       30-Sep-2022 11:00                3841
function.trader-sub.php                            30-Sep-2022 11:00                2638
function.trader-sum.php                            30-Sep-2022 11:00                2508
function.trader-t3.php                             30-Sep-2022 11:00                2833
function.trader-tan.php                            30-Sep-2022 11:00                2331
function.trader-tanh.php                           30-Sep-2022 11:00                2355
function.trader-tema.php                           30-Sep-2022 11:00                2552
function.trader-trange.php                         30-Sep-2022 11:00                2755
function.trader-trima.php                          30-Sep-2022 11:00                2554
function.trader-trix.php                           30-Sep-2022 11:00                2564
function.trader-tsf.php                            30-Sep-2022 11:00                2533
function.trader-typprice.php                       30-Sep-2022 11:00                2778
function.trader-ultosc.php                         30-Sep-2022 11:00                3928
function.trader-var.php                            30-Sep-2022 11:00                2786
function.trader-wclprice.php                       30-Sep-2022 11:00                2783
function.trader-willr.php                          30-Sep-2022 11:00                3185
function.trader-wma.php                            30-Sep-2022 11:00                2540
function.trait-exists.php                          30-Sep-2022 11:01                2657
function.trigger-error.php                         30-Sep-2022 11:00                6201
function.trim.php                                  30-Sep-2022 11:01               13650
function.uasort.php                                30-Sep-2022 11:01                9622
function.ucfirst.php                               30-Sep-2022 11:01                5504
function.ucwords.php                               30-Sep-2022 11:01                9526
function.ui-draw-text-font-fontfamilies.php        30-Sep-2022 11:01                2261
function.ui-quit.php                               30-Sep-2022 11:01                1989
function.ui-run.php                                30-Sep-2022 11:01                2319
function.uksort.php                                30-Sep-2022 11:01                8949
function.umask.php                                 30-Sep-2022 11:00                5489
function.uniqid.php                                30-Sep-2022 11:01                7421
function.unixtojd.php                              30-Sep-2022 11:00                3580
function.unlink.php                                30-Sep-2022 11:00                5611
function.unpack.php                                30-Sep-2022 11:01               10168
function.unregister-tick-function.php              30-Sep-2022 11:01                3127
function.unserialize.php                           30-Sep-2022 11:01               15937
function.unset.php                                 30-Sep-2022 11:01               15298
function.untaint.php                               30-Sep-2022 11:01                2338
function.uopz-add-function.php                     30-Sep-2022 11:00                6538
function.uopz-allow-exit.php                       30-Sep-2022 11:00                4527
function.uopz-backup.php                           30-Sep-2022 11:00                4351
function.uopz-compose.php                          30-Sep-2022 11:00                6848
function.uopz-copy.php                             30-Sep-2022 11:00                5063
function.uopz-del-function.php                     30-Sep-2022 11:00                6083
function.uopz-delete.php                           30-Sep-2022 11:00                5848
function.uopz-extend.php                           30-Sep-2022 11:00                4718
function.uopz-flags.php                            30-Sep-2022 11:00               10681
function.uopz-function.php                         30-Sep-2022 11:00                7036
function.uopz-get-exit-status.php                  30-Sep-2022 11:00                4155
function.uopz-get-hook.php                         30-Sep-2022 11:00                5163
function.uopz-get-mock.php                         30-Sep-2022 11:00                5104
function.uopz-get-property.php                     30-Sep-2022 11:00                6096
function.uopz-get-return.php                       30-Sep-2022 11:00                4311
function.uopz-get-static.php                       30-Sep-2022 11:00                4781
function.uopz-implement.php                        30-Sep-2022 11:00                4743
function.uopz-overload.php                         30-Sep-2022 11:00                3836
function.uopz-redefine.php                         30-Sep-2022 11:00                4784
function.uopz-rename.php                           30-Sep-2022 11:00                6516
function.uopz-restore.php                          30-Sep-2022 11:00                4721
function.uopz-set-hook.php                         30-Sep-2022 11:00                5306
function.uopz-set-mock.php                         30-Sep-2022 11:00               12527
function.uopz-set-property.php                     30-Sep-2022 11:00                7542
function.uopz-set-return.php                       30-Sep-2022 11:00                9339
function.uopz-set-static.php                       30-Sep-2022 11:00                5417
function.uopz-undefine.php                         30-Sep-2022 11:00                4246
function.uopz-unset-hook.php                       30-Sep-2022 11:00                5200
function.uopz-unset-mock.php                       30-Sep-2022 11:00                5440
function.uopz-unset-return.php                     30-Sep-2022 11:00                4607
function.urldecode.php                             30-Sep-2022 11:01                6392
function.urlencode.php                             30-Sep-2022 11:01                7932
function.use-soap-error-handler.php                30-Sep-2022 11:01                3597
function.user-error.php                            30-Sep-2022 11:00                1680
function.usleep.php                                30-Sep-2022 11:01                5715
function.usort.php                                 30-Sep-2022 11:01               27605
function.utf8-decode.php                           30-Sep-2022 11:01                9020
function.utf8-encode.php                           30-Sep-2022 11:01                7370
function.var-dump.php                              30-Sep-2022 11:01                6916
function.var-export.php                            30-Sep-2022 11:01               16983
function.var-representation.php                    30-Sep-2022 11:01               14304
function.variant-abs.php                           30-Sep-2022 11:01                4157
function.variant-add.php                           30-Sep-2022 11:01                5530
function.variant-and.php                           30-Sep-2022 11:01                6234
function.variant-cast.php                          30-Sep-2022 11:01                3466
function.variant-cat.php                           30-Sep-2022 11:01                4746
function.variant-cmp.php                           30-Sep-2022 11:01                7179
function.variant-date-from-timestamp.php           30-Sep-2022 11:01                3509
function.variant-date-to-timestamp.php             30-Sep-2022 11:01                3575
function.variant-div.php                           30-Sep-2022 11:01                6326
function.variant-eqv.php                           30-Sep-2022 11:01                4355
function.variant-fix.php                           30-Sep-2022 11:01                5529
function.variant-get-type.php                      30-Sep-2022 11:01                3399
function.variant-idiv.php                          30-Sep-2022 11:01                5749
function.variant-imp.php                           30-Sep-2022 11:01                5775
function.variant-int.php                           30-Sep-2022 11:01                5027
function.variant-mod.php                           30-Sep-2022 11:01                4825
function.variant-mul.php                           30-Sep-2022 11:01                5834
function.variant-neg.php                           30-Sep-2022 11:01                3815
function.variant-not.php                           30-Sep-2022 11:01                3979
function.variant-or.php                            30-Sep-2022 11:01                6409
function.variant-pow.php                           30-Sep-2022 11:01                4655
function.variant-round.php                         30-Sep-2022 11:01                4329
function.variant-set-type.php                      30-Sep-2022 11:01                3585
function.variant-set.php                           30-Sep-2022 11:01                2888
function.variant-sub.php                           30-Sep-2022 11:01                5492
function.variant-xor.php                           30-Sep-2022 11:01                5761
function.version-compare.php                       30-Sep-2022 11:00               11275
function.vfprintf.php                              30-Sep-2022 11:01               15910
function.virtual.php                               30-Sep-2022 11:01                5070
function.vprintf.php                               30-Sep-2022 11:01               15265
function.vsprintf.php                              30-Sep-2022 11:01               15619
function.wddx-add-vars.php                         30-Sep-2022 11:01                3618
function.wddx-deserialize.php                      30-Sep-2022 11:01                3503
function.wddx-packet-end.php                       30-Sep-2022 11:01                2712
function.wddx-packet-start.php                     30-Sep-2022 11:01                2839
function.wddx-serialize-value.php                  30-Sep-2022 11:01                3118
function.wddx-serialize-vars.php                   30-Sep-2022 11:01                6013
function.win32-continue-service.php                30-Sep-2022 11:01                6370
function.win32-create-service.php                  30-Sep-2022 11:01               32885
function.win32-delete-service.php                  30-Sep-2022 11:01                6799
function.win32-get-last-control-message.php        30-Sep-2022 11:01                7096
function.win32-pause-service.php                   30-Sep-2022 11:01                6368
function.win32-query-service-status.php            30-Sep-2022 11:01                8279
function.win32-send-custom-control.php             30-Sep-2022 11:01                6923
function.win32-set-service-exit-code.php           30-Sep-2022 11:01                5645
function.win32-set-service-exit-mode.php           30-Sep-2022 11:01                5688
function.win32-set-service-status.php              30-Sep-2022 11:01                8076
function.win32-start-service-ctrl-dispatcher.php   30-Sep-2022 11:01               10962
function.win32-start-service.php                   30-Sep-2022 11:01                6372
function.win32-stop-service.php                    30-Sep-2022 11:01                6293
function.wincache-fcache-fileinfo.php              30-Sep-2022 11:00                9120
function.wincache-fcache-meminfo.php               30-Sep-2022 11:00                7046
function.wincache-lock.php                         30-Sep-2022 11:00                8524
function.wincache-ocache-fileinfo.php              30-Sep-2022 11:00                9799
function.wincache-ocache-meminfo.php               30-Sep-2022 11:00                7250
function.wincache-refresh-if-changed.php           30-Sep-2022 11:00                7800
function.wincache-rplist-fileinfo.php              30-Sep-2022 11:00                7487
function.wincache-rplist-meminfo.php               30-Sep-2022 11:00                7161
function.wincache-scache-info.php                  30-Sep-2022 11:00                9390
function.wincache-scache-meminfo.php               30-Sep-2022 11:00                6619
function.wincache-ucache-add.php                   30-Sep-2022 11:00               13199
function.wincache-ucache-cas.php                   30-Sep-2022 11:00                6047
function.wincache-ucache-clear.php                 30-Sep-2022 11:00                7524
function.wincache-ucache-dec.php                   30-Sep-2022 11:00                6098
function.wincache-ucache-delete.php                30-Sep-2022 11:00               11411
function.wincache-ucache-exists.php                30-Sep-2022 11:00                6055
function.wincache-ucache-get.php                   30-Sep-2022 11:00               10508
function.wincache-ucache-inc.php                   30-Sep-2022 11:00                6090
function.wincache-ucache-info.php                  30-Sep-2022 11:00               11109
function.wincache-ucache-meminfo.php               30-Sep-2022 11:00                6823
function.wincache-ucache-set.php                   30-Sep-2022 11:00               13427
function.wincache-unlock.php                       30-Sep-2022 11:00                7893
function.wordwrap.php                              30-Sep-2022 11:01                8970
function.xattr-get.php                             30-Sep-2022 11:00                5769
function.xattr-list.php                            30-Sep-2022 11:00                6385
function.xattr-remove.php                          30-Sep-2022 11:00                5942
function.xattr-set.php                             30-Sep-2022 11:00                7558
function.xattr-supported.php                       30-Sep-2022 11:00                5058
function.xdiff-file-bdiff-size.php                 30-Sep-2022 11:00                4813
function.xdiff-file-bdiff.php                      30-Sep-2022 11:00                5649
function.xdiff-file-bpatch.php                     30-Sep-2022 11:00                6311
function.xdiff-file-diff-binary.php                30-Sep-2022 11:00                6086
function.xdiff-file-diff.php                       30-Sep-2022 11:00                6879
function.xdiff-file-merge3.php                     30-Sep-2022 11:00                6643
function.xdiff-file-patch-binary.php               30-Sep-2022 11:00                6449
function.xdiff-file-patch.php                      30-Sep-2022 11:00                8713
function.xdiff-file-rabdiff.php                    30-Sep-2022 11:00                6205
function.xdiff-string-bdiff-size.php               30-Sep-2022 11:00                5138
function.xdiff-string-bdiff.php                    30-Sep-2022 11:00                3629
function.xdiff-string-bpatch.php                   30-Sep-2022 11:00                3742
function.xdiff-string-diff-binary.php              30-Sep-2022 11:00                4134
function.xdiff-string-diff.php                     30-Sep-2022 11:00                7382
function.xdiff-string-merge3.php                   30-Sep-2022 11:00                4514
function.xdiff-string-patch-binary.php             30-Sep-2022 11:00                4291
function.xdiff-string-patch.php                    30-Sep-2022 11:00                8074
function.xdiff-string-rabdiff.php                  30-Sep-2022 11:00                4231
function.xhprof-disable.php                        30-Sep-2022 11:00                3842
function.xhprof-enable.php                         30-Sep-2022 11:00                7724
function.xhprof-sample-disable.php                 30-Sep-2022 11:00                4649
function.xhprof-sample-enable.php                  30-Sep-2022 11:00                3432
function.xml-error-string.php                      30-Sep-2022 11:01                3112
function.xml-get-current-byte-index.php            30-Sep-2022 11:01                4405
function.xml-get-current-column-number.php         30-Sep-2022 11:01                4251
function.xml-get-current-line-number.php           30-Sep-2022 11:01                4053
function.xml-get-error-code.php                    30-Sep-2022 11:01                3695
function.xml-parse-into-struct.php                 30-Sep-2022 11:01               20906
function.xml-parse.php                             30-Sep-2022 11:01                7943
function.xml-parser-create-ns.php                  30-Sep-2022 11:01                5130
function.xml-parser-create.php                     30-Sep-2022 11:01                4738
function.xml-parser-free.php                       30-Sep-2022 11:01                3797
function.xml-parser-get-option.php                 30-Sep-2022 11:01                4379
function.xml-parser-set-option.php                 30-Sep-2022 11:01                5843
function.xml-set-character-data-handler.php        30-Sep-2022 11:01                5712
function.xml-set-default-handler.php               30-Sep-2022 11:01                5584
function.xml-set-element-handler.php               30-Sep-2022 11:01                8384
function.xml-set-end-namespace-decl-handler.php    30-Sep-2022 11:01                6701
function.xml-set-external-entity-ref-handler.php   30-Sep-2022 11:01                8119
function.xml-set-notation-decl-handler.php         30-Sep-2022 11:01                7463
function.xml-set-object.php                        30-Sep-2022 11:01               10466
function.xml-set-processing-instruction-handler..> 30-Sep-2022 11:01                6712
function.xml-set-start-namespace-decl-handler.php  30-Sep-2022 11:01                6895
function.xml-set-unparsed-entity-decl-handler.php  30-Sep-2022 11:01                8090
function.xmlrpc-decode-request.php                 30-Sep-2022 11:01                2637
function.xmlrpc-decode.php                         30-Sep-2022 11:01                4028
function.xmlrpc-encode-request.php                 30-Sep-2022 11:01                8754
function.xmlrpc-encode.php                         30-Sep-2022 11:01                2337
function.xmlrpc-get-type.php                       30-Sep-2022 11:01                6493
function.xmlrpc-is-fault.php                       30-Sep-2022 11:01                3673
function.xmlrpc-parse-method-descriptions.php      30-Sep-2022 11:01                2435
function.xmlrpc-server-add-introspection-data.php  30-Sep-2022 11:01                2571
function.xmlrpc-server-call-method.php             30-Sep-2022 11:01                2958
function.xmlrpc-server-create.php                  30-Sep-2022 11:01                2209
function.xmlrpc-server-destroy.php                 30-Sep-2022 11:01                2358
function.xmlrpc-server-register-introspection-c..> 30-Sep-2022 11:01                2652
function.xmlrpc-server-register-method.php         30-Sep-2022 11:01                2669
function.xmlrpc-set-type.php                       30-Sep-2022 11:01                5181
function.yaml-emit-file.php                        30-Sep-2022 11:01                5804
function.yaml-emit.php                             30-Sep-2022 11:01               12806
function.yaml-parse-file.php                       30-Sep-2022 11:01                5676
function.yaml-parse-url.php                        30-Sep-2022 11:01                6004
function.yaml-parse.php                            30-Sep-2022 11:01                9942
function.yaz-addinfo.php                           30-Sep-2022 11:01                3280
function.yaz-ccl-conf.php                          30-Sep-2022 11:01                5637
function.yaz-ccl-parse.php                         30-Sep-2022 11:01                6561
function.yaz-close.php                             30-Sep-2022 11:01                3253
function.yaz-connect.php                           30-Sep-2022 11:01                8906
function.yaz-database.php                          30-Sep-2022 11:01                3122
function.yaz-element.php                           30-Sep-2022 11:01                3554
function.yaz-errno.php                             30-Sep-2022 11:01                3517
function.yaz-error.php                             30-Sep-2022 11:01                3270
function.yaz-es-result.php                         30-Sep-2022 11:01                3175
function.yaz-es.php                                30-Sep-2022 11:01                7094
function.yaz-get-option.php                        30-Sep-2022 11:01                3194
function.yaz-hits.php                              30-Sep-2022 11:01                4671
function.yaz-itemorder.php                         30-Sep-2022 11:01                6890
function.yaz-present.php                           30-Sep-2022 11:01                2754
function.yaz-range.php                             30-Sep-2022 11:01                3397
function.yaz-record.php                            30-Sep-2022 11:01               14178
function.yaz-scan-result.php                       30-Sep-2022 11:01                3822
function.yaz-scan.php                              30-Sep-2022 11:01                9694
function.yaz-schema.php                            30-Sep-2022 11:01                3285
function.yaz-search.php                            30-Sep-2022 11:01                8311
function.yaz-set-option.php                        30-Sep-2022 11:01                6645
function.yaz-sort.php                              30-Sep-2022 11:01                5454
function.yaz-syntax.php                            30-Sep-2022 11:01                3243
function.yaz-wait.php                              30-Sep-2022 11:01                3944
function.zend-thread-id.php                        30-Sep-2022 11:00                3666
function.zend-version.php                          30-Sep-2022 11:00                3863
function.zip-close.php                             30-Sep-2022 11:00                3827
function.zip-entry-close.php                       30-Sep-2022 11:00                3922
function.zip-entry-compressedsize.php              30-Sep-2022 11:00                4242
function.zip-entry-compressionmethod.php           30-Sep-2022 11:00                4340
function.zip-entry-filesize.php                    30-Sep-2022 11:00                4171
function.zip-entry-name.php                        30-Sep-2022 11:00                4102
function.zip-entry-open.php                        30-Sep-2022 11:00                5475
function.zip-entry-read.php                        30-Sep-2022 11:00                4798
function.zip-open.php                              30-Sep-2022 11:00                4222
function.zip-read.php                              30-Sep-2022 11:00                4469
function.zlib-decode.php                           30-Sep-2022 11:00                3171
function.zlib-encode.php                           30-Sep-2022 11:00                4939
function.zlib-get-coding-type.php                  30-Sep-2022 11:00                2737
function.zookeeper-dispatch.php                    30-Sep-2022 11:01                8625
functional.parallel.php                            30-Sep-2022 11:01                2551
functions.anonymous.php                            30-Sep-2022 11:00               26857
functions.arguments.php                            30-Sep-2022 11:00               47586
functions.arrow.php                                30-Sep-2022 11:00               11007
functions.first_class_callable_syntax.php          30-Sep-2022 11:00               12131
functions.internal.php                             30-Sep-2022 11:00                7427
functions.returning-values.php                     30-Sep-2022 11:00                6358
functions.user-defined.php                         30-Sep-2022 11:00               10021
functions.variable-functions.php                   30-Sep-2022 11:00               12716
gearman.configuration.php                          30-Sep-2022 11:01                1220
gearman.constants.php                              30-Sep-2022 11:01               17891
gearman.examples-reverse-bg.php                    30-Sep-2022 11:01               11681
gearman.examples-reverse-task.php                  30-Sep-2022 11:01               18860
gearman.examples-reverse.php                       30-Sep-2022 11:01               14301
gearman.examples.php                               30-Sep-2022 11:01                1555
gearman.installation.php                           30-Sep-2022 11:01                1548
gearman.requirements.php                           30-Sep-2022 11:01                1471
gearman.resources.php                              30-Sep-2022 11:01                1195
gearman.setup.php                                  30-Sep-2022 11:01                1562
gearmanclient.addoptions.php                       30-Sep-2022 11:01                2850
gearmanclient.addserver.php                        30-Sep-2022 11:01                4894
gearmanclient.addservers.php                       30-Sep-2022 11:01                4392
gearmanclient.addtask.php                          30-Sep-2022 11:01               15168
gearmanclient.addtaskbackground.php                30-Sep-2022 11:01               21465
gearmanclient.addtaskhigh.php                      30-Sep-2022 11:01               11284
gearmanclient.addtaskhighbackground.php            30-Sep-2022 11:01                5831
gearmanclient.addtasklow.php                       30-Sep-2022 11:01               11266
gearmanclient.addtasklowbackground.php             30-Sep-2022 11:01                5824
gearmanclient.addtaskstatus.php                    30-Sep-2022 11:01                9909
gearmanclient.clearcallbacks.php                   30-Sep-2022 11:01                4325
gearmanclient.clone.php                            30-Sep-2022 11:01                2564
gearmanclient.construct.php                        30-Sep-2022 11:01                2799
gearmanclient.context.php                          30-Sep-2022 11:01                2812
gearmanclient.data.php                             30-Sep-2022 11:01                3077
gearmanclient.do.php                               30-Sep-2022 11:01               23859
gearmanclient.dobackground.php                     30-Sep-2022 11:01                9700
gearmanclient.dohigh.php                           30-Sep-2022 11:01                4725
gearmanclient.dohighbackground.php                 30-Sep-2022 11:01                4552
gearmanclient.dojobhandle.php                      30-Sep-2022 11:01                2869
gearmanclient.dolow.php                            30-Sep-2022 11:01                4711
gearmanclient.dolowbackground.php                  30-Sep-2022 11:01                4534
gearmanclient.donormal.php                         30-Sep-2022 11:01               24247
gearmanclient.dostatus.php                         30-Sep-2022 11:01                8756
gearmanclient.echo.php                             30-Sep-2022 11:01                2726
gearmanclient.error.php                            30-Sep-2022 11:01                2557
gearmanclient.geterrno.php                         30-Sep-2022 11:01                2581
gearmanclient.jobstatus.php                        30-Sep-2022 11:01                8613
gearmanclient.ping.php                             30-Sep-2022 11:01                2699
gearmanclient.removeoptions.php                    30-Sep-2022 11:01                2496
gearmanclient.returncode.php                       30-Sep-2022 11:01                2214
gearmanclient.runtasks.php                         30-Sep-2022 11:01                3515
gearmanclient.setclientcallback.php                30-Sep-2022 11:01                5311
gearmanclient.setcompletecallback.php              30-Sep-2022 11:01                5148
gearmanclient.setcontext.php                       30-Sep-2022 11:01                3053
gearmanclient.setcreatedcallback.php               30-Sep-2022 11:01                4621
gearmanclient.setdata.php                          30-Sep-2022 11:01                3245
gearmanclient.setdatacallback.php                  30-Sep-2022 11:01                4672
gearmanclient.setexceptioncallback.php             30-Sep-2022 11:01                4592
gearmanclient.setfailcallback.php                  30-Sep-2022 11:01                4678
gearmanclient.setoptions.php                       30-Sep-2022 11:01                2482
gearmanclient.setstatuscallback.php                30-Sep-2022 11:01                4678
gearmanclient.settimeout.php                       30-Sep-2022 11:01                2524
gearmanclient.setwarningcallback.php               30-Sep-2022 11:01                4681
