Index of /php.ihc-ru.net/manual/de/


../
feeds/                                             30-Sep-2022 11:06                   -
images/                                            30-Sep-2022 11:06                   -
styles/                                            30-Sep-2022 11:05                   -
toc/                                               30-Sep-2022 11:06                   -
about.formats.php                                  30-Sep-2022 11:06                4555
about.generate.php                                 30-Sep-2022 11:06                2952
about.howtohelp.php                                30-Sep-2022 11:06                3724
about.more.php                                     30-Sep-2022 11:06                1922
about.notes.php                                    30-Sep-2022 11:06                2500
about.php                                          30-Sep-2022 11:06                1873
about.phpversions.php                              30-Sep-2022 11:06                3652
about.prototypes.php                               30-Sep-2022 11:06                7239
about.translations.php                             30-Sep-2022 11:06                3260
aliases.php                                        30-Sep-2022 11:06               29412
apache.configuration.php                           30-Sep-2022 11:06                4957
apache.constants.php                               30-Sep-2022 11:06                1131
apache.installation.php                            30-Sep-2022 11:06                1252
apache.requirements.php                            30-Sep-2022 11:06                1191
apache.resources.php                               30-Sep-2022 11:06                1174
apache.setup.php                                   30-Sep-2022 11:06                1570
apcu.configuration.php                             30-Sep-2022 11:06               14401
apcu.constants.php                                 30-Sep-2022 11:06                5266
apcu.installation.php                              30-Sep-2022 11:06                3172
apcu.requirements.php                              30-Sep-2022 11:06                1177
apcu.resources.php                                 30-Sep-2022 11:06                1160
apcu.setup.php                                     30-Sep-2022 11:06                1527
apcuiterator.construct.php                         30-Sep-2022 11:06                6483
apcuiterator.current.php                           30-Sep-2022 11:06                2975
apcuiterator.gettotalcount.php                     30-Sep-2022 11:06                3136
apcuiterator.gettotalhits.php                      30-Sep-2022 11:06                3220
apcuiterator.gettotalsize.php                      30-Sep-2022 11:06                3013
apcuiterator.key.php                               30-Sep-2022 11:06                2683
apcuiterator.next.php                              30-Sep-2022 11:06                2941
apcuiterator.rewind.php                            30-Sep-2022 11:06                2711
apcuiterator.valid.php                             30-Sep-2022 11:06                2778
appendices.php                                     30-Sep-2022 11:06               12025
appenditerator.append.php                          30-Sep-2022 11:06                5538
appenditerator.construct.php                       30-Sep-2022 11:06               10590
appenditerator.current.php                         30-Sep-2022 11:06                3482
appenditerator.getarrayiterator.php                30-Sep-2022 11:06                3153
appenditerator.getinneriterator.php                30-Sep-2022 11:06                6850
appenditerator.getiteratorindex.php                30-Sep-2022 11:06                6791
appenditerator.key.php                             30-Sep-2022 11:06                8223
appenditerator.next.php                            30-Sep-2022 11:06                3395
appenditerator.rewind.php                          30-Sep-2022 11:06                3377
appenditerator.valid.php                           30-Sep-2022 11:06                3200
array.configuration.php                            30-Sep-2022 11:06                1224
array.constants.php                                30-Sep-2022 11:06                8417
array.installation.php                             30-Sep-2022 11:06                1208
array.requirements.php                             30-Sep-2022 11:06                1184
array.resources.php                                30-Sep-2022 11:06                1167
array.setup.php                                    30-Sep-2022 11:06                1536
array.sorting.php                                  30-Sep-2022 11:06                6878
arrayaccess.offsetexists.php                       30-Sep-2022 11:06               10088
arrayaccess.offsetget.php                          30-Sep-2022 11:06                5003
arrayaccess.offsetset.php                          30-Sep-2022 11:06                5056
arrayaccess.offsetunset.php                        30-Sep-2022 11:06                2876
arrayiterator.append.php                           30-Sep-2022 11:06                3486
arrayiterator.asort.php                            30-Sep-2022 11:06                6104
arrayiterator.construct.php                        30-Sep-2022 11:06                3540
arrayiterator.count.php                            30-Sep-2022 11:06                2935
arrayiterator.current.php                          30-Sep-2022 11:06                5411
arrayiterator.getarraycopy.php                     30-Sep-2022 11:06                2900
arrayiterator.getflags.php                         30-Sep-2022 11:06                3009
arrayiterator.key.php                              30-Sep-2022 11:06                3804
arrayiterator.ksort.php                            30-Sep-2022 11:06                6077
arrayiterator.natcasesort.php                      30-Sep-2022 11:06                4067
arrayiterator.natsort.php                          30-Sep-2022 11:06                3854
arrayiterator.next.php                             30-Sep-2022 11:06                4713
arrayiterator.offsetexists.php                     30-Sep-2022 11:06                3199
arrayiterator.offsetget.php                        30-Sep-2022 11:06                3445
arrayiterator.offsetset.php                        30-Sep-2022 11:06                3699
arrayiterator.offsetunset.php                      30-Sep-2022 11:06                3777
arrayiterator.rewind.php                           30-Sep-2022 11:06                4671
arrayiterator.seek.php                             30-Sep-2022 11:06                2520
arrayiterator.serialize.php                        30-Sep-2022 11:06                2811
arrayiterator.setflags.php                         30-Sep-2022 11:06                4028
arrayiterator.uasort.php                           30-Sep-2022 11:06                5127
arrayiterator.uksort.php                           30-Sep-2022 11:06                4892
arrayiterator.unserialize.php                      30-Sep-2022 11:06                3041
arrayiterator.valid.php                            30-Sep-2022 11:06                4556
arrayobject.append.php                             30-Sep-2022 11:06                5504