gearmanclient.setworkloadcallback.php              30-Sep-2022 11:01                4835
gearmanclient.timeout.php                          30-Sep-2022 11:01                2676
gearmanclient.wait.php                             30-Sep-2022 11:01                2619
gearmanjob.complete.php                            30-Sep-2022 11:01                3350
gearmanjob.construct.php                           30-Sep-2022 11:01                2306
gearmanjob.data.php                                30-Sep-2022 11:01                3310
gearmanjob.exception.php                           30-Sep-2022 11:01                3532
gearmanjob.fail.php                                30-Sep-2022 11:01                3521
gearmanjob.functionname.php                        30-Sep-2022 11:01                2602
gearmanjob.handle.php                              30-Sep-2022 11:01                2489
gearmanjob.returncode.php                          30-Sep-2022 11:01                2536
gearmanjob.sendcomplete.php                        30-Sep-2022 11:01                3071
gearmanjob.senddata.php                            30-Sep-2022 11:01                3038
gearmanjob.sendexception.php                       30-Sep-2022 11:01                3266
gearmanjob.sendfail.php                            30-Sep-2022 11:01                3240
gearmanjob.sendstatus.php                          30-Sep-2022 11:01                3729
gearmanjob.sendwarning.php                         30-Sep-2022 11:01                3262
gearmanjob.setreturn.php                           30-Sep-2022 11:01                2417
gearmanjob.status.php                              30-Sep-2022 11:01                4010
gearmanjob.unique.php                              30-Sep-2022 11:01                2741
gearmanjob.warning.php                             30-Sep-2022 11:01                3543
gearmanjob.workload.php                            30-Sep-2022 11:01                2747
gearmanjob.workloadsize.php                        30-Sep-2022 11:01                2552
gearmantask.construct.php                          30-Sep-2022 11:01                2326
gearmantask.create.php                             30-Sep-2022 11:01                2677
gearmantask.data.php                               30-Sep-2022 11:01                2543
gearmantask.datasize.php                           30-Sep-2022 11:01                2568
gearmantask.function.php                           30-Sep-2022 11:01                2556
gearmantask.functionname.php                       30-Sep-2022 11:01                2248
gearmantask.isknown.php                            30-Sep-2022 11:01                2263
gearmantask.isrunning.php                          30-Sep-2022 11:01                2267
gearmantask.jobhandle.php                          30-Sep-2022 11:01                2638
gearmantask.recvdata.php                           30-Sep-2022 11:01                3213
gearmantask.returncode.php                         30-Sep-2022 11:01                2563
gearmantask.senddata.php                           30-Sep-2022 11:01                3140
gearmantask.sendworkload.php                       30-Sep-2022 11:01                3173
gearmantask.taskdenominator.php                    30-Sep-2022 11:01                2761
gearmantask.tasknumerator.php                      30-Sep-2022 11:01                2733
gearmantask.unique.php                             30-Sep-2022 11:01                2991
gearmantask.uuid.php                               30-Sep-2022 11:01                3280
gearmanworker.addfunction.php                      30-Sep-2022 11:01                7793
gearmanworker.addoptions.php                       30-Sep-2022 11:01                3239
gearmanworker.addserver.php                        30-Sep-2022 11:01                4551
gearmanworker.addservers.php                       30-Sep-2022 11:01                4044
gearmanworker.clone.php                            30-Sep-2022 11:01                2262
gearmanworker.construct.php                        30-Sep-2022 11:01                2772
gearmanworker.echo.php                             30-Sep-2022 11:01                2892
gearmanworker.error.php                            30-Sep-2022 11:01                2510
gearmanworker.geterrno.php                         30-Sep-2022 11:01                2548
gearmanworker.options.php                          30-Sep-2022 11:01                2555
gearmanworker.register.php                         30-Sep-2022 11:01                3610
gearmanworker.removeoptions.php                    30-Sep-2022 11:01                3261
gearmanworker.returncode.php                       30-Sep-2022 11:01                2758
gearmanworker.setid.php                            30-Sep-2022 11:01                3823
gearmanworker.setoptions.php                       30-Sep-2022 11:01                3409
gearmanworker.settimeout.php                       30-Sep-2022 11:01                8074
gearmanworker.timeout.php                          30-Sep-2022 11:01                2655
gearmanworker.unregister.php                       30-Sep-2022 11:01                3228
gearmanworker.unregisterall.php                    30-Sep-2022 11:01                2933
gearmanworker.wait.php                             30-Sep-2022 11:01                8402
gearmanworker.work.php                             30-Sep-2022 11:01                5334
gender-gender.connect.php                          30-Sep-2022 11:00                2413
gender-gender.construct.php                        30-Sep-2022 11:00                2327
gender-gender.country.php                          30-Sep-2022 11:00                3578
gender-gender.get.php                              30-Sep-2022 11:00                2676
gender-gender.isnick.php                           30-Sep-2022 11:00                3108
gender-gender.similarnames.php                     30-Sep-2022 11:00                2789
gender.example.admin.php                           30-Sep-2022 11:00                9301
gender.examples.php                                30-Sep-2022 11:00                1332
gender.installation.php                            30-Sep-2022 11:00                1928
gender.setup.php                                   30-Sep-2022 11:00                1346
generator.current.php                              30-Sep-2022 11:00                2113
generator.getreturn.php                            30-Sep-2022 11:00                3959
generator.key.php                                  30-Sep-2022 11:00                3940
generator.next.php                                 30-Sep-2022 11:00                2324
generator.rewind.php                               30-Sep-2022 11:00                2127
generator.send.php                                 30-Sep-2022 11:00                5761
generator.throw.php                                30-Sep-2022 11:00                5340
generator.valid.php                                30-Sep-2022 11:00                2116
generator.wakeup.php                               30-Sep-2022 11:00                2120
geoip.configuration.php                            30-Sep-2022 11:01                2344
geoip.constants.php                                30-Sep-2022 11:01                4454
geoip.installation.php                             30-Sep-2022 11:01                1676
geoip.requirements.php                             30-Sep-2022 11:01                1674
geoip.resources.php                                30-Sep-2022 11:01                1151
geoip.setup.php                                    30-Sep-2022 11:01                1523
gettext.configuration.php                          30-Sep-2022 11:00                1220
gettext.constants.php                              30-Sep-2022 11:00                1125
gettext.installation.php                           30-Sep-2022 11:00                1357
gettext.requirements.php                           30-Sep-2022 11:00                1348
gettext.resources.php                              30-Sep-2022 11:00                1165
gettext.setup.php                                  30-Sep-2022 11:00                1566
getting-started.php                                30-Sep-2022 11:00                1884
globiterator.construct.php                         30-Sep-2022 11:01                7820
globiterator.count.php                             30-Sep-2022 11:01                4335
gmagick.addimage.php                               30-Sep-2022 11:00                2826
gmagick.addnoiseimage.php                          30-Sep-2022 11:00                2823
gmagick.annotateimage.php                          30-Sep-2022 11:00                4198
gmagick.blurimage.php                              30-Sep-2022 11:00                3107
gmagick.borderimage.php                            30-Sep-2022 11:00                3618
gmagick.charcoalimage.php                          30-Sep-2022 11:00                3115
gmagick.chopimage.php                              30-Sep-2022 11:00                3659
gmagick.clear.php                                  30-Sep-2022 11:00                2563
gmagick.commentimage.php                           30-Sep-2022 11:00                2768
gmagick.compositeimage.php                         30-Sep-2022 11:00                3880
gmagick.configuration.php                          30-Sep-2022 11:00                1226
gmagick.constants.php                              30-Sep-2022 11:00               68477
gmagick.construct.php                              30-Sep-2022 11:00                2526
gmagick.cropimage.php                              30-Sep-2022 11:00                3794
gmagick.cropthumbnailimage.php                     30-Sep-2022 11:00                3152
gmagick.current.php                                30-Sep-2022 11:00                2464
gmagick.cyclecolormapimage.php                     30-Sep-2022 11:00                2896
gmagick.deconstructimages.php                      30-Sep-2022 11:00                2712
gmagick.despeckleimage.php                         30-Sep-2022 11:00                3402
gmagick.destroy.php                                30-Sep-2022 11:00                2520
gmagick.drawimage.php                              30-Sep-2022 11:00                2950
gmagick.edgeimage.php                              30-Sep-2022 11:00                2839
gmagick.embossimage.php                            30-Sep-2022 11:00                3293
gmagick.enhanceimage.php                           30-Sep-2022 11:00                2574
gmagick.equalizeimage.php                          30-Sep-2022 11:00                2533
gmagick.examples.php                               30-Sep-2022 11:00                3670
gmagick.flipimage.php                              30-Sep-2022 11:00                2882
gmagick.flopimage.php                              30-Sep-2022 11:00                2879
gmagick.frameimage.php                             30-Sep-2022 11:00                4335
gmagick.gammaimage.php                             30-Sep-2022 11:00                3050
gmagick.getcopyright.php                           30-Sep-2022 11:00                2495
gmagick.getfilename.php                            30-Sep-2022 11:00                2445
gmagick.getimagebackgroundcolor.php                30-Sep-2022 11:00                2642
gmagick.getimageblueprimary.php                    30-Sep-2022 11:00                2902
gmagick.getimagebordercolor.php                    30-Sep-2022 11:00                2686
gmagick.getimagechanneldepth.php                   30-Sep-2022 11:00                2631
gmagick.getimagecolors.php                         30-Sep-2022 11:00                2483
gmagick.getimagecolorspace.php                     30-Sep-2022 11:00                2441
gmagick.getimagecompose.php                        30-Sep-2022 11:00                2521
gmagick.getimagedelay.php                          30-Sep-2022 11:00                2418
gmagick.getimagedepth.php                          30-Sep-2022 11:00                2388
gmagick.getimagedispose.php                        30-Sep-2022 11:00                2442
gmagick.getimageextrema.php                        30-Sep-2022 11:00                2648
gmagick.getimagefilename.php                       30-Sep-2022 11:00                2524
gmagick.getimageformat.php                         30-Sep-2022 11:00                2507
gmagick.getimagegamma.php                          30-Sep-2022 11:00                2409
gmagick.getimagegreenprimary.php                   30-Sep-2022 11:00                2628
gmagick.getimageheight.php                         30-Sep-2022 11:00                2440
gmagick.getimagehistogram.php                      30-Sep-2022 11:00                2801
gmagick.getimageindex.php                          30-Sep-2022 11:00                2571
gmagick.getimageinterlacescheme.php                30-Sep-2022 11:00                2559
gmagick.getimageiterations.php                     30-Sep-2022 11:00                2486
gmagick.getimagematte.php                          30-Sep-2022 11:00                2620
gmagick.getimagemattecolor.php                     30-Sep-2022 11:00                2592
gmagick.getimageprofile.php                        30-Sep-2022 11:00                2579
gmagick.getimageredprimary.php                     30-Sep-2022 11:00                2649
gmagick.getimagerenderingintent.php                30-Sep-2022 11:00                2570
gmagick.getimageresolution.php                     30-Sep-2022 11:00                2502
gmagick.getimagescene.php                          30-Sep-2022 11:00                2405
gmagick.getimagesignature.php                      30-Sep-2022 11:00                2518
gmagick.getimagetype.php                           30-Sep-2022 11:00                2412
gmagick.getimageunits.php                          30-Sep-2022 11:00                2179
gmagick.getimagewhitepoint.php                     30-Sep-2022 11:00                2625
gmagick.getimagewidth.php                          30-Sep-2022 11:00                2419
gmagick.getpackagename.php                         30-Sep-2022 11:00                2471
gmagick.getquantumdepth.php                        30-Sep-2022 11:00                2650
gmagick.getreleasedate.php                         30-Sep-2022 11:00                2505
gmagick.getsamplingfactors.php                     30-Sep-2022 11:00                2560
gmagick.getsize.php                                30-Sep-2022 11:00                2709
gmagick.getversion.php                             30-Sep-2022 11:00                2450
gmagick.hasnextimage.php                           30-Sep-2022 11:00                2752
gmagick.haspreviousimage.php                       30-Sep-2022 11:00                2796
gmagick.implodeimage.php                           30-Sep-2022 11:00                2920
gmagick.installation.php                           30-Sep-2022 11:00                1920
gmagick.labelimage.php                             30-Sep-2022 11:00                2687
gmagick.levelimage.php                             30-Sep-2022 11:00                4478
gmagick.magnifyimage.php                           30-Sep-2022 11:00                2600
gmagick.mapimage.php                               30-Sep-2022 11:00                3187
gmagick.medianfilterimage.php                      30-Sep-2022 11:00                2943
gmagick.minifyimage.php                            30-Sep-2022 11:00                2593
gmagick.modulateimage.php                          30-Sep-2022 11:00                3689
gmagick.motionblurimage.php                        30-Sep-2022 11:00                3714
gmagick.newimage.php                               30-Sep-2022 11:00                3678
gmagick.nextimage.php                              30-Sep-2022 11:00                2541
gmagick.normalizeimage.php                         30-Sep-2022 11:00                2924
gmagick.oilpaintimage.php                          30-Sep-2022 11:00                2940
gmagick.previousimage.php                          30-Sep-2022 11:00                2536
gmagick.profileimage.php                           30-Sep-2022 11:00                3338
gmagick.quantizeimage.php                          30-Sep-2022 11:00                5049
gmagick.quantizeimages.php                         30-Sep-2022 11:00                5052
gmagick.queryfontmetrics.php                       30-Sep-2022 11:00                2768
gmagick.queryfonts.php                             30-Sep-2022 11:00                2544
gmagick.queryformats.php                           30-Sep-2022 11:00                2898
gmagick.radialblurimage.php                        30-Sep-2022 11:00                3090
gmagick.raiseimage.php                             30-Sep-2022 11:00                4118
gmagick.read.php                                   30-Sep-2022 11:00                2661
gmagick.readimage.php                              30-Sep-2022 11:00                2711
gmagick.readimageblob.php                          30-Sep-2022 11:00                3078
gmagick.readimagefile.php                          30-Sep-2022 11:00                2947
gmagick.reducenoiseimage.php                       30-Sep-2022 11:00                3118
gmagick.removeimage.php                            30-Sep-2022 11:00                2541
gmagick.removeimageprofile.php                     30-Sep-2022 11:00                2763
gmagick.requirements.php                           30-Sep-2022 11:00                1634
gmagick.resampleimage.php                          30-Sep-2022 11:00                3685
gmagick.resizeimage.php                            30-Sep-2022 11:00                3911
gmagick.rollimage.php                              30-Sep-2022 11:00                2869
gmagick.rotateimage.php                            30-Sep-2022 11:00                3143
gmagick.scaleimage.php                             30-Sep-2022 11:00                3301
gmagick.separateimagechannel.php                   30-Sep-2022 11:00                3110
gmagick.setcompressionquality.php                  30-Sep-2022 11:00                4147
gmagick.setfilename.php                            30-Sep-2022 11:00                2841
gmagick.setimagebackgroundcolor.php                30-Sep-2022 11:00                2970
gmagick.setimageblueprimary.php                    30-Sep-2022 11:00                3152
gmagick.setimagebordercolor.php                    30-Sep-2022 11:00                2932
gmagick.setimagechanneldepth.php                   30-Sep-2022 11:00                3299
gmagick.setimagecolorspace.php                     30-Sep-2022 11:00                2995
gmagick.setimagecompose.php                        30-Sep-2022 11:00                2761
gmagick.setimagedelay.php                          30-Sep-2022 11:00                2775
gmagick.setimagedepth.php                          30-Sep-2022 11:00                2773
gmagick.setimagedispose.php                        30-Sep-2022 11:00                2817
gmagick.setimagefilename.php                       30-Sep-2022 11:00                2865
gmagick.setimageformat.php                         30-Sep-2022 11:00                2828
gmagick.setimagegamma.php                          30-Sep-2022 11:00                2767
gmagick.setimagegreenprimary.php                   30-Sep-2022 11:00                3160
gmagick.setimageindex.php                          30-Sep-2022 11:00                2914
gmagick.setimageinterlacescheme.php                30-Sep-2022 11:00                3061
gmagick.setimageiterations.php                     30-Sep-2022 11:00                2870
gmagick.setimageprofile.php                        30-Sep-2022 11:00                3245
gmagick.setimageredprimary.php                     30-Sep-2022 11:00                3063
gmagick.setimagerenderingintent.php                30-Sep-2022 11:00                3092
gmagick.setimageresolution.php                     30-Sep-2022 11:00                3057
gmagick.setimagescene.php                          30-Sep-2022 11:00                2763
gmagick.setimagetype.php                           30-Sep-2022 11:00                2888
gmagick.setimageunits.php                          30-Sep-2022 11:00                2947
gmagick.setimagewhitepoint.php                     30-Sep-2022 11:00                3089
gmagick.setsamplingfactors.php                     30-Sep-2022 11:00                2931
gmagick.setsize.php                                30-Sep-2022 11:00                3196
gmagick.setup.php                                  30-Sep-2022 11:00                1490
gmagick.shearimage.php                             30-Sep-2022 11:00                3832
gmagick.solarizeimage.php                          30-Sep-2022 11:00                3021
gmagick.spreadimage.php                            30-Sep-2022 11:00                2865
gmagick.stripimage.php                             30-Sep-2022 11:00                2521
gmagick.swirlimage.php                             30-Sep-2022 11:00                2946
gmagick.thumbnailimage.php                         30-Sep-2022 11:00                3561
gmagick.trimimage.php                              30-Sep-2022 11:00                3010
gmagick.write.php                                  30-Sep-2022 11:00                1690
gmagick.writeimage.php                             30-Sep-2022 11:00                3258
gmagickdraw.annotate.php                           30-Sep-2022 11:00                2994
gmagickdraw.arc.php                                30-Sep-2022 11:00                3994
gmagickdraw.bezier.php                             30-Sep-2022 11:00                2543
gmagickdraw.ellipse.php                            30-Sep-2022 11:00                3915
gmagickdraw.getfillcolor.php                       30-Sep-2022 11:00                2407
gmagickdraw.getfillopacity.php                     30-Sep-2022 11:00                2300
gmagickdraw.getfont.php                            30-Sep-2022 11:00                2338
gmagickdraw.getfontsize.php                        30-Sep-2022 11:00                2342
gmagickdraw.getfontstyle.php                       30-Sep-2022 11:00                2418
gmagickdraw.getfontweight.php                      30-Sep-2022 11:00                2263
gmagickdraw.getstrokecolor.php                     30-Sep-2022 11:00                2462
gmagickdraw.getstrokeopacity.php                   30-Sep-2022 11:00                2319
gmagickdraw.getstrokewidth.php                     30-Sep-2022 11:00                2338
gmagickdraw.gettextdecoration.php                  30-Sep-2022 11:00                2330
gmagickdraw.gettextencoding.php                    30-Sep-2022 11:00                2466
gmagickdraw.line.php                               30-Sep-2022 11:00                3386
gmagickdraw.point.php                              30-Sep-2022 11:00                2781
gmagickdraw.polygon.php                            30-Sep-2022 11:00                2610
gmagickdraw.polyline.php                           30-Sep-2022 11:00                2645
gmagickdraw.rectangle.php                          30-Sep-2022 11:00                3490
gmagickdraw.rotate.php                             30-Sep-2022 11:00                2601
gmagickdraw.roundrectangle.php                     30-Sep-2022 11:00                4159
gmagickdraw.scale.php                              30-Sep-2022 11:00                2845
gmagickdraw.setfillcolor.php                       30-Sep-2022 11:00                2900
gmagickdraw.setfillopacity.php                     30-Sep-2022 11:00                2699
gmagickdraw.setfont.php                            30-Sep-2022 11:00                2597
gmagickdraw.setfontsize.php                        30-Sep-2022 11:00                2629
gmagickdraw.setfontstyle.php                       30-Sep-2022 11:00                2760
gmagickdraw.setfontweight.php                      30-Sep-2022 11:00                2631
gmagickdraw.setstrokecolor.php                     30-Sep-2022 11:00                2924
gmagickdraw.setstrokeopacity.php                   30-Sep-2022 11:00                2717
gmagickdraw.setstrokewidth.php                     30-Sep-2022 11:00                2677
gmagickdraw.settextdecoration.php                  30-Sep-2022 11:00                2763
gmagickdraw.settextencoding.php                    30-Sep-2022 11:00                2969
gmagickpixel.construct.php                         30-Sep-2022 11:00                2473
gmagickpixel.getcolor.php                          30-Sep-2022 11:00                3637
gmagickpixel.getcolorcount.php                     30-Sep-2022 11:00                2391
gmagickpixel.getcolorvalue.php                     30-Sep-2022 11:00                2749
gmagickpixel.setcolor.php                          30-Sep-2022 11:00                2936
gmagickpixel.setcolorvalue.php                     30-Sep-2022 11:00                3163
gmp.configuration.php                              30-Sep-2022 11:00                1198
gmp.constants.php                                  30-Sep-2022 11:00                3111
gmp.examples.php                                   30-Sep-2022 11:00                3226
gmp.installation.php                               30-Sep-2022 11:00                1296
gmp.requirements.php                               30-Sep-2022 11:00                1679
gmp.serialize.php                                  30-Sep-2022 11:00                2139
gmp.setup.php                                      30-Sep-2022 11:00                1452
gmp.unserialize.php                                30-Sep-2022 11:00                2451
gnupg.configuration.php                            30-Sep-2022 11:00                1204
gnupg.constants.php                                30-Sep-2022 11:00                6346
gnupg.examples-clearsign.php                       30-Sep-2022 11:00                6715
gnupg.examples.php                                 30-Sep-2022 11:00                1337
gnupg.installation.php                             30-Sep-2022 11:00                1529
gnupg.requirements.php                             30-Sep-2022 11:00                1238
gnupg.resources.php                                30-Sep-2022 11:00                1151
gnupg.setup.php                                    30-Sep-2022 11:00                1541
hash.configuration.php                             30-Sep-2022 11:00                1199
hash.constants.php                                 30-Sep-2022 11:00                1662
hash.installation.php                              30-Sep-2022 11:00                1593
hash.requirements.php                              30-Sep-2022 11:00                1175
hash.resources.php                                 30-Sep-2022 11:00                1267
hash.setup.php                                     30-Sep-2022 11:00                1522
hashcontext.construct.php                          30-Sep-2022 11:00                1878
hashcontext.serialize.php                          30-Sep-2022 11:00                2285
hashcontext.unserialize.php                        30-Sep-2022 11:00                2577
history.php                                        30-Sep-2022 11:01                2125
history.php.books.php                              30-Sep-2022 11:01                2563
history.php.php                                    30-Sep-2022 11:01               10772
history.php.publications.php                       30-Sep-2022 11:01                1783
history.php.related.php                            30-Sep-2022 11:01                5945
hrtime-performancecounter.getfrequency.php         30-Sep-2022 11:00                2589
hrtime-performancecounter.getticks.php             30-Sep-2022 11:00                2462
hrtime-performancecounter.gettickssince.php        30-Sep-2022 11:00                2720
hrtime-stopwatch.getelapsedticks.php               30-Sep-2022 11:00                2364
hrtime-stopwatch.getelapsedtime.php                30-Sep-2022 11:00                2715
hrtime-stopwatch.getlastelapsedticks.php           30-Sep-2022 11:00                2432
hrtime-stopwatch.getlastelapsedtime.php            30-Sep-2022 11:00                2739
hrtime-stopwatch.isrunning.php                     30-Sep-2022 11:00                2323
hrtime-stopwatch.start.php                         30-Sep-2022 11:00                2317
hrtime-stopwatch.stop.php                          30-Sep-2022 11:00                2196
hrtime.example.basic.php                           30-Sep-2022 11:00                5957
hrtime.examples.php                                30-Sep-2022 11:00                1326
hrtime.installation.php                            30-Sep-2022 11:00                1928
hrtime.setup.php                                   30-Sep-2022 11:00                1343
ibase.configuration.php                            30-Sep-2022 11:00                7094
ibase.constants.php                                30-Sep-2022 11:00               18121
ibase.installation.php                             30-Sep-2022 11:00                3300
ibase.requirements.php                             30-Sep-2022 11:00                1153
ibase.resources.php                                30-Sep-2022 11:00                1151
ibase.setup.php                                    30-Sep-2022 11:00                1559
ibm-db2.configuration.php                          30-Sep-2022 11:00                9260
ibm-db2.constants.php                              30-Sep-2022 11:00                6796
ibm-db2.installation.php                           30-Sep-2022 11:00                3513
ibm-db2.requirements.php                           30-Sep-2022 11:00                3177
ibm-db2.resources.php                              30-Sep-2022 11:00                1228
ibm-db2.setup.php                                  30-Sep-2022 11:00                1571
iconv.configuration.php                            30-Sep-2022 11:00                4442
iconv.constants.php                                30-Sep-2022 11:00                3131
iconv.installation.php                             30-Sep-2022 11:00                1529
iconv.requirements.php                             30-Sep-2022 11:00                1454
iconv.resources.php                                30-Sep-2022 11:00                1151
iconv.setup.php                                    30-Sep-2022 11:00                1547
igbinary.configuration.php                         30-Sep-2022 11:01                3225
igbinary.installation.php                          30-Sep-2022 11:01                1927
igbinary.requirements.php                          30-Sep-2022 11:01                1174
igbinary.setup.php                                 30-Sep-2022 11:01                1497
image.configuration.php                            30-Sep-2022 11:00                3218
image.constants.php                                30-Sep-2022 11:00               40168
image.examples-png.php                             30-Sep-2022 11:00                4859
image.examples-watermark.php                       30-Sep-2022 11:00                6177
image.examples.merged-watermark.php                30-Sep-2022 11:00                9057
image.examples.php                                 30-Sep-2022 11:00                1553
image.installation.php                             30-Sep-2022 11:00                5697
image.requirements.php                             30-Sep-2022 11:00                3862
image.resources.php                                30-Sep-2022 11:00                1998
image.setup.php                                    30-Sep-2022 11:00                1544
imagick.adaptiveblurimage.php                      30-Sep-2022 11:00                6630
imagick.adaptiveresizeimage.php                    30-Sep-2022 11:00                8748
imagick.adaptivesharpenimage.php                   30-Sep-2022 11:00                6242
imagick.adaptivethresholdimage.php                 30-Sep-2022 11:00                6120
imagick.addimage.php                               30-Sep-2022 11:00                2767
imagick.addnoiseimage.php                          30-Sep-2022 11:00                5396
imagick.affinetransformimage.php                   30-Sep-2022 11:00                6957
imagick.animateimages.php                          30-Sep-2022 11:00                2979
imagick.annotateimage.php                          30-Sep-2022 11:00                8631
imagick.appendimages.php                           30-Sep-2022 11:00                6685
imagick.autolevelimage.php                         30-Sep-2022 11:00                4353
imagick.averageimages.php                          30-Sep-2022 11:00                2689
imagick.blackthresholdimage.php                    30-Sep-2022 11:00                5324
imagick.blueshiftimage.php                         30-Sep-2022 11:00                4422
imagick.blurimage.php                              30-Sep-2022 11:00                5522
imagick.borderimage.php                            30-Sep-2022 11:00                5986
imagick.brightnesscontrastimage.php                30-Sep-2022 11:00                5474
imagick.charcoalimage.php                          30-Sep-2022 11:00                4889
imagick.chopimage.php                              30-Sep-2022 11:00                6848
imagick.clampimage.php                             30-Sep-2022 11:00                2421
imagick.clear.php                                  30-Sep-2022 11:00                2120
imagick.clipimage.php                              30-Sep-2022 11:00                2355
imagick.clipimagepath.php                          30-Sep-2022 11:00                2921
imagick.clippathimage.php                          30-Sep-2022 11:00                3203
imagick.clone.php                                  30-Sep-2022 11:00                4229
imagick.clutimage.php                              30-Sep-2022 11:00                5935
imagick.coalesceimages.php                         30-Sep-2022 11:00                2765
imagick.colorfloodfillimage.php                    30-Sep-2022 11:00                5224
imagick.colorizeimage.php                          30-Sep-2022 11:00                6926
imagick.colormatriximage.php                       30-Sep-2022 11:00                8381
imagick.combineimages.php                          30-Sep-2022 11:00                3212
imagick.commentimage.php                           30-Sep-2022 11:00                4918
imagick.compareimagechannels.php                   30-Sep-2022 11:00                3750
imagick.compareimagelayers.php                     30-Sep-2022 11:00                5479
imagick.compareimages.php                          30-Sep-2022 11:00                5569
imagick.compositeimage.php                         30-Sep-2022 11:00                7796
imagick.configuration.php                          30-Sep-2022 11:00                3983
imagick.constants.php                              30-Sep-2022 11:00              110923
imagick.construct.php                              30-Sep-2022 11:00                2595
imagick.contrastimage.php                          30-Sep-2022 11:00                5040
imagick.contraststretchimage.php                   30-Sep-2022 11:00                3584
imagick.convolveimage.php                          30-Sep-2022 11:00                5948
imagick.count.php                                  30-Sep-2022 11:00                2570
imagick.cropimage.php                              30-Sep-2022 11:00                5946
imagick.cropthumbnailimage.php                     30-Sep-2022 11:00                3158
imagick.current.php                                30-Sep-2022 11:00                2426
imagick.cyclecolormapimage.php                     30-Sep-2022 11:00                2792
imagick.decipherimage.php                          30-Sep-2022 11:00                3071
imagick.deconstructimages.php                      30-Sep-2022 11:00                2581
imagick.deleteimageartifact.php                    30-Sep-2022 11:00                3482
imagick.deleteimageproperty.php                    30-Sep-2022 11:00                2436
imagick.deskewimage.php                            30-Sep-2022 11:00               11642
imagick.despeckleimage.php                         30-Sep-2022 11:00                4228
imagick.destroy.php                                30-Sep-2022 11:00                2258
imagick.displayimage.php                           30-Sep-2022 11:00                2591
imagick.displayimages.php                          30-Sep-2022 11:00                2635
imagick.distortimage.php                           30-Sep-2022 11:00               12879
imagick.drawimage.php                              30-Sep-2022 11:00                2498
imagick.edgeimage.php                              30-Sep-2022 11:00                4599
imagick.embossimage.php                            30-Sep-2022 11:00                5252
imagick.encipherimage.php                          30-Sep-2022 11:00                3067
imagick.enhanceimage.php                           30-Sep-2022 11:00                4195
imagick.equalizeimage.php                          30-Sep-2022 11:00                4162
imagick.evaluateimage.php                          30-Sep-2022 11:00                5730
imagick.examples-1.php                             30-Sep-2022 11:00               32556
imagick.examples.php                               30-Sep-2022 11:00                1339
imagick.exportimagepixels.php                      30-Sep-2022 11:00                7632
imagick.extentimage.php                            30-Sep-2022 11:00                4937
imagick.filter.php                                 30-Sep-2022 11:00                7819
imagick.flattenimages.php                          30-Sep-2022 11:00                2743
imagick.flipimage.php                              30-Sep-2022 11:00                4506
imagick.floodfillpaintimage.php                    30-Sep-2022 11:00               11564
imagick.flopimage.php                              30-Sep-2022 11:00                4538
imagick.forwardfouriertransformimage.php           30-Sep-2022 11:00               12975
imagick.frameimage.php                             30-Sep-2022 11:00                8468
imagick.functionimage.php                          30-Sep-2022 11:00               13683
imagick.fximage.php                                30-Sep-2022 11:00                6080
imagick.gammaimage.php                             30-Sep-2022 11:00                5594
imagick.gaussianblurimage.php                      30-Sep-2022 11:00                6086
imagick.getcolorspace.php                          30-Sep-2022 11:00                2356
imagick.getcompression.php                         30-Sep-2022 11:00                2185
imagick.getcompressionquality.php                  30-Sep-2022 11:00                2259
imagick.getcopyright.php                           30-Sep-2022 11:00                2286
imagick.getfilename.php                            30-Sep-2022 11:00                2343
imagick.getfont.php                                30-Sep-2022 11:00                2975
imagick.getformat.php                              30-Sep-2022 11:00                2305
imagick.getgravity.php                             30-Sep-2022 11:00                2335
imagick.gethomeurl.php                             30-Sep-2022 11:00                2163
imagick.getimage.php                               30-Sep-2022 11:00                2407
imagick.getimagealphachannel.php                   30-Sep-2022 11:00                3214
imagick.getimageartifact.php                       30-Sep-2022 11:00                3431
imagick.getimageattribute.php                      30-Sep-2022 11:00                2680
imagick.getimagebackgroundcolor.php                30-Sep-2022 11:00                2573
imagick.getimageblob.php                           30-Sep-2022 11:00                2599
imagick.getimageblueprimary.php                    30-Sep-2022 11:00                2808
imagick.getimagebordercolor.php                    30-Sep-2022 11:00                2530
imagick.getimagechanneldepth.php                   30-Sep-2022 11:00                2943
imagick.getimagechanneldistortion.php              30-Sep-2022 11:00                3834
imagick.getimagechanneldistortions.php             30-Sep-2022 11:00                4149
imagick.getimagechannelextrema.php                 30-Sep-2022 11:00                3448
imagick.getimagechannelkurtosis.php                30-Sep-2022 11:00                3392
imagick.getimagechannelmean.php                    30-Sep-2022 11:00                3112
imagick.getimagechannelrange.php                   30-Sep-2022 11:00                3245
imagick.getimagechannelstatistics.php              30-Sep-2022 11:00                2464
imagick.getimageclipmask.php                       30-Sep-2022 11:00                2938
imagick.getimagecolormapcolor.php                  30-Sep-2022 11:00                2819
imagick.getimagecolors.php                         30-Sep-2022 11:00                2271
imagick.getimagecolorspace.php                     30-Sep-2022 11:00                2312
imagick.getimagecompose.php                        30-Sep-2022 11:00                2270
imagick.getimagecompression.php                    30-Sep-2022 11:00                2273
imagick.getimagecompressionquality.php             30-Sep-2022 11:00                2367
imagick.getimagedelay.php                          30-Sep-2022 11:00                2338
imagick.getimagedepth.php                          30-Sep-2022 11:00                2118
imagick.getimagedispose.php                        30-Sep-2022 11:00                2378
imagick.getimagedistortion.php                     30-Sep-2022 11:00                3158
imagick.getimageextrema.php                        30-Sep-2022 11:00                2794
imagick.getimagefilename.php                       30-Sep-2022 11:00                2450
imagick.getimageformat.php                         30-Sep-2022 11:00                2432
imagick.getimagegamma.php                          30-Sep-2022 11:00                2333
imagick.getimagegeometry.php                       30-Sep-2022 11:00                4062
imagick.getimagegravity.php                        30-Sep-2022 11:00                2628
imagick.getimagegreenprimary.php                   30-Sep-2022 11:00                2603
imagick.getimageheight.php                         30-Sep-2022 11:00                2364
imagick.getimagehistogram.php                      30-Sep-2022 11:00               19695
imagick.getimageindex.php                          30-Sep-2022 11:00                2901
imagick.getimageinterlacescheme.php                30-Sep-2022 11:00                2410
imagick.getimageinterpolatemethod.php              30-Sep-2022 11:00                2637
imagick.getimageiterations.php                     30-Sep-2022 11:00                2426
imagick.getimagelength.php                         30-Sep-2022 11:00                3339
imagick.getimagematte.php                          30-Sep-2022 11:00                2641
imagick.getimagemattecolor.php                     30-Sep-2022 11:00                2767
imagick.getimagemimetype.php                       30-Sep-2022 11:00                2165
imagick.getimageorientation.php                    30-Sep-2022 11:00                2530
imagick.getimagepage.php                           30-Sep-2022 11:00                2595
imagick.getimagepixelcolor.php                     30-Sep-2022 11:00                3016
imagick.getimageprofile.php                        30-Sep-2022 11:00                2652
imagick.getimageprofiles.php                       30-Sep-2022 11:00                3198
imagick.getimageproperties.php                     30-Sep-2022 11:00                5627
imagick.getimageproperty.php                       30-Sep-2022 11:00                4859
imagick.getimageredprimary.php                     30-Sep-2022 11:00                2671
imagick.getimageregion.php                         30-Sep-2022 11:00                3708
imagick.getimagerenderingintent.php                30-Sep-2022 11:00                2554
imagick.getimageresolution.php                     30-Sep-2022 11:00                2430
imagick.getimagesblob.php                          30-Sep-2022 11:00                2441
imagick.getimagescene.php                          30-Sep-2022 11:00                2320
imagick.getimagesignature.php                      30-Sep-2022 11:00                2447
imagick.getimagesize.php                           30-Sep-2022 11:00                2579
imagick.getimagetickspersecond.php                 30-Sep-2022 11:00                2466
imagick.getimagetotalinkdensity.php                30-Sep-2022 11:00                2396
imagick.getimagetype.php                           30-Sep-2022 11:00                3956
imagick.getimageunits.php                          30-Sep-2022 11:00                2382
imagick.getimagevirtualpixelmethod.php             30-Sep-2022 11:00                2533
imagick.getimagewhitepoint.php                     30-Sep-2022 11:00                2583
imagick.getimagewidth.php                          30-Sep-2022 11:00                2338
imagick.getinterlacescheme.php                     30-Sep-2022 11:00                2484
imagick.getiteratorindex.php                       30-Sep-2022 11:00                6106
imagick.getnumberimages.php                        30-Sep-2022 11:00                2433
imagick.getoption.php                              30-Sep-2022 11:00                2626
imagick.getpackagename.php                         30-Sep-2022 11:00                2404
imagick.getpage.php                                30-Sep-2022 11:00                2419
imagick.getpixeliterator.php                       30-Sep-2022 11:00                6789
imagick.getpixelregioniterator.php                 30-Sep-2022 11:00                6748
imagick.getpointsize.php                           30-Sep-2022 11:00                2657
imagick.getquantum.php                             30-Sep-2022 11:00                2132
imagick.getquantumdepth.php                        30-Sep-2022 11:00                2517
imagick.getquantumrange.php                        30-Sep-2022 11:00                2661
imagick.getregistry.php                            30-Sep-2022 11:00                2360
imagick.getreleasedate.php                         30-Sep-2022 11:00                2428
imagick.getresource.php                            30-Sep-2022 11:00                2787
imagick.getresourcelimit.php                       30-Sep-2022 11:00                3215
imagick.getsamplingfactors.php                     30-Sep-2022 11:00                2494
imagick.getsize.php                                30-Sep-2022 11:00                5811
imagick.getsizeoffset.php                          30-Sep-2022 11:00                2476
imagick.getversion.php                             30-Sep-2022 11:00                2416
imagick.haldclutimage.php                          30-Sep-2022 11:00                6009
imagick.hasnextimage.php                           30-Sep-2022 11:00                2406
imagick.haspreviousimage.php                       30-Sep-2022 11:00                2444
imagick.identifyformat.php                         30-Sep-2022 11:00                4474
imagick.identifyimage.php                          30-Sep-2022 11:00                3826
imagick.implodeimage.php                           30-Sep-2022 11:00                4584
imagick.importimagepixels.php                      30-Sep-2022 11:00               11669
imagick.installation.php                           30-Sep-2022 11:00                2948
imagick.inversefouriertransformimage.php           30-Sep-2022 11:00                3253
imagick.labelimage.php                             30-Sep-2022 11:00                2394
imagick.levelimage.php                             30-Sep-2022 11:00                7672
imagick.linearstretchimage.php                     30-Sep-2022 11:00                5632
imagick.liquidrescaleimage.php                     30-Sep-2022 11:00                4170
imagick.listregistry.php                           30-Sep-2022 11:00                2251
imagick.magnifyimage.php                           30-Sep-2022 11:00                4194
imagick.mapimage.php                               30-Sep-2022 11:00                3057
imagick.mattefloodfillimage.php                    30-Sep-2022 11:00                5462
imagick.medianfilterimage.php                      30-Sep-2022 11:00                5079
imagick.mergeimagelayers.php                       30-Sep-2022 11:00                6593
imagick.minifyimage.php                            30-Sep-2022 11:00                2238
imagick.modulateimage.php                          30-Sep-2022 11:00                5476
imagick.montageimage.php                           30-Sep-2022 11:00                4319
imagick.morphimages.php                            30-Sep-2022 11:00                2715
imagick.morphology.php                             30-Sep-2022 11:00               75777
imagick.mosaicimages.php                           30-Sep-2022 11:00                2648
imagick.motionblurimage.php                        30-Sep-2022 11:00                6603
imagick.negateimage.php                            30-Sep-2022 11:00                5443
imagick.newimage.php                               30-Sep-2022 11:00                6068
imagick.newpseudoimage.php                         30-Sep-2022 11:00                5676
imagick.nextimage.php                              30-Sep-2022 11:00                2170
imagick.normalizeimage.php                         30-Sep-2022 11:00                6452
imagick.oilpaintimage.php                          30-Sep-2022 11:00                4542
imagick.opaquepaintimage.php                       30-Sep-2022 11:00                4673
imagick.optimizeimagelayers.php                    30-Sep-2022 11:00                5308
imagick.orderedposterizeimage.php                  30-Sep-2022 11:00                6778
imagick.paintfloodfillimage.php                    30-Sep-2022 11:00                5433
imagick.paintopaqueimage.php                       30-Sep-2022 11:00                5226
imagick.painttransparentimage.php                  30-Sep-2022 11:00                4446
imagick.pingimage.php                              30-Sep-2022 11:00                2516
imagick.pingimageblob.php                          30-Sep-2022 11:00                6011
imagick.pingimagefile.php                          30-Sep-2022 11:00                5723
imagick.polaroidimage.php                          30-Sep-2022 11:00                4665
imagick.posterizeimage.php                         30-Sep-2022 11:00                5560
imagick.previewimages.php                          30-Sep-2022 11:00                2915
imagick.previousimage.php                          30-Sep-2022 11:00                2225
imagick.profileimage.php                           30-Sep-2022 11:00                3004
imagick.quantizeimage.php                          30-Sep-2022 11:00                6465
imagick.quantizeimages.php                         30-Sep-2022 11:00                3614
imagick.queryfontmetrics.php                       30-Sep-2022 11:00                5545
imagick.queryfonts.php                             30-Sep-2022 11:00                4987
imagick.queryformats.php                           30-Sep-2022 11:00                8212
imagick.radialblurimage.php                        30-Sep-2022 11:00                5512
imagick.raiseimage.php                             30-Sep-2022 11:00                6322
imagick.randomthresholdimage.php                   30-Sep-2022 11:00                6430
imagick.readimage.php                              30-Sep-2022 11:00                2358
imagick.readimageblob.php                          30-Sep-2022 11:00                5405
imagick.readimagefile.php                          30-Sep-2022 11:00                2888
imagick.readimages.php                             30-Sep-2022 11:00                2380
imagick.recolorimage.php                           30-Sep-2022 11:00                6611
imagick.reducenoiseimage.php                       30-Sep-2022 11:00                5129
imagick.remapimage.php                             30-Sep-2022 11:00                3248
imagick.removeimage.php                            30-Sep-2022 11:00                2361
imagick.removeimageprofile.php                     30-Sep-2022 11:00                2647
imagick.render.php                                 30-Sep-2022 11:00                2133
imagick.requirements.php                           30-Sep-2022 11:00                1517
imagick.resampleimage.php                          30-Sep-2022 11:00                5416
imagick.resetimagepage.php                         30-Sep-2022 11:00                2610
imagick.resizeimage.php                            30-Sep-2022 11:00               11761
imagick.resources.php                              30-Sep-2022 11:00                1165
imagick.rollimage.php                              30-Sep-2022 11:00                4696
imagick.rotateimage.php                            30-Sep-2022 11:00                5670
imagick.rotationalblurimage.php                    30-Sep-2022 11:00                5577
imagick.roundcorners.php                           30-Sep-2022 11:00                6349
imagick.sampleimage.php                            30-Sep-2022 11:00                2729
imagick.scaleimage.php                             30-Sep-2022 11:00                6606
imagick.segmentimage.php                           30-Sep-2022 11:00                6578
imagick.selectiveblurimage.php                     30-Sep-2022 11:00                6299
imagick.separateimagechannel.php                   30-Sep-2022 11:00                5329
imagick.sepiatoneimage.php                         30-Sep-2022 11:00                4820
imagick.setbackgroundcolor.php                     30-Sep-2022 11:00                3161
imagick.setcolorspace.php                          30-Sep-2022 11:00                2801
imagick.setcompression.php                         30-Sep-2022 11:00                2577
imagick.setcompressionquality.php                  30-Sep-2022 11:00                7258
imagick.setfilename.php                            30-Sep-2022 11:00                2445
imagick.setfirstiterator.php                       30-Sep-2022 11:00                2219
imagick.setfont.php                                30-Sep-2022 11:00                5512
imagick.setformat.php                              30-Sep-2022 11:00                2347
imagick.setgravity.php                             30-Sep-2022 11:00                2586
imagick.setimage.php                               30-Sep-2022 11:00                4679
imagick.setimagealphachannel.php                   30-Sep-2022 11:00                3491
imagick.setimageartifact.php                       30-Sep-2022 11:00                7349
imagick.setimageattribute.php                      30-Sep-2022 11:00                3055
imagick.setimagebackgroundcolor.php                30-Sep-2022 11:00                3390
imagick.setimagebias.php                           30-Sep-2022 11:00                7007
imagick.setimagebiasquantum.php                    30-Sep-2022 11:00                2811
imagick.setimageblueprimary.php                    30-Sep-2022 11:00                2908
imagick.setimagebordercolor.php                    30-Sep-2022 11:00                3368
imagick.setimagechanneldepth.php                   30-Sep-2022 11:00                2925
imagick.setimageclipmask.php                       30-Sep-2022 11:00                9371
imagick.setimagecolormapcolor.php                  30-Sep-2022 11:00                3006
imagick.setimagecolorspace.php                     30-Sep-2022 11:00                3023
imagick.setimagecompose.php                        30-Sep-2022 11:00                2742
imagick.setimagecompression.php                    30-Sep-2022 11:00                2714
imagick.setimagecompressionquality.php             30-Sep-2022 11:00                4812
imagick.setimagedelay.php                          30-Sep-2022 11:00                6273
imagick.setimagedepth.php                          30-Sep-2022 11:00                2560
imagick.setimagedispose.php                        30-Sep-2022 11:00                2604
imagick.setimageextent.php                         30-Sep-2022 11:00                2825
imagick.setimagefilename.php                       30-Sep-2022 11:00                2654
imagick.setimageformat.php                         30-Sep-2022 11:00                2546
imagick.setimagegamma.php                          30-Sep-2022 11:00                2564
imagick.setimagegravity.php                        30-Sep-2022 11:00                2751
imagick.setimagegreenprimary.php                   30-Sep-2022 11:00                2901
imagick.setimageindex.php                          30-Sep-2022 11:00                3174
imagick.setimageinterlacescheme.php                30-Sep-2022 11:00                2724
imagick.setimageinterpolatemethod.php              30-Sep-2022 11:00                2651
imagick.setimageiterations.php                     30-Sep-2022 11:00                4859
imagick.setimagematte.php                          30-Sep-2022 11:00                2569
imagick.setimagemattecolor.php                     30-Sep-2022 11:00                3593
imagick.setimageopacity.php                        30-Sep-2022 11:00                4941
imagick.setimageorientation.php                    30-Sep-2022 11:00                4671
imagick.setimagepage.php                           30-Sep-2022 11:00                3356
imagick.setimageprofile.php                        30-Sep-2022 11:00                3040
imagick.setimageproperty.php                       30-Sep-2022 11:00                4971
imagick.setimageredprimary.php                     30-Sep-2022 11:00                2897
imagick.setimagerenderingintent.php                30-Sep-2022 11:00                2730
imagick.setimageresolution.php                     30-Sep-2022 11:00                4899
imagick.setimagescene.php                          30-Sep-2022 11:00                2584
imagick.setimagetickspersecond.php                 30-Sep-2022 11:00                8264
imagick.setimagetype.php                           30-Sep-2022 11:00                2382
imagick.setimageunits.php                          30-Sep-2022 11:00                2418
imagick.setimagevirtualpixelmethod.php             30-Sep-2022 11:00                2538
imagick.setimagewhitepoint.php                     30-Sep-2022 11:00                2895
imagick.setinterlacescheme.php                     30-Sep-2022 11:00                2466
imagick.setiteratorindex.php                       30-Sep-2022 11:00                6166
imagick.setlastiterator.php                        30-Sep-2022 11:00                2233
imagick.setoption.php                              30-Sep-2022 11:00               12872
imagick.setpage.php                                30-Sep-2022 11:00                3109
imagick.setpointsize.php                           30-Sep-2022 11:00                5212
imagick.setprogressmonitor.php                     30-Sep-2022 11:00               12720
imagick.setregistry.php                            30-Sep-2022 11:00                2763
imagick.setresolution.php                          30-Sep-2022 11:00                3535
imagick.setresourcelimit.php                       30-Sep-2022 11:00                3440
imagick.setsamplingfactors.php                     30-Sep-2022 11:00                7105
imagick.setsize.php                                30-Sep-2022 11:00                2643
imagick.setsizeoffset.php                          30-Sep-2022 11:00                3098
imagick.settype.php                                30-Sep-2022 11:00                2328
imagick.setup.php                                  30-Sep-2022 11:00                1566
imagick.shadeimage.php                             30-Sep-2022 11:00                5477
imagick.shadowimage.php                            30-Sep-2022 11:00                5227
imagick.sharpenimage.php                           30-Sep-2022 11:00                5461
imagick.shaveimage.php                             30-Sep-2022 11:00                4628
imagick.shearimage.php                             30-Sep-2022 11:00                6406
imagick.sigmoidalcontrastimage.php                 30-Sep-2022 11:00                7774
imagick.sketchimage.php                            30-Sep-2022 11:00                5695
imagick.smushimages.php                            30-Sep-2022 11:00                5796
imagick.solarizeimage.php                          30-Sep-2022 11:00                4795
imagick.sparsecolorimage.php                       30-Sep-2022 11:00               31255
imagick.spliceimage.php                            30-Sep-2022 11:00                5615
imagick.spreadimage.php                            30-Sep-2022 11:00                4595
imagick.statisticimage.php                         30-Sep-2022 11:00                6691
imagick.steganoimage.php                           30-Sep-2022 11:00                2912
imagick.stereoimage.php                            30-Sep-2022 11:00                2693
imagick.stripimage.php                             30-Sep-2022 11:00                2358
imagick.subimagematch.php                          30-Sep-2022 11:00                7642
imagick.swirlimage.php                             30-Sep-2022 11:00                4647
imagick.textureimage.php                           30-Sep-2022 11:00                6369
imagick.thresholdimage.php                         30-Sep-2022 11:00                5167
imagick.thumbnailimage.php                         30-Sep-2022 11:00                7053
imagick.tintimage.php                              30-Sep-2022 11:00                7965
imagick.tostring.php                               30-Sep-2022 11:00                2867
imagick.transformimage.php                         30-Sep-2022 11:00                5983
imagick.transformimagecolorspace.php               30-Sep-2022 11:00                5787
imagick.transparentpaintimage.php                  30-Sep-2022 11:00                7304
imagick.transposeimage.php                         30-Sep-2022 11:00                4581
imagick.transverseimage.php                        30-Sep-2022 11:00                4569
imagick.trimimage.php                              30-Sep-2022 11:00                5688
imagick.uniqueimagecolors.php                      30-Sep-2022 11:00                5627
imagick.unsharpmaskimage.php                       30-Sep-2022 11:00                6451
imagick.valid.php                                  30-Sep-2022 11:00                2113
imagick.vignetteimage.php                          30-Sep-2022 11:00                6428
imagick.waveimage.php                              30-Sep-2022 11:00                6282
imagick.whitethresholdimage.php                    30-Sep-2022 11:00                5236
imagick.writeimage.php                             30-Sep-2022 11:00                2825
imagick.writeimagefile.php                         30-Sep-2022 11:00                3520
imagick.writeimages.php                            30-Sep-2022 11:00                2624
imagick.writeimagesfile.php                        30-Sep-2022 11:00                3570
imagickdraw.affine.php                             30-Sep-2022 11:00               18678
imagickdraw.annotation.php                         30-Sep-2022 11:00                3061
imagickdraw.arc.php                                30-Sep-2022 11:00                9860
imagickdraw.bezier.php                             30-Sep-2022 11:00               19598
imagickdraw.circle.php                             30-Sep-2022 11:00                9223
imagickdraw.clear.php                              30-Sep-2022 11:00                2254
imagickdraw.clone.php                              30-Sep-2022 11:00                2406
imagickdraw.color.php                              30-Sep-2022 11:00                3223
imagickdraw.comment.php                            30-Sep-2022 11:00                2555
imagickdraw.composite.php                          30-Sep-2022 11:00               12245
imagickdraw.construct.php                          30-Sep-2022 11:00                2184
imagickdraw.destroy.php                            30-Sep-2022 11:00                2226
imagickdraw.ellipse.php                            30-Sep-2022 11:00               12456
imagickdraw.getclippath.php                        30-Sep-2022 11:00                2221
imagickdraw.getcliprule.php                        30-Sep-2022 11:00                2344
imagickdraw.getclipunits.php                       30-Sep-2022 11:00                2230
imagickdraw.getfillcolor.php                       30-Sep-2022 11:00                2355
imagickdraw.getfillopacity.php                     30-Sep-2022 11:00                2257
imagickdraw.getfillrule.php                        30-Sep-2022 11:00                2306
imagickdraw.getfont.php                            30-Sep-2022 11:00                2188
imagickdraw.getfontfamily.php                      30-Sep-2022 11:00                2248
imagickdraw.getfontsize.php                        30-Sep-2022 11:00                2326
imagickdraw.getfontstretch.php                     30-Sep-2022 11:00                2235
imagickdraw.getfontstyle.php                       30-Sep-2022 11:00                2469
imagickdraw.getfontweight.php                      30-Sep-2022 11:00                2250
imagickdraw.getgravity.php                         30-Sep-2022 11:00                2374
imagickdraw.getstrokeantialias.php                 30-Sep-2022 11:00                2542
imagickdraw.getstrokecolor.php                     30-Sep-2022 11:00                2753
imagickdraw.getstrokedasharray.php                 30-Sep-2022 11:00                2384
imagickdraw.getstrokedashoffset.php                30-Sep-2022 11:00                2358
imagickdraw.getstrokelinecap.php                   30-Sep-2022 11:00                2499
imagickdraw.getstrokelinejoin.php                  30-Sep-2022 11:00                2528
imagickdraw.getstrokemiterlimit.php                30-Sep-2022 11:00                2620
imagickdraw.getstrokeopacity.php                   30-Sep-2022 11:00                2303
imagickdraw.getstrokewidth.php                     30-Sep-2022 11:00                2312
imagickdraw.gettextalignment.php                   30-Sep-2022 11:00                2390
imagickdraw.gettextantialias.php                   30-Sep-2022 11:00                2423
imagickdraw.gettextdecoration.php                  30-Sep-2022 11:00                2427
imagickdraw.gettextencoding.php                    30-Sep-2022 11:00                2350
imagickdraw.gettextinterlinespacing.php            30-Sep-2022 11:00                2295
imagickdraw.gettextinterwordspacing.php            30-Sep-2022 11:00                2319
imagickdraw.gettextkerning.php                     30-Sep-2022 11:00                2224
imagickdraw.gettextundercolor.php                  30-Sep-2022 11:00                2458
imagickdraw.getvectorgraphics.php                  30-Sep-2022 11:00                2448
imagickdraw.line.php                               30-Sep-2022 11:00                8397
imagickdraw.matte.php                              30-Sep-2022 11:00                8380
imagickdraw.pathclose.php                          30-Sep-2022 11:00                2349
imagickdraw.pathcurvetoabsolute.php                30-Sep-2022 11:00                4485
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-Sep-2022 11:00               12212
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-Sep-2022 11:00                3974
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-Sep-2022 11:00               10799
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-Sep-2022 11:00               10931
imagickdraw.pathcurvetorelative.php                30-Sep-2022 11:00                4501
imagickdraw.pathcurvetosmoothabsolute.php          30-Sep-2022 11:00                4346
imagickdraw.pathcurvetosmoothrelative.php          30-Sep-2022 11:00                4353
imagickdraw.pathellipticarcabsolute.php            30-Sep-2022 11:00                5151
imagickdraw.pathellipticarcrelative.php            30-Sep-2022 11:00                5121
imagickdraw.pathfinish.php                         30-Sep-2022 11:00                2182
imagickdraw.pathlinetoabsolute.php                 30-Sep-2022 11:00                3007
imagickdraw.pathlinetohorizontalabsolute.php       30-Sep-2022 11:00                2911
imagickdraw.pathlinetohorizontalrelative.php       30-Sep-2022 11:00                2906
imagickdraw.pathlinetorelative.php                 30-Sep-2022 11:00                3057
imagickdraw.pathlinetoverticalabsolute.php         30-Sep-2022 11:00                2875
imagickdraw.pathlinetoverticalrelative.php         30-Sep-2022 11:00                2880
imagickdraw.pathmovetoabsolute.php                 30-Sep-2022 11:00                3054
imagickdraw.pathmovetorelative.php                 30-Sep-2022 11:00                2990
imagickdraw.pathstart.php                          30-Sep-2022 11:00               12447
imagickdraw.point.php                              30-Sep-2022 11:00                7039
imagickdraw.polygon.php                            30-Sep-2022 11:00                9473
imagickdraw.polyline.php                           30-Sep-2022 11:00                9467
imagickdraw.pop.php                                30-Sep-2022 11:00                2480
imagickdraw.popclippath.php                        30-Sep-2022 11:00                2141
imagickdraw.popdefs.php                            30-Sep-2022 11:00                8077
imagickdraw.poppattern.php                         30-Sep-2022 11:00                2213
imagickdraw.push.php                               30-Sep-2022 11:00                8694
imagickdraw.pushclippath.php                       30-Sep-2022 11:00                2782
imagickdraw.pushdefs.php                           30-Sep-2022 11:00                2440
imagickdraw.pushpattern.php                        30-Sep-2022 11:00               15178
imagickdraw.rectangle.php                          30-Sep-2022 11:00                8638
imagickdraw.render.php                             30-Sep-2022 11:00                2255
imagickdraw.resetvectorgraphics.php                30-Sep-2022 11:00                2256
imagickdraw.rotate.php                             30-Sep-2022 11:00                7985
imagickdraw.roundrectangle.php                     30-Sep-2022 11:00                9350
imagickdraw.scale.php                              30-Sep-2022 11:00                8282
imagickdraw.setclippath.php                        30-Sep-2022 11:00                8725
imagickdraw.setcliprule.php                        30-Sep-2022 11:00                9833
imagickdraw.setclipunits.php                       30-Sep-2022 11:00                9175
imagickdraw.setfillalpha.php                       30-Sep-2022 11:00                8001
imagickdraw.setfillcolor.php                       30-Sep-2022 11:00                8071
imagickdraw.setfillopacity.php                     30-Sep-2022 11:00                8059
imagickdraw.setfillpatternurl.php                  30-Sep-2022 11:00                2991
imagickdraw.setfillrule.php                        30-Sep-2022 11:00               14780
imagickdraw.setfont.php                            30-Sep-2022 11:00                9586
imagickdraw.setfontfamily.php                      30-Sep-2022 11:00               10288
imagickdraw.setfontsize.php                        30-Sep-2022 11:00                8662
imagickdraw.setfontstretch.php                     30-Sep-2022 11:00               10494
imagickdraw.setfontstyle.php                       30-Sep-2022 11:00                9299
imagickdraw.setfontweight.php                      30-Sep-2022 11:00                9502
imagickdraw.setgravity.php                         30-Sep-2022 11:00               11401
imagickdraw.setresolution.php                      30-Sep-2022 11:00                2644
imagickdraw.setstrokealpha.php                     30-Sep-2022 11:00                8711
imagickdraw.setstrokeantialias.php                 30-Sep-2022 11:00                9269
imagickdraw.setstrokecolor.php                     30-Sep-2022 11:00                8828
imagickdraw.setstrokedasharray.php                 30-Sep-2022 11:00               13933
imagickdraw.setstrokedashoffset.php                30-Sep-2022 11:00               10342
imagickdraw.setstrokelinecap.php                   30-Sep-2022 11:00                8993
imagickdraw.setstrokelinejoin.php                  30-Sep-2022 11:00               12574
imagickdraw.setstrokemiterlimit.php                30-Sep-2022 11:00               12166
imagickdraw.setstrokeopacity.php                   30-Sep-2022 11:00               10637
imagickdraw.setstrokepatternurl.php                30-Sep-2022 11:00                2753
imagickdraw.setstrokewidth.php                     30-Sep-2022 11:00                8742
imagickdraw.settextalignment.php                   30-Sep-2022 11:00                9783
imagickdraw.settextantialias.php                   30-Sep-2022 11:00                9246
imagickdraw.settextdecoration.php                  30-Sep-2022 11:00                7679
imagickdraw.settextencoding.php                    30-Sep-2022 11:00                2989
imagickdraw.settextinterlinespacing.php            30-Sep-2022 11:00                2710
imagickdraw.settextinterwordspacing.php            30-Sep-2022 11:00                2550
imagickdraw.settextkerning.php                     30-Sep-2022 11:00                2629
imagickdraw.settextundercolor.php                  30-Sep-2022 11:00                8088
imagickdraw.setvectorgraphics.php                  30-Sep-2022 11:00                9463
imagickdraw.setviewbox.php                         30-Sep-2022 11:00               10878
imagickdraw.skewx.php                              30-Sep-2022 11:00                8496
imagickdraw.skewy.php                              30-Sep-2022 11:00                8485
imagickdraw.translate.php                          30-Sep-2022 11:00                8779
imagickkernel.addkernel.php                        30-Sep-2022 11:00                7613
imagickkernel.addunitykernel.php                   30-Sep-2022 11:00               15960
imagickkernel.frombuiltin.php                      30-Sep-2022 11:00               29667
imagickkernel.frommatrix.php                       30-Sep-2022 11:00               26039
imagickkernel.getmatrix.php                        30-Sep-2022 11:00                8204
imagickkernel.scale.php                            30-Sep-2022 11:00               15161
imagickkernel.separate.php                         30-Sep-2022 11:00               11729
imagickpixel.clear.php                             30-Sep-2022 11:00                2234
imagickpixel.construct.php                         30-Sep-2022 11:00               13813
imagickpixel.destroy.php                           30-Sep-2022 11:00                2323
imagickpixel.getcolor.php                          30-Sep-2022 11:00                7630
imagickpixel.getcolorasstring.php                  30-Sep-2022 11:00                4810
imagickpixel.getcolorcount.php                     30-Sep-2022 11:00                4977
imagickpixel.getcolorquantum.php                   30-Sep-2022 11:00                2739
imagickpixel.getcolorvalue.php                     30-Sep-2022 11:00                8701
imagickpixel.getcolorvaluequantum.php              30-Sep-2022 11:00                6543
imagickpixel.gethsl.php                            30-Sep-2022 11:00                4275
imagickpixel.getindex.php                          30-Sep-2022 11:00                2151
imagickpixel.ispixelsimilar.php                    30-Sep-2022 11:00                3431
imagickpixel.ispixelsimilarquantum.php             30-Sep-2022 11:00                2967
imagickpixel.issimilar.php                         30-Sep-2022 11:00               22799
imagickpixel.setcolor.php                          30-Sep-2022 11:00                7649
imagickpixel.setcolorcount.php                     30-Sep-2022 11:00                2443
imagickpixel.setcolorvalue.php                     30-Sep-2022 11:00                4919
imagickpixel.setcolorvaluequantum.php              30-Sep-2022 11:00                8506
imagickpixel.sethsl.php                            30-Sep-2022 11:00                7463
imagickpixel.setindex.php                          30-Sep-2022 11:00                2378
imagickpixeliterator.clear.php                     30-Sep-2022 11:00                7178
imagickpixeliterator.construct.php                 30-Sep-2022 11:00                6895
imagickpixeliterator.destroy.php                   30-Sep-2022 11:00                2364
imagickpixeliterator.getcurrentiteratorrow.php     30-Sep-2022 11:00                2523
imagickpixeliterator.getiteratorrow.php            30-Sep-2022 11:00                2448
imagickpixeliterator.getnextiteratorrow.php        30-Sep-2022 11:00                7986
imagickpixeliterator.getpreviousiteratorrow.php    30-Sep-2022 11:00                2592
imagickpixeliterator.newpixeliterator.php          30-Sep-2022 11:00                2617
imagickpixeliterator.newpixelregioniterator.php    30-Sep-2022 11:00                3973
imagickpixeliterator.resetiterator.php             30-Sep-2022 11:00               10471
imagickpixeliterator.setiteratorfirstrow.php       30-Sep-2022 11:00                2458
imagickpixeliterator.setiteratorlastrow.php        30-Sep-2022 11:00                2451
imagickpixeliterator.setiteratorrow.php            30-Sep-2022 11:00                7855
imagickpixeliterator.synciterator.php              30-Sep-2022 11:00                2306
imap.configuration.php                             30-Sep-2022 11:00                3114
imap.constants.php                                 30-Sep-2022 11:00               17479
imap.installation.php                              30-Sep-2022 11:00                2599
imap.requirements.php                              30-Sep-2022 11:00                2990
imap.resources.php                                 30-Sep-2022 11:00                1351
imap.setup.php                                     30-Sep-2022 11:00                1535
index.php                                          30-Sep-2022 11:01               12109
indexes.examples.php                               30-Sep-2022 11:01              695940
indexes.functions.php                              30-Sep-2022 11:01             1125436
indexes.php                                        30-Sep-2022 11:01                1400
infiniteiterator.construct.php                     30-Sep-2022 11:01                5120
infiniteiterator.next.php                          30-Sep-2022 11:01                3236
info.configuration.php                             30-Sep-2022 11:00               18284
info.constants.php                                 30-Sep-2022 11:00               15527
info.installation.php                              30-Sep-2022 11:00                1182
info.requirements.php                              30-Sep-2022 11:00                1146
info.resources.php                                 30-Sep-2022 11:00                1144
info.setup.php                                     30-Sep-2022 11:00                1523
ini.core.php                                       30-Sep-2022 11:01               67580
ini.list.php                                       30-Sep-2022 11:01               88560
ini.php                                            30-Sep-2022 11:01                1518
ini.sections.php                                   30-Sep-2022 11:01                3970
inotify.configuration.php                          30-Sep-2022 11:00                1225
inotify.constants.php                              30-Sep-2022 11:00                7771
inotify.install.php                                30-Sep-2022 11:00                1704
inotify.requirements.php                           30-Sep-2022 11:00                1187
inotify.resources.php                              30-Sep-2022 11:00                1285
inotify.setup.php                                  30-Sep-2022 11:00                1566
install.cloud.azure.php                            30-Sep-2022 11:00                3913
install.cloud.ec2.php                              30-Sep-2022 11:00                1384
install.cloud.php                                  30-Sep-2022 11:00                1576
install.fpm.configuration.php                      30-Sep-2022 11:00               33333
install.fpm.install.php                            30-Sep-2022 11:00                3275
install.fpm.php                                    30-Sep-2022 11:00                3561
install.general.php                                30-Sep-2022 11:00                4322
install.macosx.bundled.php                         30-Sep-2022 11:00               10047
install.macosx.compile.php                         30-Sep-2022 11:00                1290
install.macosx.packages.php                        30-Sep-2022 11:00                2951
install.macosx.php                                 30-Sep-2022 11:00                1867
install.pecl.downloads.php                         30-Sep-2022 11:00                3510
install.pecl.intro.php                             30-Sep-2022 11:00                3016
install.pecl.pear.php                              30-Sep-2022 11:00                2891
install.pecl.php                                   30-Sep-2022 11:00                1941
install.pecl.php-config.php                        30-Sep-2022 11:00                3761
install.pecl.phpize.php                            30-Sep-2022 11:00                2971
install.pecl.static.php                            30-Sep-2022 11:00                3032
install.pecl.windows.php                           30-Sep-2022 11:00                8997
install.php                                        30-Sep-2022 11:00                5400
install.problems.bugs.php                          30-Sep-2022 11:00                1832
install.problems.faq.php                           30-Sep-2022 11:00                1266
install.problems.php                               30-Sep-2022 11:00                1516
install.problems.support.php                       30-Sep-2022 11:00                2253
install.unix.apache2.php                           30-Sep-2022 11:00               12604
install.unix.commandline.php                       30-Sep-2022 11:00                3713
install.unix.debian.php                            30-Sep-2022 11:00                6683
install.unix.lighttpd-14.php                       30-Sep-2022 11:00                5905
install.unix.litespeed.php                         30-Sep-2022 11:00                8938
install.unix.nginx.php                             30-Sep-2022 11:00                8308
install.unix.openbsd.php                           30-Sep-2022 11:00                5463
install.unix.php                                   30-Sep-2022 11:00                6953
install.unix.solaris.php                           30-Sep-2022 11:00                3731
install.windows.apache2.php                        30-Sep-2022 11:00                6818
install.windows.building.php                       30-Sep-2022 11:00                1635
install.windows.commandline.php                    30-Sep-2022 11:00                8143
install.windows.manual.php                         30-Sep-2022 11:00                5190
install.windows.pecl.php                           30-Sep-2022 11:00                1532
install.windows.php                                30-Sep-2022 11:00                3060
install.windows.recommended.php                    30-Sep-2022 11:00                4564
install.windows.requirements.php                   30-Sep-2022 11:00                2178
install.windows.tools.php                          30-Sep-2022 11:00                1743
install.windows.troubleshooting.php                30-Sep-2022 11:00                1650
internaliterator.construct.php                     30-Sep-2022 11:00                1937
internaliterator.current.php                       30-Sep-2022 11:00                2283
internaliterator.key.php                           30-Sep-2022 11:00                2272
internaliterator.next.php                          30-Sep-2022 11:00                2190
internaliterator.rewind.php                        30-Sep-2022 11:00                2225
internaliterator.valid.php                         30-Sep-2022 11:00                2172
intl.configuration.php                             30-Sep-2022 11:00                4984
intl.constants.php                                 30-Sep-2022 11:00                7286
intl.examples.basic.php                            30-Sep-2022 11:00                4430
intl.examples.php                                  30-Sep-2022 11:00                1351
intl.installation.php                              30-Sep-2022 11:00                2350
intl.requirements.php                              30-Sep-2022 11:00                1544
intl.resources.php                                 30-Sep-2022 11:00                1144
intl.setup.php                                     30-Sep-2022 11:00                1534
intlbreakiterator.construct.php                    30-Sep-2022 11:00                2391
intlbreakiterator.createcharacterinstance.php      30-Sep-2022 11:00                3104
intlbreakiterator.createcodepointinstance.php      30-Sep-2022 11:00                2734
intlbreakiterator.createlineinstance.php           30-Sep-2022 11:00                3065
intlbreakiterator.createsentenceinstance.php       30-Sep-2022 11:00                3067
intlbreakiterator.createtitleinstance.php          30-Sep-2022 11:00                3047
intlbreakiterator.createwordinstance.php           30-Sep-2022 11:00                3001
intlbreakiterator.current.php                      30-Sep-2022 11:00                2365
intlbreakiterator.first.php                        30-Sep-2022 11:00                2349
intlbreakiterator.following.php                    30-Sep-2022 11:00                2603
intlbreakiterator.geterrorcode.php                 30-Sep-2022 11:00                2834
intlbreakiterator.geterrormessage.php              30-Sep-2022 11:00                2969
intlbreakiterator.getlocale.php                    30-Sep-2022 11:00                2595
intlbreakiterator.getpartsiterator.php             30-Sep-2022 11:00                3397
intlbreakiterator.gettext.php                      30-Sep-2022 11:00                2424
intlbreakiterator.isboundary.php                   30-Sep-2022 11:00                2572
intlbreakiterator.last.php                         30-Sep-2022 11:00                2348
intlbreakiterator.next.php                         30-Sep-2022 11:00                2656
intlbreakiterator.preceding.php                    30-Sep-2022 11:00                2581
intlbreakiterator.previous.php                     30-Sep-2022 11:00                2404
intlbreakiterator.settext.php                      30-Sep-2022 11:00                2589
intlcalendar.add.php                               30-Sep-2022 11:00                8334
intlcalendar.after.php                             30-Sep-2022 11:00                6666
intlcalendar.before.php                            30-Sep-2022 11:00                3906
intlcalendar.clear.php                             30-Sep-2022 11:00               20691
intlcalendar.construct.php                         30-Sep-2022 11:00                2295
intlcalendar.createinstance.php                    30-Sep-2022 11:00               12828
intlcalendar.equals.php                            30-Sep-2022 11:00               10906
intlcalendar.fielddifference.php                   30-Sep-2022 11:00               11274
intlcalendar.fromdatetime.php                      30-Sep-2022 11:00                7428
intlcalendar.get.php                               30-Sep-2022 11:00                8837
intlcalendar.getactualmaximum.php                  30-Sep-2022 11:00                8379
intlcalendar.getactualminimum.php                  30-Sep-2022 11:00                5548
intlcalendar.getavailablelocales.php               30-Sep-2022 11:00                4155
intlcalendar.getdayofweektype.php                  30-Sep-2022 11:00                9790
intlcalendar.geterrorcode.php                      30-Sep-2022 11:00                9012
intlcalendar.geterrormessage.php                   30-Sep-2022 11:00                5930
intlcalendar.getfirstdayofweek.php                 30-Sep-2022 11:00                8442
intlcalendar.getgreatestminimum.php                30-Sep-2022 11:00                4390
intlcalendar.getkeywordvaluesforlocale.php         30-Sep-2022 11:00                7511
intlcalendar.getleastmaximum.php                   30-Sep-2022 11:00                8176
intlcalendar.getlocale.php                         30-Sep-2022 11:00                5892
intlcalendar.getmaximum.php                        30-Sep-2022 11:00                5081
intlcalendar.getminimaldaysinfirstweek.php         30-Sep-2022 11:00                8986
intlcalendar.getminimum.php                        30-Sep-2022 11:00                4334
intlcalendar.getnow.php                            30-Sep-2022 11:00                5292
intlcalendar.getrepeatedwalltimeoption.php         30-Sep-2022 11:00               10282
intlcalendar.getskippedwalltimeoption.php          30-Sep-2022 11:00               12691
intlcalendar.gettime.php                           30-Sep-2022 11:00                6407
intlcalendar.gettimezone.php                       30-Sep-2022 11:00                7509
intlcalendar.gettype.php                           30-Sep-2022 11:00                5571
intlcalendar.getweekendtransition.php              30-Sep-2022 11:00                4674
intlcalendar.indaylighttime.php                    30-Sep-2022 11:00                8726
intlcalendar.isequivalentto.php                    30-Sep-2022 11:00                8467
intlcalendar.islenient.php                         30-Sep-2022 11:00                8305
intlcalendar.isset.php                             30-Sep-2022 11:00                4580
intlcalendar.isweekend.php                         30-Sep-2022 11:00                8659
intlcalendar.roll.php                              30-Sep-2022 11:00                9002
intlcalendar.set.php                               30-Sep-2022 11:00               14044
intlcalendar.setfirstdayofweek.php                 30-Sep-2022 11:00                7855
intlcalendar.setlenient.php                        30-Sep-2022 11:00                4053
intlcalendar.setminimaldaysinfirstweek.php         30-Sep-2022 11:00                4055
intlcalendar.setrepeatedwalltimeoption.php         30-Sep-2022 11:00                5353
intlcalendar.setskippedwalltimeoption.php          30-Sep-2022 11:00                6062
intlcalendar.settime.php                           30-Sep-2022 11:00                8558
intlcalendar.settimezone.php                       30-Sep-2022 11:00               10840
intlcalendar.todatetime.php                        30-Sep-2022 11:00                7132
intlchar.charage.php                               30-Sep-2022 11:00                5463
intlchar.chardigitvalue.php                        30-Sep-2022 11:00                5135
intlchar.chardirection.php                         30-Sep-2022 11:00                8580
intlchar.charfromname.php                          30-Sep-2022 11:00                6669
intlchar.charmirror.php                            30-Sep-2022 11:00                5912
intlchar.charname.php                              30-Sep-2022 11:00                6928
intlchar.chartype.php                              30-Sep-2022 11:00                9121
intlchar.chr.php                                   30-Sep-2022 11:00                5318
intlchar.digit.php                                 30-Sep-2022 11:00                7813
intlchar.enumcharnames.php                         30-Sep-2022 11:00                7638
intlchar.enumchartypes.php                         30-Sep-2022 11:00                5716
intlchar.foldcase.php                              30-Sep-2022 11:00                3428
intlchar.fordigit.php                              30-Sep-2022 11:00                6822
intlchar.getbidipairedbracket.php                  30-Sep-2022 11:00                5510
intlchar.getblockcode.php                          30-Sep-2022 11:00                5213
intlchar.getcombiningclass.php                     30-Sep-2022 11:00                4527
intlchar.getfc-nfkc-closure.php                    30-Sep-2022 11:00                4468
intlchar.getintpropertymaxvalue.php                30-Sep-2022 11:00                6297
intlchar.getintpropertyminvalue.php                30-Sep-2022 11:00                6290
intlchar.getintpropertyvalue.php                   30-Sep-2022 11:00                7601
intlchar.getnumericvalue.php                       30-Sep-2022 11:00                5037
intlchar.getpropertyenum.php                       30-Sep-2022 11:00                6470
intlchar.getpropertyname.php                       30-Sep-2022 11:00                8138
intlchar.getpropertyvalueenum.php                  30-Sep-2022 11:00                7802
intlchar.getpropertyvaluename.php                  30-Sep-2022 11:00                9880
intlchar.getunicodeversion.php                     30-Sep-2022 11:00                3868
intlchar.hasbinaryproperty.php                     30-Sep-2022 11:00                8464
intlchar.isalnum.php                               30-Sep-2022 11:00                5257
intlchar.isalpha.php                               30-Sep-2022 11:00                5145
intlchar.isbase.php                                30-Sep-2022 11:00                5622
intlchar.isblank.php                               30-Sep-2022 11:00                6334
intlchar.iscntrl.php                               30-Sep-2022 11:00                5934
intlchar.isdefined.php                             30-Sep-2022 11:00                6364
intlchar.isdigit.php                               30-Sep-2022 11:00                5483
intlchar.isgraph.php                               30-Sep-2022 11:00                5177
intlchar.isidignorable.php                         30-Sep-2022 11:00                5761
intlchar.isidpart.php                              30-Sep-2022 11:00                6341
intlchar.isidstart.php                             30-Sep-2022 11:00                5848
intlchar.isisocontrol.php                          30-Sep-2022 11:00                5100
intlchar.isjavaidpart.php                          30-Sep-2022 11:00                6440
intlchar.isjavaidstart.php                         30-Sep-2022 11:00                6140
intlchar.isjavaspacechar.php                       30-Sep-2022 11:00                6378
intlchar.islower.php                               30-Sep-2022 11:00                6644
intlchar.ismirrored.php                            30-Sep-2022 11:00                5210
intlchar.isprint.php                               30-Sep-2022 11:00                5454
intlchar.ispunct.php                               30-Sep-2022 11:00                4924
intlchar.isspace.php                               30-Sep-2022 11:00                6021
intlchar.istitle.php                               30-Sep-2022 11:00                6082
intlchar.isualphabetic.php                         30-Sep-2022 11:00                5441
intlchar.isulowercase.php                          30-Sep-2022 11:00                6421
intlchar.isupper.php                               30-Sep-2022 11:00                6642
intlchar.isuuppercase.php                          30-Sep-2022 11:00                6459
intlchar.isuwhitespace.php                         30-Sep-2022 11:00                6965
intlchar.iswhitespace.php                          30-Sep-2022 11:00                7093
intlchar.isxdigit.php                              30-Sep-2022 11:00                6524
intlchar.ord.php                                   30-Sep-2022 11:00                5155
intlchar.tolower.php                               30-Sep-2022 11:00                7088
intlchar.totitle.php                               30-Sep-2022 11:00                7109
intlchar.toupper.php                               30-Sep-2022 11:00                7031
intlcodepointbreakiterator.getlastcodepoint.php    30-Sep-2022 11:00                2607
intldateformatter.create.php                       30-Sep-2022 11:00               27113
intldateformatter.format.php                       30-Sep-2022 11:00               27572
intldateformatter.formatobject.php                 30-Sep-2022 11:00               13949
intldateformatter.getcalendar.php                  30-Sep-2022 11:00                9424
intldateformatter.getcalendarobject.php            30-Sep-2022 11:00                7555
intldateformatter.getdatetype.php                  30-Sep-2022 11:00               12177
intldateformatter.geterrorcode.php                 30-Sep-2022 11:00                9221
intldateformatter.geterrormessage.php              30-Sep-2022 11:00                9129
intldateformatter.getlocale.php                    30-Sep-2022 11:00               12443
intldateformatter.getpattern.php                   30-Sep-2022 11:00               10733
intldateformatter.gettimetype.php                  30-Sep-2022 11:00               12171
intldateformatter.gettimezone.php                  30-Sep-2022 11:00                8701
intldateformatter.gettimezoneid.php                30-Sep-2022 11:00                9065
intldateformatter.islenient.php                    30-Sep-2022 11:00               15854
intldateformatter.localtime.php                    30-Sep-2022 11:00               11689
intldateformatter.parse.php                        30-Sep-2022 11:00               12443
intldateformatter.setcalendar.php                  30-Sep-2022 11:00               14491
intldateformatter.setlenient.php                   30-Sep-2022 11:00               16596
intldateformatter.setpattern.php                   30-Sep-2022 11:00               11809
intldateformatter.settimezone.php                  30-Sep-2022 11:00               11520
intldatepatterngenerator.create.php                30-Sep-2022 11:00                3767
intldatepatterngenerator.getbestpattern.php        30-Sep-2022 11:00                6790
intlgregoriancalendar.construct.php                30-Sep-2022 11:00                5072
intlgregoriancalendar.getgregorianchange.php       30-Sep-2022 11:00                2571
intlgregoriancalendar.isleapyear.php               30-Sep-2022 11:00                2801
intlgregoriancalendar.setgregorianchange.php       30-Sep-2022 11:00                2810
intliterator.current.php                           30-Sep-2022 11:00                2338
intliterator.key.php                               30-Sep-2022 11:00                2307
intliterator.next.php                              30-Sep-2022 11:00                2257
intliterator.rewind.php                            30-Sep-2022 11:00                2285
intliterator.valid.php                             30-Sep-2022 11:00                2227
intlpartsiterator.getbreakiterator.php             30-Sep-2022 11:00                2508
intlrulebasedbreakiterator.construct.php           30-Sep-2022 11:00                2988
intlrulebasedbreakiterator.getbinaryrules.php      30-Sep-2022 11:00                2679
intlrulebasedbreakiterator.getrules.php            30-Sep-2022 11:00                2643
intlrulebasedbreakiterator.getrulestatus.php       30-Sep-2022 11:00                2643
intlrulebasedbreakiterator.getrulestatusvec.php    30-Sep-2022 11:00                2739
intltimezone.construct.php                         30-Sep-2022 11:00                1936
intltimezone.countequivalentids.php                30-Sep-2022 11:00                3353
intltimezone.createdefault.php                     30-Sep-2022 11:00                2957
intltimezone.createenumeration.php                 30-Sep-2022 11:00                4109
intltimezone.createtimezone.php                    30-Sep-2022 11:00                3385
intltimezone.createtimezoneidenumeration.php       30-Sep-2022 11:00                5019
intltimezone.fromdatetimezone.php                  30-Sep-2022 11:00                3626
intltimezone.getcanonicalid.php                    30-Sep-2022 11:00                3856
intltimezone.getdisplayname.php                    30-Sep-2022 11:00                4761
intltimezone.getdstsavings.php                     30-Sep-2022 11:00                2973
intltimezone.getequivalentid.php                   30-Sep-2022 11:00                3643
intltimezone.geterrorcode.php                      30-Sep-2022 11:00                3093
intltimezone.geterrormessage.php                   30-Sep-2022 11:00                3117
intltimezone.getgmt.php                            30-Sep-2022 11:00                2806
intltimezone.getid.php                             30-Sep-2022 11:00                2969
intltimezone.getidforwindowsid.php                 30-Sep-2022 11:00                5180
intltimezone.getoffset.php                         30-Sep-2022 11:00                4493
intltimezone.getrawoffset.php                      30-Sep-2022 11:00                2924
intltimezone.getregion.php                         30-Sep-2022 11:00                3288
intltimezone.gettzdataversion.php                  30-Sep-2022 11:00                3008
intltimezone.getunknown.php                        30-Sep-2022 11:00                3021
intltimezone.getwindowsid.php                      30-Sep-2022 11:00                4040
intltimezone.hassamerules.php                      30-Sep-2022 11:00                3361
intltimezone.todatetimezone.php                    30-Sep-2022 11:00                3338
intltimezone.usedaylighttime.php                   30-Sep-2022 11:00                2948
intro-whatcando.php                                30-Sep-2022 11:00                7453
intro-whatis.php                                   30-Sep-2022 11:00                4252
intro.apache.php                                   30-Sep-2022 11:01                1135
intro.apcu.php                                     30-Sep-2022 11:00                1536
intro.array.php                                    30-Sep-2022 11:01                1841
intro.bc.php                                       30-Sep-2022 11:00                4366
intro.bzip2.php                                    30-Sep-2022 11:00                1148
intro.calendar.php                                 30-Sep-2022 11:00                1999
intro.classobj.php                                 30-Sep-2022 11:01                1681
intro.cmark.php                                    30-Sep-2022 11:01                6340
intro.com.php                                      30-Sep-2022 11:01                3042
intro.componere.php                                30-Sep-2022 11:00                6103
intro.csprng.php                                   30-Sep-2022 11:00                1620
intro.ctype.php                                    30-Sep-2022 11:01                3568
intro.cubrid.php                                   30-Sep-2022 11:00                1430
intro.curl.php                                     30-Sep-2022 11:01                1548
intro.datetime.php                                 30-Sep-2022 11:00                2085
intro.dba.php                                      30-Sep-2022 11:00                1450
intro.dbase.php                                    30-Sep-2022 11:00                6193
intro.dio.php                                      30-Sep-2022 11:00                1649
intro.dom.php                                      30-Sep-2022 11:01                1621
intro.ds.php                                       30-Sep-2022 11:01                1352
intro.eio.php                                      30-Sep-2022 11:00               15549
intro.enchant.php                                  30-Sep-2022 11:00                2563
intro.errorfunc.php                                30-Sep-2022 11:00                1845
intro.ev.php                                       30-Sep-2022 11:00                2240
intro.event.php                                    30-Sep-2022 11:01                1930
intro.exec.php                                     30-Sep-2022 11:01                1682
intro.exif.php                                     30-Sep-2022 11:00                1425
intro.expect.php                                   30-Sep-2022 11:00                1384
intro.fann.php                                     30-Sep-2022 11:01                1373
intro.fdf.php                                      30-Sep-2022 11:00                3779
intro.ffi.php                                      30-Sep-2022 11:00                2799
intro.fileinfo.php                                 30-Sep-2022 11:00                1366
intro.filesystem.php                               30-Sep-2022 11:00                1394
intro.filter.php                                   30-Sep-2022 11:01                2622
intro.fpm.php                                      30-Sep-2022 11:01                1264
intro.ftp.php                                      30-Sep-2022 11:01                1728
intro.funchand.php                                 30-Sep-2022 11:01                1183
intro.gearman.php                                  30-Sep-2022 11:01                1614
intro.gender.php                                   30-Sep-2022 11:00                1282
intro.geoip.php                                    30-Sep-2022 11:01                1522
intro.gettext.php                                  30-Sep-2022 11:00                1497
intro.gmagick.php                                  30-Sep-2022 11:00                1644
intro.gmp.php                                      30-Sep-2022 11:00                2950
intro.gnupg.php                                    30-Sep-2022 11:00                1171
intro.hash.php                                     30-Sep-2022 11:00                1186
intro.hrtime.php                                   30-Sep-2022 11:00                1615
intro.ibase.php                                    30-Sep-2022 11:00                3163
intro.ibm-db2.php                                  30-Sep-2022 11:00                1231
intro.iconv.php                                    30-Sep-2022 11:00                1907
intro.igbinary.php                                 30-Sep-2022 11:01                1626
intro.image.php                                    30-Sep-2022 11:00                6105
intro.imagick.php                                  30-Sep-2022 11:00                1663
intro.imap.php                                     30-Sep-2022 11:00                1640
intro.info.php                                     30-Sep-2022 11:00                1446
intro.inotify.php                                  30-Sep-2022 11:00                2293
intro.intl.php                                     30-Sep-2022 11:00                4969
intro.json.php                                     30-Sep-2022 11:01                1586
intro.ldap.php                                     30-Sep-2022 11:01                4032
intro.libxml.php                                   30-Sep-2022 11:01                1722
intro.lua.php                                      30-Sep-2022 11:01                1219
intro.luasandbox.php                               30-Sep-2022 11:01                2316
intro.lzf.php                                      30-Sep-2022 11:00                1372
intro.mail.php                                     30-Sep-2022 11:00                1168
intro.mailparse.php                                30-Sep-2022 11:00                1888
intro.math.php                                     30-Sep-2022 11:00                1884
intro.mbstring.php                                 30-Sep-2022 11:00                2724
intro.mcrypt.php                                   30-Sep-2022 11:00                2252
intro.memcache.php                                 30-Sep-2022 11:01                1635
intro.memcached.php                                30-Sep-2022 11:01                1828
intro.mhash.php                                    30-Sep-2022 11:00                2734
intro.misc.php                                     30-Sep-2022 11:01                1134
intro.mqseries.php                                 30-Sep-2022 11:01                1695
intro.mysql-xdevapi.php                            30-Sep-2022 11:00                1831
intro.mysql.php                                    30-Sep-2022 11:00                1862
intro.mysqli.php                                   30-Sep-2022 11:00                2119
intro.mysqlnd.php                                  30-Sep-2022 11:00                1897
intro.network.php                                  30-Sep-2022 11:01                1110
intro.oauth.php                                    30-Sep-2022 11:01                1285
intro.oci8.php                                     30-Sep-2022 11:00                1427
intro.opcache.php                                  30-Sep-2022 11:00                1481
intro.openal.php                                   30-Sep-2022 11:00                1204
intro.openssl.php                                  30-Sep-2022 11:00                1531
intro.outcontrol.php                               30-Sep-2022 11:00                1761
intro.parallel.php                                 30-Sep-2022 11:01                6811
intro.parle.php                                    30-Sep-2022 11:01                3390
intro.password.php                                 30-Sep-2022 11:00                1368
intro.pcntl.php                                    30-Sep-2022 11:00                2565
intro.pcre.php                                     30-Sep-2022 11:01                2614
intro.pdo.php                                      30-Sep-2022 11:00                2056
intro.pgsql.php                                    30-Sep-2022 11:00                1529
intro.phar.php                                     30-Sep-2022 11:00               10068
intro.phpdbg.php                                   30-Sep-2022 11:00                5992
intro.posix.php                                    30-Sep-2022 11:00                1672
intro.ps.php                                       30-Sep-2022 11:00                1713
intro.pspell.php                                   30-Sep-2022 11:00                1146
intro.pthreads.php                                 30-Sep-2022 11:01                9082
intro.quickhash.php                                30-Sep-2022 11:01                1218
intro.radius.php                                   30-Sep-2022 11:00                2116
intro.rar.php                                      30-Sep-2022 11:00                1492
intro.readline.php                                 30-Sep-2022 11:00                1914
intro.recode.php                                   30-Sep-2022 11:00                2213
intro.reflection.php                               30-Sep-2022 11:01                1726
intro.rpminfo.php                                  30-Sep-2022 11:00                1177
intro.rrd.php                                      30-Sep-2022 11:01                1387
intro.runkit7.php                                  30-Sep-2022 11:00                1430
intro.scoutapm.php                                 30-Sep-2022 11:01                1416
intro.seaslog.php                                  30-Sep-2022 11:01                4124
intro.sem.php                                      30-Sep-2022 11:01                3174
intro.session.php                                  30-Sep-2022 11:01                4722
intro.shmop.php                                    30-Sep-2022 11:01                1192
intro.simplexml.php                                30-Sep-2022 11:01                1270
intro.snmp.php                                     30-Sep-2022 11:01                1610
intro.soap.php                                     30-Sep-2022 11:01                1415
intro.sockets.php                                  30-Sep-2022 11:01                2539
intro.sodium.php                                   30-Sep-2022 11:00                1281
intro.solr.php                                     30-Sep-2022 11:01                1736
intro.spl.php                                      30-Sep-2022 11:01                1526
intro.sqlite3.php                                  30-Sep-2022 11:00                1111
intro.sqlsrv.php                                   30-Sep-2022 11:00                2117
intro.ssdeep.php                                   30-Sep-2022 11:01                1710
intro.ssh2.php                                     30-Sep-2022 11:01                1292
intro.stats.php                                    30-Sep-2022 11:00                1462
intro.stomp.php                                    30-Sep-2022 11:01                1295
intro.stream.php                                   30-Sep-2022 11:01                3827
intro.strings.php                                  30-Sep-2022 11:01                1594
intro.svm.php                                      30-Sep-2022 11:01                1193
intro.svn.php                                      30-Sep-2022 11:01                1754
intro.swoole.php                                   30-Sep-2022 11:01                1595
intro.sync.php                                     30-Sep-2022 11:01                2303
intro.taint.php                                    30-Sep-2022 11:01                4487
intro.tcpwrap.php                                  30-Sep-2022 11:01                1224
intro.tidy.php                                     30-Sep-2022 11:01                1360
intro.tokenizer.php                                30-Sep-2022 11:01                1464
intro.trader.php                                   30-Sep-2022 11:00                2339
intro.ui.php                                       30-Sep-2022 11:01                1162
intro.uodbc.php                                    30-Sep-2022 11:00                2707
intro.uopz.php                                     30-Sep-2022 11:00                2353
intro.url.php                                      30-Sep-2022 11:01                1095
intro.v8js.php                                     30-Sep-2022 11:01                1179
intro.var.php                                      30-Sep-2022 11:01                1273
intro.var_representation.php                       30-Sep-2022 11:01                1380
intro.varnish.php                                  30-Sep-2022 11:01                1269
intro.wddx.php                                     30-Sep-2022 11:01                2132
intro.win32service.php                             30-Sep-2022 11:01                1352
intro.wincache.php                                 30-Sep-2022 11:00                4926
intro.wkhtmltox.php                                30-Sep-2022 11:00                1228
intro.xattr.php                                    30-Sep-2022 11:00                1141
intro.xdiff.php                                    30-Sep-2022 11:00                2563
intro.xhprof.php                                   30-Sep-2022 11:00                2745
intro.xlswriter.php                                30-Sep-2022 11:00                1141
intro.xml.php                                      30-Sep-2022 11:01                2222
intro.xmldiff.php                                  30-Sep-2022 11:01                1362
intro.xmlreader.php                                30-Sep-2022 11:01                1541
intro.xmlrpc.php                                   30-Sep-2022 11:01                1836
intro.xmlwriter.php                                30-Sep-2022 11:01                1500
intro.xsl.php                                      30-Sep-2022 11:01                1289
intro.yac.php                                      30-Sep-2022 11:00                1153
intro.yaconf.php                                   30-Sep-2022 11:01                2523
intro.yaf.php                                      30-Sep-2022 11:01                1501
intro.yaml.php                                     30-Sep-2022 11:01                1357
intro.yar.php                                      30-Sep-2022 11:01                1222
intro.yaz.php                                      30-Sep-2022 11:01                2479
intro.zip.php                                      30-Sep-2022 11:00                1147
intro.zlib.php                                     30-Sep-2022 11:00                1645
intro.zmq.php                                      30-Sep-2022 11:01                1338
intro.zookeeper.php                                30-Sep-2022 11:01                1399
introduction.php                                   30-Sep-2022 11:00                1408
iterator.current.php                               30-Sep-2022 11:00                2141
iterator.key.php                                   30-Sep-2022 11:00                2452
iterator.next.php                                  30-Sep-2022 11:00                2336
iterator.rewind.php                                30-Sep-2022 11:00                2545
iterator.valid.php                                 30-Sep-2022 11:00                2483
iteratoraggregate.getiterator.php                  30-Sep-2022 11:00                2791
iteratoriterator.construct.php                     30-Sep-2022 11:01                2936
iteratoriterator.current.php                       30-Sep-2022 11:01                2726
iteratoriterator.getinneriterator.php              30-Sep-2022 11:01                3040
iteratoriterator.key.php                           30-Sep-2022 11:01                2674
iteratoriterator.next.php                          30-Sep-2022 11:01                2773
iteratoriterator.rewind.php                        30-Sep-2022 11:01                2792
iteratoriterator.valid.php                         30-Sep-2022 11:01                2831
json.configuration.php                             30-Sep-2022 11:01                1199
json.constants.php                                 30-Sep-2022 11:01               12363
json.installation.php                              30-Sep-2022 11:01                1734
json.requirements.php                              30-Sep-2022 11:01                1175
json.resources.php                                 30-Sep-2022 11:01                1144
json.setup.php                                     30-Sep-2022 11:01                1506
jsonserializable.jsonserialize.php                 30-Sep-2022 11:01               12815
langref.php                                        30-Sep-2022 11:00               18370
language.attributes.classes.php                    30-Sep-2022 11:00                5493
language.attributes.overview.php                   30-Sep-2022 11:00               11503
language.attributes.php                            30-Sep-2022 11:00                1681
language.attributes.reflection.php                 30-Sep-2022 11:00                8613
language.attributes.syntax.php                     30-Sep-2022 11:00                5074
language.basic-syntax.comments.php                 30-Sep-2022 11:00                4288
language.basic-syntax.instruction-separation.php   30-Sep-2022 11:00                4259
language.basic-syntax.php                          30-Sep-2022 11:00                1607
language.basic-syntax.phpmode.php                  30-Sep-2022 11:00                4728
language.basic-syntax.phptags.php                  30-Sep-2022 11:00                5214
language.constants.magic.php                       30-Sep-2022 11:00                4972
language.constants.php                             30-Sep-2022 11:00                6201
language.constants.predefined.php                  30-Sep-2022 11:00                1496
language.constants.syntax.php                      30-Sep-2022 11:00               10084
language.control-structures.php                    30-Sep-2022 11:00                2697
language.enumerations.backed.php                   30-Sep-2022 11:00               10168
language.enumerations.basics.php                   30-Sep-2022 11:00                7504
language.enumerations.constants.php                30-Sep-2022 11:00                2371
language.enumerations.examples.php                 30-Sep-2022 11:00                7796
language.enumerations.expressions.php              30-Sep-2022 11:00                5804
language.enumerations.listing.php                  30-Sep-2022 11:00                2184
language.enumerations.methods.php                  30-Sep-2022 11:00               15832
language.enumerations.object-differences.php       30-Sep-2022 11:00                4851
language.enumerations.overview.php                 30-Sep-2022 11:00                2176
language.enumerations.php                          30-Sep-2022 11:00                2323
language.enumerations.serialization.php            30-Sep-2022 11:00                4878
language.enumerations.static-methods.php           30-Sep-2022 11:00                3661
language.enumerations.traits.php                   30-Sep-2022 11:00                4953
language.errors.basics.php                         30-Sep-2022 11:00                4656
language.errors.php                                30-Sep-2022 11:00                1791
language.errors.php7.php                           30-Sep-2022 11:00                5694
language.exceptions.extending.php                  30-Sep-2022 11:00               24558
language.exceptions.php                            30-Sep-2022 11:00               30334
language.expressions.php                           30-Sep-2022 11:00               16579
language.fibers.php                                30-Sep-2022 11:00                6197
language.functions.php                             30-Sep-2022 11:00                1894
language.generators.comparison.php                 30-Sep-2022 11:00               10397
language.generators.overview.php                   30-Sep-2022 11:00               10196
language.generators.php                            30-Sep-2022 11:00                1539
language.generators.syntax.php                     30-Sep-2022 11:00               26636
language.namespaces.basics.php                     30-Sep-2022 11:00               12606
language.namespaces.definition.php                 30-Sep-2022 11:00                4323
language.namespaces.definitionmultiple.php         30-Sep-2022 11:00                9806
language.namespaces.dynamic.php                    30-Sep-2022 11:00                8740
language.namespaces.fallback.php                   30-Sep-2022 11:00                6621
language.namespaces.faq.php                        30-Sep-2022 11:00               34074
language.namespaces.global.php                     30-Sep-2022 11:00                3010
language.namespaces.importing.php                  30-Sep-2022 11:00               18648
language.namespaces.nested.php                     30-Sep-2022 11:00                2967
language.namespaces.nsconstants.php                30-Sep-2022 11:00                9795
language.namespaces.php                            30-Sep-2022 11:00                2386
language.namespaces.rationale.php                  30-Sep-2022 11:00                6855
language.namespaces.rules.php                      30-Sep-2022 11:00               15063
language.oop5.abstract.php                         30-Sep-2022 11:00               12284
language.oop5.anonymous.php                        30-Sep-2022 11:00               12032
language.oop5.autoload.php                         30-Sep-2022 11:00                6620
language.oop5.basic.php                            30-Sep-2022 11:00               48347
language.oop5.changelog.php                        30-Sep-2022 11:00               12650
language.oop5.cloning.php                          30-Sep-2022 11:00                9353
language.oop5.constants.php                        30-Sep-2022 11:00                9481
language.oop5.decon.php                            30-Sep-2022 11:00               29444
language.oop5.final.php                            30-Sep-2022 11:00                6791
language.oop5.inheritance.php                      30-Sep-2022 11:00               14057
language.oop5.interfaces.php                       30-Sep-2022 11:00               23319
language.oop5.iterations.php                       30-Sep-2022 11:00                6393
language.oop5.late-static-bindings.php             30-Sep-2022 11:00               16164
language.oop5.magic.php                            30-Sep-2022 11:00               44980
language.oop5.object-comparison.php                30-Sep-2022 11:00                9603
language.oop5.overloading.php                      30-Sep-2022 11:00               25851
language.oop5.paamayim-nekudotayim.php             30-Sep-2022 11:00                8819
language.oop5.php                                  30-Sep-2022 11:00                3194
language.oop5.properties.php                       30-Sep-2022 11:00               28356
language.oop5.references.php                       30-Sep-2022 11:00                6183
language.oop5.serialization.php                    30-Sep-2022 11:00                7523
language.oop5.static.php                           30-Sep-2022 11:00                9462
language.oop5.traits.php                           30-Sep-2022 11:00               34978
language.oop5.variance.php                         30-Sep-2022 11:00               17137
language.oop5.visibility.php                       30-Sep-2022 11:00               28389
language.operators.arithmetic.php                  30-Sep-2022 11:00                5982
language.operators.array.php                       30-Sep-2022 11:00                9167
language.operators.assignment.php                  30-Sep-2022 11:00               11896
language.operators.bitwise.php                     30-Sep-2022 11:00               46720
language.operators.comparison.php                  30-Sep-2022 11:00               42930
language.operators.errorcontrol.php                30-Sep-2022 11:00                6034
language.operators.execution.php                   30-Sep-2022 11:00                3340
language.operators.increment.php                   30-Sep-2022 11:00               11339
language.operators.logical.php                     30-Sep-2022 11:00                7763
language.operators.php                             30-Sep-2022 11:00                3838
language.operators.precedence.php                  30-Sep-2022 11:00               20625
language.operators.string.php                      30-Sep-2022 11:00                3248
language.operators.type.php                        30-Sep-2022 11:00               18952
language.references.arent.php                      30-Sep-2022 11:00                3149
language.references.pass.php                       30-Sep-2022 11:00                7049
language.references.php                            30-Sep-2022 11:00                1882
language.references.return.php                     30-Sep-2022 11:00                7378
language.references.spot.php                       30-Sep-2022 11:00                2416
language.references.unset.php                      30-Sep-2022 11:00                2263
language.references.whatare.php                    30-Sep-2022 11:00                1900
language.references.whatdo.php                     30-Sep-2022 11:00               19310
language.types.array.php                           30-Sep-2022 11:00              108495
language.types.boolean.php                         30-Sep-2022 11:00                9234
language.types.callable.php                        30-Sep-2022 11:00               12580
language.types.declarations.php                    30-Sep-2022 11:00               52809
language.types.enumerations.php                    30-Sep-2022 11:00                3566
language.types.float.php                           30-Sep-2022 11:00                8945
language.types.integer.php                         30-Sep-2022 11:00               19875
language.types.intro.php                           30-Sep-2022 11:00                7454
language.types.iterable.php                        30-Sep-2022 11:00                6653
language.types.null.php                            30-Sep-2022 11:00                3467
language.types.numeric-strings.php                 30-Sep-2022 11:00               10688
language.types.object.php                          30-Sep-2022 11:00                5433
language.types.php                                 30-Sep-2022 11:00                2299
language.types.resource.php                        30-Sep-2022 11:00                2766
language.types.string.php                          30-Sep-2022 11:00               81446
language.types.type-juggling.php                   30-Sep-2022 11:00               18142
language.variables.basics.php                      30-Sep-2022 11:00               14383
language.variables.external.php                    30-Sep-2022 11:00               17781
language.variables.php                             30-Sep-2022 11:00                1670
language.variables.predefined.php                  30-Sep-2022 11:00                2778
language.variables.scope.php                       30-Sep-2022 11:00               29691
language.variables.superglobals.php                30-Sep-2022 11:00                4363
language.variables.variable.php                    30-Sep-2022 11:00               10424
ldap.configuration.php                             30-Sep-2022 11:01                2271
ldap.constants.php                                 30-Sep-2022 11:01               24520
ldap.controls.php                                  30-Sep-2022 11:01                8678
ldap.examples-basic.php                            30-Sep-2022 11:01                9406
ldap.examples-controls.php                         30-Sep-2022 11:01               18985
ldap.examples.php                                  30-Sep-2022 11:01                1370
ldap.installation.php                              30-Sep-2022 11:01                2790
ldap.requirements.php                              30-Sep-2022 11:01                1476
ldap.resources.php                                 30-Sep-2022 11:01                1364
ldap.setup.php                                     30-Sep-2022 11:01                1533
ldap.using.php                                     30-Sep-2022 11:01                2175
libxml.configuration.php                           30-Sep-2022 11:01                1213
libxml.constants.php                               30-Sep-2022 11:01                9962
libxml.installation.php                            30-Sep-2022 11:01                2471
libxml.requirements.php                            30-Sep-2022 11:01                1229
libxml.resources.php                               30-Sep-2022 11:01                1158
libxml.setup.php                                   30-Sep-2022 11:01                1548
limititerator.construct.php                        30-Sep-2022 11:01                7270
limititerator.current.php                          30-Sep-2022 11:01                3578
limititerator.getinneriterator.php                 30-Sep-2022 11:01                3109
limititerator.getposition.php                      30-Sep-2022 11:01                5924
limititerator.key.php                              30-Sep-2022 11:01                3684
limititerator.next.php                             30-Sep-2022 11:01                3283
limititerator.rewind.php                           30-Sep-2022 11:01                3451
limititerator.seek.php                             30-Sep-2022 11:01                4035
limititerator.valid.php                            30-Sep-2022 11:01                3360
locale.acceptfromhttp.php                          30-Sep-2022 11:00                5810
locale.canonicalize.php                            30-Sep-2022 11:00                2841
locale.composelocale.php                           30-Sep-2022 11:00               13741
locale.filtermatches.php                           30-Sep-2022 11:00                8524
locale.getallvariants.php                          30-Sep-2022 11:00                6152
locale.getdefault.php                              30-Sep-2022 11:00                5744
locale.getdisplaylanguage.php                      30-Sep-2022 11:00                9286
locale.getdisplayname.php                          30-Sep-2022 11:00                9270
locale.getdisplayregion.php                        30-Sep-2022 11:00                9234
locale.getdisplayscript.php                        30-Sep-2022 11:00                9241
locale.getdisplayvariant.php                       30-Sep-2022 11:00                9282
locale.getkeywords.php                             30-Sep-2022 11:00                6973
locale.getprimarylanguage.php                      30-Sep-2022 11:00                5618
locale.getregion.php                               30-Sep-2022 11:00                5508
locale.getscript.php                               30-Sep-2022 11:00                5299
locale.lookup.php                                  30-Sep-2022 11:00                9219
locale.parselocale.php                             30-Sep-2022 11:00                7214
locale.setdefault.php                              30-Sep-2022 11:00                5050
lua.assign.php                                     30-Sep-2022 11:01                4510
lua.call.php                                       30-Sep-2022 11:01                7376
lua.configuration.php                              30-Sep-2022 11:01                1192
lua.construct.php                                  30-Sep-2022 11:01                2302
lua.eval.php                                       30-Sep-2022 11:01                3620
lua.getversion.php                                 30-Sep-2022 11:01                2168
lua.include.php                                    30-Sep-2022 11:01                2544
lua.installation.php                               30-Sep-2022 11:01                1945
lua.registercallback.php                           30-Sep-2022 11:01                4453
lua.requirements.php                               30-Sep-2022 11:01                1239
lua.resources.php                                  30-Sep-2022 11:01                1142
lua.setup.php                                      30-Sep-2022 11:01                1493
luaclosure.invoke.php                              30-Sep-2022 11:01                4200
luasandbox.callfunction.php                        30-Sep-2022 11:01                4873
luasandbox.configuration.php                       30-Sep-2022 11:01                1241
luasandbox.disableprofiler.php                     30-Sep-2022 11:01                2824
luasandbox.enableprofiler.php                      30-Sep-2022 11:01                3382
luasandbox.examples-basic.php                      30-Sep-2022 11:01                7405
luasandbox.examples.php                            30-Sep-2022 11:01                1430
luasandbox.getcpuusage.php                         30-Sep-2022 11:01                3559
luasandbox.getmemoryusage.php                      30-Sep-2022 11:01                3139
luasandbox.getpeakmemoryusage.php                  30-Sep-2022 11:01                3189
luasandbox.getprofilerfunctionreport.php           30-Sep-2022 11:01                5639
luasandbox.getversioninfo.php                      30-Sep-2022 11:01                2889
luasandbox.installation.php                        30-Sep-2022 11:01                2062
luasandbox.loadbinary.php                          30-Sep-2022 11:01                3497
luasandbox.loadstring.php                          30-Sep-2022 11:01                5607
luasandbox.pauseusagetimer.php                     30-Sep-2022 11:01               10261
luasandbox.registerlibrary.php                     30-Sep-2022 11:01                6867
luasandbox.requirements.php                        30-Sep-2022 11:01                1725
luasandbox.resources.php                           30-Sep-2022 11:01                1207
luasandbox.setcpulimit.php                         30-Sep-2022 11:01                5972
luasandbox.setmemorylimit.php                      30-Sep-2022 11:01                5627
luasandbox.setup.php                               30-Sep-2022 11:01                1584
luasandbox.unpauseusagetimer.php                   30-Sep-2022 11:01                3120
luasandbox.wrapphpfunction.php                     30-Sep-2022 11:01                4315
luasandboxfunction.call.php                        30-Sep-2022 11:01                6844
luasandboxfunction.construct.php                   30-Sep-2022 11:01                2648
luasandboxfunction.dump.php                        30-Sep-2022 11:01                2348
lzf.configuration.php                              30-Sep-2022 11:00                1192
lzf.constants.php                                  30-Sep-2022 11:00                1089
lzf.installation.php                               30-Sep-2022 11:00                2397
lzf.requirements.php                               30-Sep-2022 11:00                1139
lzf.resources.php                                  30-Sep-2022 11:00                1137
lzf.setup.php                                      30-Sep-2022 11:00                1514
mail.configuration.php                             30-Sep-2022 11:00                7193
mail.constants.php                                 30-Sep-2022 11:00                1098
mail.installation.php                              30-Sep-2022 11:00                1182
mail.requirements.php                              30-Sep-2022 11:00                1836
mail.resources.php                                 30-Sep-2022 11:00                1144
mail.setup.php                                     30-Sep-2022 11:00                1527
mailparse.configuration.php                        30-Sep-2022 11:00                2388
mailparse.constants.php                            30-Sep-2022 11:00                1937
mailparse.installation.php                         30-Sep-2022 11:00                2427
mailparse.requirements.php                         30-Sep-2022 11:00                1181
mailparse.resources.php                            30-Sep-2022 11:00                1507
mailparse.setup.php                                30-Sep-2022 11:00                1592
manual.php                                         30-Sep-2022 11:00                1222
math.configuration.php                             30-Sep-2022 11:00                1199
math.constants.php                                 30-Sep-2022 11:00                5954
math.installation.php                              30-Sep-2022 11:00                1182
math.requirements.php                              30-Sep-2022 11:00                1146
math.resources.php                                 30-Sep-2022 11:00                1144
math.setup.php                                     30-Sep-2022 11:00                1522
mbstring.configuration.php                         30-Sep-2022 11:00               14177
mbstring.constants.php                             30-Sep-2022 11:00                5347
mbstring.encodings.php                             30-Sep-2022 11:00               15375
mbstring.http.php                                  30-Sep-2022 11:00                5191
mbstring.installation.php                          30-Sep-2022 11:00                3286
mbstring.ja-basic.php                              30-Sep-2022 11:00                3656
mbstring.overload.php                              30-Sep-2022 11:00                7185
mbstring.php4.req.php                              30-Sep-2022 11:00                3958
mbstring.requirements.php                          30-Sep-2022 11:00                1174
mbstring.resources.php                             30-Sep-2022 11:00                1172
mbstring.setup.php                                 30-Sep-2022 11:00                1592
mbstring.supported-encodings.php                   30-Sep-2022 11:00                8147
mcrypt.ciphers.php                                 30-Sep-2022 11:00                6190
mcrypt.configuration.php                           30-Sep-2022 11:00                3383
mcrypt.constants.php                               30-Sep-2022 11:00                5820
mcrypt.installation.php                            30-Sep-2022 11:00                1738
mcrypt.requirements.php                            30-Sep-2022 11:00                2086
mcrypt.resources.php                               30-Sep-2022 11:00                1267
mcrypt.setup.php                                   30-Sep-2022 11:00                1559
memcache.add.php                                   30-Sep-2022 11:01                6918
memcache.addserver.php                             30-Sep-2022 11:01               13146
memcache.close.php                                 30-Sep-2022 11:01                5092
memcache.connect.php                               30-Sep-2022 11:01                7168
memcache.constants.php                             30-Sep-2022 11:01                4223
memcache.decrement.php                             30-Sep-2022 11:01                7174
memcache.delete.php                                30-Sep-2022 11:01                6362
memcache.examples-overview.php                     30-Sep-2022 11:01                6716
memcache.examples.php                              30-Sep-2022 11:01                1359
memcache.flush.php                                 30-Sep-2022 11:01                4452
memcache.get.php                                   30-Sep-2022 11:01                8627
memcache.getextendedstats.php                      30-Sep-2022 11:01                8012
memcache.getserverstatus.php                       30-Sep-2022 11:01                6109
memcache.getstats.php                              30-Sep-2022 11:01                4512
memcache.getversion.php                            30-Sep-2022 11:01                4973
memcache.increment.php                             30-Sep-2022 11:01                6972
memcache.ini.php                                   30-Sep-2022 11:01                9572
memcache.installation.php                          30-Sep-2022 11:01                2072
memcache.pconnect.php                              30-Sep-2022 11:01                6156
memcache.replace.php                               30-Sep-2022 11:01                7021
memcache.requirements.php                          30-Sep-2022 11:01                1315
memcache.resources.php                             30-Sep-2022 11:01                1245
memcache.set.php                                   30-Sep-2022 11:01                9630
memcache.setcompressthreshold.php                  30-Sep-2022 11:01                5801
memcache.setserverparams.php                       30-Sep-2022 11:01               10853
memcache.setup.php                                 30-Sep-2022 11:01                1574
memcached.add.php                                  30-Sep-2022 11:01                4342
memcached.addbykey.php                             30-Sep-2022 11:01                5212
memcached.addserver.php                            30-Sep-2022 11:01                7221
memcached.addservers.php                           30-Sep-2022 11:01                5298
memcached.append.php                               30-Sep-2022 11:01                6743
memcached.appendbykey.php                          30-Sep-2022 11:01                4401
memcached.callbacks.php                            30-Sep-2022 11:01                1473
memcached.callbacks.read-through.php               30-Sep-2022 11:01                4560
memcached.callbacks.result.php                     30-Sep-2022 11:01                4997
memcached.cas.php                                  30-Sep-2022 11:01                9609
memcached.casbykey.php                             30-Sep-2022 11:01                5245
memcached.configuration.php                        30-Sep-2022 11:01               23078
memcached.constants.php                            30-Sep-2022 11:01               22248
memcached.construct.php                            30-Sep-2022 11:01                4411
memcached.decrement.php                            30-Sep-2022 11:01                8882
memcached.decrementbykey.php                       30-Sep-2022 11:01                5547
memcached.delete.php                               30-Sep-2022 11:01                5767
memcached.deletebykey.php                          30-Sep-2022 11:01                4654
memcached.deletemulti.php                          30-Sep-2022 11:01                4825
memcached.deletemultibykey.php                     30-Sep-2022 11:01                4717
memcached.expiration.php                           30-Sep-2022 11:01                1875
memcached.fetch.php                                30-Sep-2022 11:01                6529
memcached.fetchall.php                             30-Sep-2022 11:01                6429
memcached.flush.php                                30-Sep-2022 11:01                4518
memcached.get.php                                  30-Sep-2022 11:01               10101
memcached.getallkeys.php                           30-Sep-2022 11:01                2671
memcached.getbykey.php                             30-Sep-2022 11:01                5962
memcached.getdelayed.php                           30-Sep-2022 11:01                8289
memcached.getdelayedbykey.php                      30-Sep-2022 11:01                5122
memcached.getmulti.php                             30-Sep-2022 11:01               21087
memcached.getmultibykey.php                        30-Sep-2022 11:01                5253
memcached.getoption.php                            30-Sep-2022 11:01                5110
memcached.getresultcode.php                        30-Sep-2022 11:01                4249
memcached.getresultmessage.php                     30-Sep-2022 11:01                4639
memcached.getserverbykey.php                       30-Sep-2022 11:01                7153
memcached.getserverlist.php                        30-Sep-2022 11:01                4570
memcached.getstats.php                             30-Sep-2022 11:01                5036
memcached.getversion.php                           30-Sep-2022 11:01                3789
memcached.increment.php                            30-Sep-2022 11:01                8202
memcached.incrementbykey.php                       30-Sep-2022 11:01                5480
memcached.installation.php                         30-Sep-2022 11:01                2570
memcached.ispersistent.php                         30-Sep-2022 11:01                2760
memcached.ispristine.php                           30-Sep-2022 11:01                2691
memcached.prepend.php                              30-Sep-2022 11:01                6769
memcached.prependbykey.php                         30-Sep-2022 11:01                4425
memcached.quit.php                                 30-Sep-2022 11:01                2241
memcached.replace.php                              30-Sep-2022 11:01                4414
memcached.replacebykey.php                         30-Sep-2022 11:01                5299
memcached.requirements.php                         30-Sep-2022 11:01                1489
memcached.resetserverlist.php                      30-Sep-2022 11:01                2980
memcached.resources.php                            30-Sep-2022 11:01                1179
memcached.sessions.php                             30-Sep-2022 11:01                2265
memcached.set.php                                  30-Sep-2022 11:01                8955
memcached.setbykey.php                             30-Sep-2022 11:01                6758
memcached.setmulti.php                             30-Sep-2022 11:01                6091
memcached.setmultibykey.php                        30-Sep-2022 11:01                4573
memcached.setoption.php                            30-Sep-2022 11:01                7235
memcached.setoptions.php                           30-Sep-2022 11:01                6804
memcached.setsaslauthdata.php                      30-Sep-2022 11:01                3160
memcached.setup.php                                30-Sep-2022 11:01                1592
memcached.touch.php                                30-Sep-2022 11:01                3409
memcached.touchbykey.php                           30-Sep-2022 11:01                4234
messageformatter.create.php                        30-Sep-2022 11:00               10782
messageformatter.format.php                        30-Sep-2022 11:00                9717
messageformatter.formatmessage.php                 30-Sep-2022 11:00                9869
messageformatter.geterrorcode.php                  30-Sep-2022 11:00                3871
messageformatter.geterrormessage.php               30-Sep-2022 11:00                7762
messageformatter.getlocale.php                     30-Sep-2022 11:00                5384
messageformatter.getpattern.php                    30-Sep-2022 11:00               10312
messageformatter.parse.php                         30-Sep-2022 11:00                9724
messageformatter.parsemessage.php                  30-Sep-2022 11:00               10313
messageformatter.setpattern.php                    30-Sep-2022 11:00               10731
mhash.configuration.php                            30-Sep-2022 11:00                1206
mhash.constants.php                                30-Sep-2022 11:00                4863
mhash.examples.php                                 30-Sep-2022 11:00                3415
mhash.installation.php                             30-Sep-2022 11:00                1567
mhash.requirements.php                             30-Sep-2022 11:00                1296
mhash.resources.php                                30-Sep-2022 11:00                1151
mhash.setup.php                                    30-Sep-2022 11:00                1540
migration56.changed-functions.php                  30-Sep-2022 11:01                6583
migration56.constants.php                          30-Sep-2022 11:01                5194
migration56.deprecated.php                         30-Sep-2022 11:01                6095
migration56.extensions.php                         30-Sep-2022 11:01                4313
migration56.incompatible.php                       30-Sep-2022 11:01                8540
migration56.new-features.php                       30-Sep-2022 11:01               30942
migration56.new-functions.php                      30-Sep-2022 11:01                7495
migration56.openssl.php                            30-Sep-2022 11:01               26239
migration56.php                                    30-Sep-2022 11:01                2427
migration70.changed-functions.php                  30-Sep-2022 11:01                5189
migration70.classes.php                            30-Sep-2022 11:01                3875
migration70.constants.php                          30-Sep-2022 11:01                7052
migration70.deprecated.php                         30-Sep-2022 11:01                5827
migration70.incompatible.php                       30-Sep-2022 11:01               61927
migration70.new-features.php                       30-Sep-2022 11:01               43667
migration70.new-functions.php                      30-Sep-2022 11:01                7376
migration70.other-changes.php                      30-Sep-2022 11:01                3451
migration70.php                                    30-Sep-2022 11:01                2807
migration70.removed-exts-sapis.php                 30-Sep-2022 11:01                3129
migration70.sapi-changes.php                       30-Sep-2022 11:01                1974
migration71.changed-functions.php                  30-Sep-2022 11:01                7194
migration71.constants.php                          30-Sep-2022 11:01                7188
migration71.deprecated.php                         30-Sep-2022 11:01                2246
migration71.incompatible.php                       30-Sep-2022 11:01               31692
migration71.new-features.php                       30-Sep-2022 11:01               28550
migration71.new-functions.php                      30-Sep-2022 11:01                5030
migration71.other-changes.php                      30-Sep-2022 11:01                8152
migration71.php                                    30-Sep-2022 11:01                2472
migration71.windows-support.php                    30-Sep-2022 11:01                7125
migration72.constants.php                          30-Sep-2022 11:01               24658
migration72.deprecated.php                         30-Sep-2022 11:01               10171
migration72.incompatible.php                       30-Sep-2022 11:01               19597
migration72.new-features.php                       30-Sep-2022 11:01               18542
migration72.new-functions.php                      30-Sep-2022 11:01               24374
migration72.other-changes.php                      30-Sep-2022 11:01                5655
migration72.php                                    30-Sep-2022 11:01                2372
migration73.constants.php                          30-Sep-2022 11:01               17677
migration73.deprecated.php                         30-Sep-2022 11:01                8452
migration73.incompatible.php                       30-Sep-2022 11:01               18425
migration73.new-features.php                       30-Sep-2022 11:01               16096
migration73.new-functions.php                      30-Sep-2022 11:01                7351
migration73.other-changes.php                      30-Sep-2022 11:01               15458
migration73.php                                    30-Sep-2022 11:01                2490
migration73.windows-support.php                    30-Sep-2022 11:01                1801
migration74.constants.php                          30-Sep-2022 11:01                5845
migration74.deprecated.php                         30-Sep-2022 11:01               15354
migration74.incompatible.php                       30-Sep-2022 11:01               17106
migration74.new-classes.php                        30-Sep-2022 11:01                1481
migration74.new-features.php                       30-Sep-2022 11:01               22478
migration74.new-functions.php                      30-Sep-2022 11:01                3697
migration74.other-changes.php                      30-Sep-2022 11:01               21106
migration74.php                                    30-Sep-2022 11:01                2706
migration74.removed-extensions.php                 30-Sep-2022 11:01                1889
migration74.windows-support.php                    30-Sep-2022 11:01                3754
migration80.deprecated.php                         30-Sep-2022 11:01               19184
migration80.incompatible.php                       30-Sep-2022 11:01               96867
migration80.new-features.php                       30-Sep-2022 11:01               32952
migration80.other-changes.php                      30-Sep-2022 11:01               14803
migration80.php                                    30-Sep-2022 11:01                2359
migration81.constants.php                          30-Sep-2022 11:01                6172
migration81.deprecated.php                         30-Sep-2022 11:01               17819
migration81.incompatible.php                       30-Sep-2022 11:01               22555
migration81.new-classes.php                        30-Sep-2022 11:01                2117
migration81.new-features.php                       30-Sep-2022 11:01               23399
migration81.new-functions.php                      30-Sep-2022 11:01                8457
migration81.other-changes.php                      30-Sep-2022 11:01                9551
migration81.php                                    30-Sep-2022 11:01                2579
migration82.constants.php                          30-Sep-2022 11:01               16108
migration82.deprecated.php                         30-Sep-2022 11:01                6000
migration82.incompatible.php                       30-Sep-2022 11:01                8083
migration82.new-features.php                       30-Sep-2022 11:01                6780
migration82.new-functions.php                      30-Sep-2022 11:01                3401
migration82.other-changes.php                      30-Sep-2022 11:01               24982
migration82.php                                    30-Sep-2022 11:01                2630
migration82.windows-support.php                    30-Sep-2022 11:01                2291
misc.configuration.php                             30-Sep-2022 11:01                5245
misc.constants.php                                 30-Sep-2022 11:01                2073
misc.installation.php                              30-Sep-2022 11:01                1182
misc.requirements.php                              30-Sep-2022 11:01                1146
misc.resources.php                                 30-Sep-2022 11:01                1144
misc.setup.php                                     30-Sep-2022 11:01                1512
mongodb-bson-binary.construct.php                  30-Sep-2022 11:00                7058
mongodb-bson-binary.getdata.php                    30-Sep-2022 11:00                4632
mongodb-bson-binary.gettype.php                    30-Sep-2022 11:00                4616
mongodb-bson-binary.jsonserialize.php              30-Sep-2022 11:00                5484
mongodb-bson-binary.serialize.php                  30-Sep-2022 11:00                3448
mongodb-bson-binary.tostring.php                   30-Sep-2022 11:00                4410
mongodb-bson-binary.unserialize.php                30-Sep-2022 11:00                4298
mongodb-bson-binaryinterface.getdata.php           30-Sep-2022 11:00                2760
mongodb-bson-binaryinterface.gettype.php           30-Sep-2022 11:00                2772
mongodb-bson-binaryinterface.tostring.php          30-Sep-2022 11:00                3238
mongodb-bson-dbpointer.construct.php               30-Sep-2022 11:00                2647
mongodb-bson-dbpointer.jsonserialize.php           30-Sep-2022 11:00                5553
mongodb-bson-dbpointer.serialize.php               30-Sep-2022 11:00                3523
mongodb-bson-dbpointer.tostring.php                30-Sep-2022 11:00                2602
mongodb-bson-dbpointer.unserialize.php             30-Sep-2022 11:00                3767
mongodb-bson-decimal128.construct.php              30-Sep-2022 11:00                6123
mongodb-bson-decimal128.jsonserialize.php          30-Sep-2022 11:00                5574
mongodb-bson-decimal128.serialize.php              30-Sep-2022 11:00                3548
mongodb-bson-decimal128.tostring.php               30-Sep-2022 11:00                4924
mongodb-bson-decimal128.unserialize.php            30-Sep-2022 11:00                4390
mongodb-bson-decimal128interface.tostring.php      30-Sep-2022 11:00                2923
mongodb-bson-int64.construct.php                   30-Sep-2022 11:00                2595
mongodb-bson-int64.jsonserialize.php               30-Sep-2022 11:00                5228
mongodb-bson-int64.serialize.php                   30-Sep-2022 11:00                3425
mongodb-bson-int64.tostring.php                    30-Sep-2022 11:00                3828
mongodb-bson-int64.unserialize.php                 30-Sep-2022 11:00                4269
mongodb-bson-javascript.construct.php              30-Sep-2022 11:00                7158
mongodb-bson-javascript.getcode.php                30-Sep-2022 11:00                4480
mongodb-bson-javascript.getscope.php               30-Sep-2022 11:00                5548
mongodb-bson-javascript.jsonserialize.php          30-Sep-2022 11:00                5570
mongodb-bson-javascript.serialize.php              30-Sep-2022 11:00                3548
mongodb-bson-javascript.tostring.php               30-Sep-2022 11:00                4280
mongodb-bson-javascript.unserialize.php            30-Sep-2022 11:00                4382
mongodb-bson-javascriptinterface.getcode.php       30-Sep-2022 11:00                2854
mongodb-bson-javascriptinterface.getscope.php      30-Sep-2022 11:00                2963
mongodb-bson-javascriptinterface.tostring.php      30-Sep-2022 11:00                3336
mongodb-bson-maxkey.construct.php                  30-Sep-2022 11:00                3762
mongodb-bson-maxkey.jsonserialize.php              30-Sep-2022 11:00                5490
mongodb-bson-maxkey.serialize.php                  30-Sep-2022 11:00                3452
mongodb-bson-maxkey.unserialize.php                30-Sep-2022 11:00                3700
mongodb-bson-minkey.construct.php                  30-Sep-2022 11:00                3762
mongodb-bson-minkey.jsonserialize.php              30-Sep-2022 11:00                5490
mongodb-bson-minkey.serialize.php                  30-Sep-2022 11:00                3452
mongodb-bson-minkey.unserialize.php                30-Sep-2022 11:00                3704
mongodb-bson-objectid.construct.php                30-Sep-2022 11:00                5383
mongodb-bson-objectid.gettimestamp.php             30-Sep-2022 11:00                5718
mongodb-bson-objectid.jsonserialize.php            30-Sep-2022 11:00                5536
mongodb-bson-objectid.serialize.php                30-Sep-2022 11:00                3500
mongodb-bson-objectid.tostring.php                 30-Sep-2022 11:00                4416
mongodb-bson-objectid.unserialize.php              30-Sep-2022 11:00                4336
mongodb-bson-objectidinterface.gettimestamp.php    30-Sep-2022 11:00                2925
mongodb-bson-objectidinterface.tostring.php        30-Sep-2022 11:00                2907
mongodb-bson-regex.construct.php                   30-Sep-2022 11:00                6948
mongodb-bson-regex.getflags.php                    30-Sep-2022 11:00                4597
mongodb-bson-regex.getpattern.php                  30-Sep-2022 11:00                4444
mongodb-bson-regex.jsonserialize.php               30-Sep-2022 11:00                5469
mongodb-bson-regex.serialize.php                   30-Sep-2022 11:00                3423
mongodb-bson-regex.tostring.php                    30-Sep-2022 11:00                3958
mongodb-bson-regex.unserialize.php                 30-Sep-2022 11:00                4273
mongodb-bson-regexinterface.getflags.php           30-Sep-2022 11:00                2759
mongodb-bson-regexinterface.getpattern.php         30-Sep-2022 11:00                2802
mongodb-bson-regexinterface.tostring.php           30-Sep-2022 11:00                2833
mongodb-bson-serializable.bsonserialize.php        30-Sep-2022 11:00               16183
mongodb-bson-symbol.construct.php                  30-Sep-2022 11:00                2587
mongodb-bson-symbol.jsonserialize.php              30-Sep-2022 11:00                5490
mongodb-bson-symbol.serialize.php                  30-Sep-2022 11:00                3448
mongodb-bson-symbol.tostring.php                   30-Sep-2022 11:00                2580
mongodb-bson-symbol.unserialize.php                30-Sep-2022 11:00                3706
mongodb-bson-timestamp.construct.php               30-Sep-2022 11:00                4738
mongodb-bson-timestamp.getincrement.php            30-Sep-2022 11:00                4241
mongodb-bson-timestamp.gettimestamp.php            30-Sep-2022 11:00                4226
mongodb-bson-timestamp.jsonserialize.php           30-Sep-2022 11:00                5557
mongodb-bson-timestamp.serialize.php               30-Sep-2022 11:00                3523
mongodb-bson-timestamp.tostring.php                30-Sep-2022 11:00                4104
mongodb-bson-timestamp.unserialize.php             30-Sep-2022 11:00                4369
mongodb-bson-timestampinterface.getincrement.php   30-Sep-2022 11:00                3289
mongodb-bson-timestampinterface.gettimestamp.php   30-Sep-2022 11:00                3304
mongodb-bson-timestampinterface.tostring.php       30-Sep-2022 11:00                2925
mongodb-bson-undefined.construct.php               30-Sep-2022 11:00                2647
mongodb-bson-undefined.jsonserialize.php           30-Sep-2022 11:00                5553
mongodb-bson-undefined.serialize.php               30-Sep-2022 11:00                3523
mongodb-bson-undefined.tostring.php                30-Sep-2022 11:00                2602
mongodb-bson-undefined.unserialize.php             30-Sep-2022 11:00                3768
mongodb-bson-unserializable.bsonunserialize.php    30-Sep-2022 11:00                7538
mongodb-bson-utcdatetime.construct.php             30-Sep-2022 11:00                8108
mongodb-bson-utcdatetime.jsonserialize.php         30-Sep-2022 11:00                5595
mongodb-bson-utcdatetime.serialize.php             30-Sep-2022 11:00                3575
mongodb-bson-utcdatetime.todatetime.php            30-Sep-2022 11:00                5978
mongodb-bson-utcdatetime.tostring.php              30-Sep-2022 11:00                4051
mongodb-bson-utcdatetime.unserialize.php           30-Sep-2022 11:00                4401
mongodb-bson-utcdatetimeinterface.todatetime.php   30-Sep-2022 11:00                3262
mongodb-bson-utcdatetimeinterface.tostring.php     30-Sep-2022 11:00                2941
mongodb-driver-bulkwrite.construct.php             30-Sep-2022 11:00               20262
mongodb-driver-bulkwrite.count.php                 30-Sep-2022 11:00                7085
mongodb-driver-bulkwrite.delete.php                30-Sep-2022 11:00               11529
mongodb-driver-bulkwrite.insert.php                30-Sep-2022 11:00               10056
mongodb-driver-bulkwrite.update.php                30-Sep-2022 11:00               14786
mongodb-driver-clientencryption.construct.php      30-Sep-2022 11:00                8503
mongodb-driver-clientencryption.createdatakey.php  30-Sep-2022 11:00               10215
mongodb-driver-clientencryption.decrypt.php        30-Sep-2022 11:00                4256
mongodb-driver-clientencryption.encrypt.php        30-Sep-2022 11:00                9852
mongodb-driver-command.construct.php               30-Sep-2022 11:00               15392
mongodb-driver-commandexception.getresultdocume..> 30-Sep-2022 11:00                3175
mongodb-driver-cursor.construct.php                30-Sep-2022 11:00                3366
mongodb-driver-cursor.current.php                  30-Sep-2022 11:00                2856
mongodb-driver-cursor.getid.php                    30-Sep-2022 11:00                8332
mongodb-driver-cursor.getserver.php                30-Sep-2022 11:00                7980
mongodb-driver-cursor.isdead.php                   30-Sep-2022 11:00               11097
mongodb-driver-cursor.key.php                      30-Sep-2022 11:00                2578
mongodb-driver-cursor.next.php                     30-Sep-2022 11:00                3505
mongodb-driver-cursor.rewind.php                   30-Sep-2022 11:00                3925
mongodb-driver-cursor.settypemap.php               30-Sep-2022 11:00                8400
mongodb-driver-cursor.toarray.php                  30-Sep-2022 11:00                8077
mongodb-driver-cursor.valid.php                    30-Sep-2022 11:00                2662
mongodb-driver-cursorid.construct.php              30-Sep-2022 11:00                2809
mongodb-driver-cursorid.serialize.php              30-Sep-2022 11:00                3546
mongodb-driver-cursorid.tostring.php               30-Sep-2022 11:00                7511
mongodb-driver-cursorid.unserialize.php            30-Sep-2022 11:00                4408
mongodb-driver-cursorinterface.getid.php           30-Sep-2022 11:00                4040
mongodb-driver-cursorinterface.getserver.php       30-Sep-2022 11:00                4126
mongodb-driver-cursorinterface.isdead.php          30-Sep-2022 11:00                3972
mongodb-driver-cursorinterface.settypemap.php      30-Sep-2022 11:00                3987
mongodb-driver-cursorinterface.toarray.php         30-Sep-2022 11:00                3872
mongodb-driver-manager.addsubscriber.php           30-Sep-2022 11:00                5107
mongodb-driver-manager.construct.php               30-Sep-2022 11:00               73126
mongodb-driver-manager.createclientencryption.php  30-Sep-2022 11:00               10237
mongodb-driver-manager.executebulkwrite.php        30-Sep-2022 11:00               24016
mongodb-driver-manager.executecommand.php          30-Sep-2022 11:00               26393
mongodb-driver-manager.executequery.php            30-Sep-2022 11:00               17186
mongodb-driver-manager.executereadcommand.php      30-Sep-2022 11:00               10133
mongodb-driver-manager.executereadwritecommand.php 30-Sep-2022 11:00               11117
mongodb-driver-manager.executewritecommand.php     30-Sep-2022 11:00               11192
mongodb-driver-manager.getencryptedfieldsmap.php   30-Sep-2022 11:00                3683
mongodb-driver-manager.getreadconcern.php          30-Sep-2022 11:00                6210
mongodb-driver-manager.getreadpreference.php       30-Sep-2022 11:00                6805
mongodb-driver-manager.getservers.php              30-Sep-2022 11:00                8119
mongodb-driver-manager.getwriteconcern.php         30-Sep-2022 11:00                6263
mongodb-driver-manager.removesubscriber.php        30-Sep-2022 11:00                4967
mongodb-driver-manager.selectserver.php            30-Sep-2022 11:00                7045
mongodb-driver-manager.startsession.php            30-Sep-2022 11:00               11868
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                3652
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                3747
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                3636
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                4804
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                3946
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                4218
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                4204
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                3854
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:00                3696
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:00                3953
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:00                3684
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:00                3586
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:00                5128
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:00                4694
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:00                4510
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:00                3874
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:00                3716
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:00                4934
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:00                4984
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:00                4999
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:00                3709
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:00                3816
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:00                4891
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:00                4003
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:00                4281
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:00                4739
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:00                3914
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:00                3742
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:00                4802
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:00                4772
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:00                5339
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:00                5384
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:00                5415
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:00                4802
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:00                4877
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:00                4814
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:00                4797
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:00                3108
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:00                3484
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:00                3178
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:00                3561
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:00                3284
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:00                3070
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:00                3122
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:00                3240
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:00                3558
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:00                3468
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:00                3245
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:00                3276
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:00                3527
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:00                3250
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:00                3294
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:00                3547
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:00                3610
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:00                3317
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:00                3328
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:00                4140
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:00                3563
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:00                3088
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:00                3140
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:00                3272
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:00                3553
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:00                3631
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:00                3292
mongodb-driver-monitoring-topologyclosedevent.g..> 30-Sep-2022 11:00                3237
mongodb-driver-monitoring-topologyopeningevent...> 30-Sep-2022 11:00                3247
mongodb-driver-query.construct.php                 30-Sep-2022 11:00               31464
mongodb-driver-readconcern.bsonserialize.php       30-Sep-2022 11:00                7747
mongodb-driver-readconcern.construct.php           30-Sep-2022 11:00                6515
mongodb-driver-readconcern.getlevel.php            30-Sep-2022 11:00                6410
mongodb-driver-readconcern.isdefault.php           30-Sep-2022 11:00                8688
mongodb-driver-readconcern.serialize.php           30-Sep-2022 11:00                3623
mongodb-driver-readconcern.unserialize.php         30-Sep-2022 11:00                4459
mongodb-driver-readpreference.bsonserialize.php    30-Sep-2022 11:00               12392
mongodb-driver-readpreference.construct.php        30-Sep-2022 11:00               18258
mongodb-driver-readpreference.gethedge.php         30-Sep-2022 11:00                3304
mongodb-driver-readpreference.getmaxstalenessse..> 30-Sep-2022 11:00                9584
mongodb-driver-readpreference.getmode.php          30-Sep-2022 11:00                8929
mongodb-driver-readpreference.getmodestring.php    30-Sep-2022 11:00                9133
mongodb-driver-readpreference.gettagsets.php       30-Sep-2022 11:00                9130
mongodb-driver-readpreference.serialize.php        30-Sep-2022 11:00                3700
mongodb-driver-readpreference.unserialize.php      30-Sep-2022 11:00                4538
mongodb-driver-runtimeexception.haserrorlabel.php  30-Sep-2022 11:00                4162
mongodb-driver-server.construct.php                30-Sep-2022 11:00                3368
mongodb-driver-server.executebulkwrite.php         30-Sep-2022 11:00               10994
mongodb-driver-server.executecommand.php           30-Sep-2022 11:00               13032
mongodb-driver-server.executequery.php             30-Sep-2022 11:00                8291
mongodb-driver-server.executereadcommand.php       30-Sep-2022 11:00               10455
mongodb-driver-server.executereadwritecommand.php  30-Sep-2022 11:00               11628
mongodb-driver-server.executewritecommand.php      30-Sep-2022 11:00               11669
mongodb-driver-server.gethost.php                  30-Sep-2022 11:00                5851
mongodb-driver-server.getinfo.php                  30-Sep-2022 11:00               10877
mongodb-driver-server.getlatency.php               30-Sep-2022 11:00                7374
mongodb-driver-server.getport.php                  30-Sep-2022 11:00                5895
mongodb-driver-server.getserverdescription.php     30-Sep-2022 11:00                3408
mongodb-driver-server.gettags.php                  30-Sep-2022 11:00                3547
mongodb-driver-server.gettype.php                  30-Sep-2022 11:00                3658
mongodb-driver-server.isarbiter.php                30-Sep-2022 11:00                3472
mongodb-driver-server.ishidden.php                 30-Sep-2022 11:00                3466
mongodb-driver-server.ispassive.php                30-Sep-2022 11:00                3534
mongodb-driver-server.isprimary.php                30-Sep-2022 11:00                3479
mongodb-driver-server.issecondary.php              30-Sep-2022 11:00                3514
mongodb-driver-serverapi.bsonserialize.php         30-Sep-2022 11:00                3246
mongodb-driver-serverapi.construct.php             30-Sep-2022 11:00                3106
mongodb-driver-serverapi.serialize.php             30-Sep-2022 11:00                3576
mongodb-driver-serverapi.unserialize.php           30-Sep-2022 11:00                4426
mongodb-driver-serverdescription.gethellorespon..> 30-Sep-2022 11:00                5164
mongodb-driver-serverdescription.gethost.php       30-Sep-2022 11:00                3383
mongodb-driver-serverdescription.getlastupdatet..> 30-Sep-2022 11:00                3525
mongodb-driver-serverdescription.getport.php       30-Sep-2022 11:00                3440
mongodb-driver-serverdescription.getroundtripti..> 30-Sep-2022 11:00                3783
mongodb-driver-serverdescription.gettype.php       30-Sep-2022 11:00                3653
mongodb-driver-session.aborttransaction.php        30-Sep-2022 11:00                4215
mongodb-driver-session.advanceclustertime.php      30-Sep-2022 11:00                4753
mongodb-driver-session.advanceoperationtime.php    30-Sep-2022 11:00                4811
mongodb-driver-session.committransaction.php       30-Sep-2022 11:00                5623
mongodb-driver-session.construct.php               30-Sep-2022 11:00                2876
mongodb-driver-session.endsession.php              30-Sep-2022 11:00                4347
mongodb-driver-session.getclustertime.php          30-Sep-2022 11:00                3753
mongodb-driver-session.getlogicalsessionid.php     30-Sep-2022 11:00                3058
mongodb-driver-session.getoperationtime.php        30-Sep-2022 11:00                3893
mongodb-driver-session.getserver.php               30-Sep-2022 11:00                3775
mongodb-driver-session.gettransactionoptions.php   30-Sep-2022 11:00                3603
mongodb-driver-session.gettransactionstate.php     30-Sep-2022 11:00                3685
mongodb-driver-session.isdirty.php                 30-Sep-2022 11:00                2944
mongodb-driver-session.isintransaction.php         30-Sep-2022 11:00                3630
mongodb-driver-session.starttransaction.php        30-Sep-2022 11:00                8976
mongodb-driver-topologydescription.getservers.php  30-Sep-2022 11:00                3387
mongodb-driver-topologydescription.gettype.php     30-Sep-2022 11:00                3313
mongodb-driver-topologydescription.hasreadables..> 30-Sep-2022 11:00                3792
mongodb-driver-topologydescription.haswritables..> 30-Sep-2022 11:00                3154
mongodb-driver-writeconcern.bsonserialize.php      30-Sep-2022 11:00                8202
mongodb-driver-writeconcern.construct.php          30-Sep-2022 11:00               10646
mongodb-driver-writeconcern.getjournal.php         30-Sep-2022 11:00                6329
mongodb-driver-writeconcern.getw.php               30-Sep-2022 11:00                5525
mongodb-driver-writeconcern.getwtimeout.php        30-Sep-2022 11:00                6267
mongodb-driver-writeconcern.isdefault.php          30-Sep-2022 11:00                8187
mongodb-driver-writeconcern.serialize.php          30-Sep-2022 11:00                3648
mongodb-driver-writeconcern.unserialize.php        30-Sep-2022 11:00                4498
mongodb-driver-writeconcernerror.getcode.php       30-Sep-2022 11:00                7007
mongodb-driver-writeconcernerror.getinfo.php       30-Sep-2022 11:00                7224
mongodb-driver-writeconcernerror.getmessage.php    30-Sep-2022 11:00                7096
mongodb-driver-writeerror.getcode.php              30-Sep-2022 11:00                6180
mongodb-driver-writeerror.getindex.php             30-Sep-2022 11:00                6719
mongodb-driver-writeerror.getinfo.php              30-Sep-2022 11:00                2948
mongodb-driver-writeerror.getmessage.php           30-Sep-2022 11:00                6314
mongodb-driver-writeexception.getwriteresult.php   30-Sep-2022 11:00                8723
mongodb-driver-writeresult.getdeletedcount.php     30-Sep-2022 11:00                8439
mongodb-driver-writeresult.getinsertedcount.php    30-Sep-2022 11:00                8521
mongodb-driver-writeresult.getmatchedcount.php     30-Sep-2022 11:00                9099
mongodb-driver-writeresult.getmodifiedcount.php    30-Sep-2022 11:00                9346
mongodb-driver-writeresult.getserver.php           30-Sep-2022 11:00                7147
mongodb-driver-writeresult.getupsertedcount.php    30-Sep-2022 11:00                8676
mongodb-driver-writeresult.getupsertedids.php      30-Sep-2022 11:00                9220
mongodb-driver-writeresult.getwriteconcernerror..> 30-Sep-2022 11:00                7851
mongodb-driver-writeresult.getwriteerrors.php      30-Sep-2022 11:00               14469
mongodb-driver-writeresult.isacknowledged.php      30-Sep-2022 11:00                8804
mongodb.architecture.php                           30-Sep-2022 11:00                1922
mongodb.configuration.php                          30-Sep-2022 11:00                3836
mongodb.connection-handling.php                    30-Sep-2022 11:00                9468
mongodb.constants.php                              30-Sep-2022 11:00                1839
mongodb.exceptions.php                             30-Sep-2022 11:00                5149
mongodb.exceptions.tree.php                        30-Sep-2022 11:00                5559
mongodb.installation.homebrew.php                  30-Sep-2022 11:00                1975
mongodb.installation.manual.php                    30-Sep-2022 11:00                6514
mongodb.installation.pecl.php                      30-Sep-2022 11:00                3612
mongodb.installation.php                           30-Sep-2022 11:00                1768
mongodb.installation.windows.php                   30-Sep-2022 11:00                2938
mongodb.monitoring.php                             30-Sep-2022 11:00               18567
mongodb.overview.php                               30-Sep-2022 11:00                7234
mongodb.persistence.deserialization.php            30-Sep-2022 11:00               20740
mongodb.persistence.php                            30-Sep-2022 11:00                1808
mongodb.persistence.serialization.php              30-Sep-2022 11:00               23894
mongodb.requirements.php                           30-Sep-2022 11:00                3105
mongodb.security.php                               30-Sep-2022 11:00                1484
mongodb.security.request_injection.php             30-Sep-2022 11:00                3004
mongodb.security.script_injection.php              30-Sep-2022 11:00               10544
mongodb.setup.php                                  30-Sep-2022 11:00                2008
mongodb.tutorial.apm.php                           30-Sep-2022 11:00               24275
mongodb.tutorial.library.php                       30-Sep-2022 11:00               11315
mongodb.tutorial.php                               30-Sep-2022 11:00                1694
mqseries.configure.php                             30-Sep-2022 11:01                2771
mqseries.constants.php                             30-Sep-2022 11:01                2112
mqseries.ini.php                                   30-Sep-2022 11:01                1272
mqseries.requirements.php                          30-Sep-2022 11:01                1580
mqseries.resources.php                             30-Sep-2022 11:01                1627
mqseries.setup.php                                 30-Sep-2022 11:01                1577
multipleiterator.attachiterator.php                30-Sep-2022 11:01                4158
multipleiterator.construct.php                     30-Sep-2022 11:01                8146
multipleiterator.containsiterator.php              30-Sep-2022 11:01                3294
multipleiterator.countiterators.php                30-Sep-2022 11:01                2978
multipleiterator.current.php                       30-Sep-2022 11:01                4247
multipleiterator.detachiterator.php                30-Sep-2022 11:01                3181
multipleiterator.getflags.php                      30-Sep-2022 11:01                3146
multipleiterator.key.php                           30-Sep-2022 11:01                4113
multipleiterator.next.php                          30-Sep-2022 11:01                2797
multipleiterator.rewind.php                        30-Sep-2022 11:01                2815
multipleiterator.setflags.php                      30-Sep-2022 11:01                3454
multipleiterator.valid.php                         30-Sep-2022 11:01                2890
mysql-xdevapi-baseresult.getwarnings.php           30-Sep-2022 11:00                7039
mysql-xdevapi-baseresult.getwarningscount.php      30-Sep-2022 11:00                6771
mysql-xdevapi-client.close.php                     30-Sep-2022 11:00                2311
mysql-xdevapi-client.construct.php                 30-Sep-2022 11:00                3597
mysql-xdevapi-client.getsession.php                30-Sep-2022 11:00                2377
mysql-xdevapi-collection.add.php                   30-Sep-2022 11:00                9921
mysql-xdevapi-collection.addorreplaceone.php       30-Sep-2022 11:00                8560
mysql-xdevapi-collection.construct.php             30-Sep-2022 11:00                6783
mysql-xdevapi-collection.count.php                 30-Sep-2022 11:00                6884
mysql-xdevapi-collection.createindex.php           30-Sep-2022 11:00               10047
mysql-xdevapi-collection.dropindex.php             30-Sep-2022 11:00                6914
mysql-xdevapi-collection.existsindatabase.php      30-Sep-2022 11:00                6158
mysql-xdevapi-collection.find.php                  30-Sep-2022 11:00               10187
mysql-xdevapi-collection.getname.php               30-Sep-2022 11:00                5220
mysql-xdevapi-collection.getone.php                30-Sep-2022 11:00                7461
mysql-xdevapi-collection.getschema.php             30-Sep-2022 11:00                5427
mysql-xdevapi-collection.getsession.php            30-Sep-2022 11:00                5702
mysql-xdevapi-collection.modify.php                30-Sep-2022 11:00                8529
mysql-xdevapi-collection.remove.php                30-Sep-2022 11:00                8859
mysql-xdevapi-collection.removeone.php             30-Sep-2022 11:00                8107
mysql-xdevapi-collection.replaceone.php            30-Sep-2022 11:00                8375
mysql-xdevapi-collectionadd.construct.php          30-Sep-2022 11:00                8386
mysql-xdevapi-collectionadd.execute.php            30-Sep-2022 11:00                8368
mysql-xdevapi-collectionfind.bind.php              30-Sep-2022 11:00                8265
mysql-xdevapi-collectionfind.construct.php         30-Sep-2022 11:00                7233
mysql-xdevapi-collectionfind.execute.php           30-Sep-2022 11:00                7437
mysql-xdevapi-collectionfind.fields.php            30-Sep-2022 11:00                7867
mysql-xdevapi-collectionfind.groupby.php           30-Sep-2022 11:00                4338
mysql-xdevapi-collectionfind.having.php            30-Sep-2022 11:00                4582
mysql-xdevapi-collectionfind.limit.php             30-Sep-2022 11:00                8532
mysql-xdevapi-collectionfind.lockexclusive.php     30-Sep-2022 11:00                6702
mysql-xdevapi-collectionfind.lockshared.php        30-Sep-2022 11:00                6505
mysql-xdevapi-collectionfind.offset.php            30-Sep-2022 11:00                8279
mysql-xdevapi-collectionfind.sort.php              30-Sep-2022 11:00                8389
mysql-xdevapi-collectionmodify.arrayappend.php     30-Sep-2022 11:00                8348
mysql-xdevapi-collectionmodify.arrayinsert.php     30-Sep-2022 11:00                8767
mysql-xdevapi-collectionmodify.bind.php            30-Sep-2022 11:00                8492
mysql-xdevapi-collectionmodify.construct.php       30-Sep-2022 11:00                7129
mysql-xdevapi-collectionmodify.execute.php         30-Sep-2022 11:00                3267
mysql-xdevapi-collectionmodify.limit.php           30-Sep-2022 11:00                8943
mysql-xdevapi-collectionmodify.patch.php           30-Sep-2022 11:00                4170
mysql-xdevapi-collectionmodify.replace.php         30-Sep-2022 11:00                8165
mysql-xdevapi-collectionmodify.set.php             30-Sep-2022 11:00                8107
mysql-xdevapi-collectionmodify.skip.php            30-Sep-2022 11:00                4839
mysql-xdevapi-collectionmodify.sort.php            30-Sep-2022 11:00                4882
mysql-xdevapi-collectionmodify.unset.php           30-Sep-2022 11:00                4470
mysql-xdevapi-collectionremove.bind.php            30-Sep-2022 11:00                5131
mysql-xdevapi-collectionremove.construct.php       30-Sep-2022 11:00                7640
mysql-xdevapi-collectionremove.execute.php         30-Sep-2022 11:00                4028
mysql-xdevapi-collectionremove.limit.php           30-Sep-2022 11:00                4471
mysql-xdevapi-collectionremove.sort.php            30-Sep-2022 11:00                4549
mysql-xdevapi-columnresult.construct.php           30-Sep-2022 11:00               10001
mysql-xdevapi-columnresult.getcharactersetname.php 30-Sep-2022 11:00                3228
mysql-xdevapi-columnresult.getcollationname.php    30-Sep-2022 11:00                3207
mysql-xdevapi-columnresult.getcolumnlabel.php      30-Sep-2022 11:00                3173
mysql-xdevapi-columnresult.getcolumnname.php       30-Sep-2022 11:00                3168
mysql-xdevapi-columnresult.getfractionaldigits.php 30-Sep-2022 11:00                3279
mysql-xdevapi-columnresult.getlength.php           30-Sep-2022 11:00                3123
mysql-xdevapi-columnresult.getschemaname.php       30-Sep-2022 11:00                3197
mysql-xdevapi-columnresult.gettablelabel.php       30-Sep-2022 11:00                3152
mysql-xdevapi-columnresult.gettablename.php        30-Sep-2022 11:00                3162
mysql-xdevapi-columnresult.gettype.php             30-Sep-2022 11:00                3079
mysql-xdevapi-columnresult.isnumbersigned.php      30-Sep-2022 11:00                3325
mysql-xdevapi-columnresult.ispadded.php            30-Sep-2022 11:00                3166
mysql-xdevapi-crudoperationbindable.bind.php       30-Sep-2022 11:00                5781
mysql-xdevapi-crudoperationlimitable.limit.php     30-Sep-2022 11:00                5872
mysql-xdevapi-crudoperationskippable.skip.php      30-Sep-2022 11:00                4543
mysql-xdevapi-crudoperationsortable.sort.php       30-Sep-2022 11:00                4579
mysql-xdevapi-databaseobject.existsindatabase.php  30-Sep-2022 11:00                3484
mysql-xdevapi-databaseobject.getname.php           30-Sep-2022 11:00                3399
mysql-xdevapi-databaseobject.getsession.php        30-Sep-2022 11:00                3502
mysql-xdevapi-docresult.construct.php              30-Sep-2022 11:00                7794
mysql-xdevapi-docresult.fetchall.php               30-Sep-2022 11:00                8243
mysql-xdevapi-docresult.fetchone.php               30-Sep-2022 11:00                7885
mysql-xdevapi-docresult.getwarnings.php            30-Sep-2022 11:00                8906
mysql-xdevapi-docresult.getwarningscount.php       30-Sep-2022 11:00                8718
mysql-xdevapi-executable.execute.php               30-Sep-2022 11:00                6745
mysql-xdevapi-executionstatus.construct.php        30-Sep-2022 11:00                2952
mysql-xdevapi-expression.construct.php             30-Sep-2022 11:00                3052
mysql-xdevapi-result.construct.php                 30-Sep-2022 11:00                7333
mysql-xdevapi-result.getaffecteditemscount.php     30-Sep-2022 11:00                6130
mysql-xdevapi-result.getautoincrementvalue.php     30-Sep-2022 11:00                7669
mysql-xdevapi-result.getgeneratedids.php           30-Sep-2022 11:00                6958
mysql-xdevapi-result.getwarnings.php               30-Sep-2022 11:00                6921
mysql-xdevapi-result.getwarningscount.php          30-Sep-2022 11:00                6617
mysql-xdevapi-rowresult.construct.php              30-Sep-2022 11:00                4997
mysql-xdevapi-rowresult.fetchall.php               30-Sep-2022 11:00                6691
mysql-xdevapi-rowresult.fetchone.php               30-Sep-2022 11:00                6854
mysql-xdevapi-rowresult.getcolumncount.php         30-Sep-2022 11:00                6168
mysql-xdevapi-rowresult.getcolumnnames.php         30-Sep-2022 11:00                6181
mysql-xdevapi-rowresult.getcolumns.php             30-Sep-2022 11:00                7142
mysql-xdevapi-rowresult.getwarnings.php            30-Sep-2022 11:00                6968
mysql-xdevapi-rowresult.getwarningscount.php       30-Sep-2022 11:00                6663
mysql-xdevapi-schema.construct.php                 30-Sep-2022 11:00                5522
mysql-xdevapi-schema.createcollection.php          30-Sep-2022 11:00               10312
mysql-xdevapi-schema.dropcollection.php            30-Sep-2022 11:00                6640
mysql-xdevapi-schema.existsindatabase.php          30-Sep-2022 11:00                6493
mysql-xdevapi-schema.getcollection.php             30-Sep-2022 11:00                5678
mysql-xdevapi-schema.getcollectionastable.php      30-Sep-2022 11:00                7310
mysql-xdevapi-schema.getcollections.php            30-Sep-2022 11:00                6405
mysql-xdevapi-schema.getname.php                   30-Sep-2022 11:00                4807
mysql-xdevapi-schema.getsession.php                30-Sep-2022 11:00                5305
mysql-xdevapi-schema.gettable.php                  30-Sep-2022 11:00                6877
mysql-xdevapi-schema.gettables.php                 30-Sep-2022 11:00                7083
mysql-xdevapi-schemaobject.getschema.php           30-Sep-2022 11:00                4074
mysql-xdevapi-session.close.php                    30-Sep-2022 11:00                3958
mysql-xdevapi-session.commit.php                   30-Sep-2022 11:00                4759
mysql-xdevapi-session.construct.php                30-Sep-2022 11:00                3122
mysql-xdevapi-session.createschema.php             30-Sep-2022 11:00                4980
mysql-xdevapi-session.dropschema.php               30-Sep-2022 11:00                4077
mysql-xdevapi-session.generateuuid.php             30-Sep-2022 11:00                3982
mysql-xdevapi-session.getdefaultschema.php         30-Sep-2022 11:00                4137
mysql-xdevapi-session.getschema.php                30-Sep-2022 11:00                4256
mysql-xdevapi-session.getschemas.php               30-Sep-2022 11:00                4075
mysql-xdevapi-session.getserverversion.php         30-Sep-2022 11:00                3918
mysql-xdevapi-session.listclients.php              30-Sep-2022 11:00                4242
mysql-xdevapi-session.quotename.php                30-Sep-2022 11:00                5357
mysql-xdevapi-session.releasesavepoint.php         30-Sep-2022 11:00                5692
mysql-xdevapi-session.rollback.php                 30-Sep-2022 11:00                5385
mysql-xdevapi-session.rollbackto.php               30-Sep-2022 11:00                5771
mysql-xdevapi-session.setsavepoint.php             30-Sep-2022 11:00                5984
mysql-xdevapi-session.sql.php                      30-Sep-2022 11:00                3935
mysql-xdevapi-session.starttransaction.php         30-Sep-2022 11:00                5461
mysql-xdevapi-sqlstatement.bind.php                30-Sep-2022 11:00                3337
mysql-xdevapi-sqlstatement.construct.php           30-Sep-2022 11:00                2890
mysql-xdevapi-sqlstatement.execute.php             30-Sep-2022 11:00                3177
mysql-xdevapi-sqlstatement.getnextresult.php       30-Sep-2022 11:00                3229
mysql-xdevapi-sqlstatement.getresult.php           30-Sep-2022 11:00                3198
mysql-xdevapi-sqlstatement.hasmoreresults.php      30-Sep-2022 11:00                3248
mysql-xdevapi-sqlstatementresult.construct.php     30-Sep-2022 11:00                3010
mysql-xdevapi-sqlstatementresult.fetchall.php      30-Sep-2022 11:00                7098
mysql-xdevapi-sqlstatementresult.fetchone.php      30-Sep-2022 11:00                6927
mysql-xdevapi-sqlstatementresult.getaffectedite..> 30-Sep-2022 11:00                3363
mysql-xdevapi-sqlstatementresult.getcolumncount..> 30-Sep-2022 11:00                3890
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 30-Sep-2022 11:00                3279
mysql-xdevapi-sqlstatementresult.getcolumns.php    30-Sep-2022 11:00                3235
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 30-Sep-2022 11:00                3393
mysql-xdevapi-sqlstatementresult.getlastinserti..> 30-Sep-2022 11:00                3336