arrayobject.asort.php                              30-Sep-2022 11:06                9148
arrayobject.construct.php                          30-Sep-2022 11:06                6041
arrayobject.count.php                              30-Sep-2022 11:06                5462
arrayobject.exchangearray.php                      30-Sep-2022 11:06                6113
arrayobject.getarraycopy.php                       30-Sep-2022 11:06                5343
arrayobject.getflags.php                           30-Sep-2022 11:06                6208
arrayobject.getiterator.php                        30-Sep-2022 11:06                5550
arrayobject.getiteratorclass.php                   30-Sep-2022 11:06                6752
arrayobject.ksort.php                              30-Sep-2022 11:06                8832
arrayobject.natcasesort.php                        30-Sep-2022 11:06                7711
arrayobject.natsort.php                            30-Sep-2022 11:06                7398
arrayobject.offsetexists.php                       30-Sep-2022 11:06                4831
arrayobject.offsetget.php                          30-Sep-2022 11:06                5130
arrayobject.offsetset.php                          30-Sep-2022 11:06                6916
arrayobject.offsetunset.php                        30-Sep-2022 11:06                4271
arrayobject.serialize.php                          30-Sep-2022 11:06                5103
arrayobject.setflags.php                           30-Sep-2022 11:06                6828
arrayobject.setiteratorclass.php                   30-Sep-2022 11:06                5951
arrayobject.uasort.php                             30-Sep-2022 11:06               10014
arrayobject.uksort.php                             30-Sep-2022 11:06                9345
arrayobject.unserialize.php                        30-Sep-2022 11:06                3499
backedenum.from.php                                30-Sep-2022 11:06                6011
backedenum.tryfrom.php                             30-Sep-2022 11:06                6303
bc.configuration.php                               30-Sep-2022 11:06                2401
bc.constants.php                                   30-Sep-2022 11:06                1105
bc.installation.php                                30-Sep-2022 11:06                1393
bc.requirements.php                                30-Sep-2022 11:06                1163
bc.resources.php                                   30-Sep-2022 11:06                1146
bc.setup.php                                       30-Sep-2022 11:06                1528
book.apache.php                                    30-Sep-2022 11:06                3266
book.apcu.php                                      30-Sep-2022 11:06                4350
book.array.php                                     30-Sep-2022 11:06               12851
book.bc.php                                        30-Sep-2022 11:06                2935
book.bson.php                                      30-Sep-2022 11:06               19851
book.bzip2.php                                     30-Sep-2022 11:06                3021
book.calendar.php                                  30-Sep-2022 11:06                4282
book.classobj.php                                  30-Sep-2022 11:06                4614
book.cmark.php                                     30-Sep-2022 11:06                8677
book.com.php                                       30-Sep-2022 11:06                7914
book.componere.php                                 30-Sep-2022 11:06                6144
book.csprng.php                                    30-Sep-2022 11:06                2138
book.ctype.php                                     30-Sep-2022 11:06                3101
book.cubrid.php                                    30-Sep-2022 11:06               13815
book.curl.php                                      30-Sep-2022 11:06                7182
book.datetime.php                                  30-Sep-2022 11:06               16785
book.dba.php                                       30-Sep-2022 11:06                3693
book.dbase.php                                     30-Sep-2022 11:06                3380
book.dio.php                                       30-Sep-2022 11:06                2893
book.dir.php                                       30-Sep-2022 11:06                3206
book.dom.php                                       30-Sep-2022 11:06               17736
book.ds.php                                        30-Sep-2022 11:06               25062
book.eio.php                                       30-Sep-2022 11:06                7906
book.enchant.php                                   30-Sep-2022 11:06                5334
book.errorfunc.php                                 30-Sep-2022 11:06                3552
book.ev.php                                        30-Sep-2022 11:06               13335
book.event.php                                     30-Sep-2022 11:06               23028
book.exec.php                                      30-Sep-2022 11:06                3400
book.exif.php                                      30-Sep-2022 11:06                2476
book.expect.php                                    30-Sep-2022 11:06                2450
book.fann.php                                      30-Sep-2022 11:06               23071
book.fdf.php                                       30-Sep-2022 11:06                5877
book.ffi.php                                       30-Sep-2022 11:06                5607
book.fileinfo.php                                  30-Sep-2022 11:06                3064
book.filesystem.php                                30-Sep-2022 11:06               10547
book.filter.php                                    30-Sep-2022 11:06                3469
book.fpm.php                                       30-Sep-2022 11:06                1932
book.ftp.php                                       30-Sep-2022 11:06                6229
book.funchand.php                                  30-Sep-2022 11:06                3695
book.gearman.php                                   30-Sep-2022 11:06               14772
book.gender.php                                    30-Sep-2022 11:06                2556
book.geoip.php                                     30-Sep-2022 11:06                4325
book.gettext.php                                   30-Sep-2022 11:06                2980
book.gmagick.php                                   30-Sep-2022 11:06               22559
book.gmp.php                                       30-Sep-2022 11:06                6412
book.gnupg.php                                     30-Sep-2022 11:06                5259
book.hash.php                                      30-Sep-2022 11:06                4190
book.hrtime.php                                    30-Sep-2022 11:06                3441
book.ibase.php                                     30-Sep-2022 11:06               12788
book.ibm-db2.php                                   30-Sep-2022 11:06                8600
book.iconv.php                                     30-Sep-2022 11:06                3285
book.igbinary.php                                  30-Sep-2022 11:06                2097
book.image.php                                     30-Sep-2022 11:06               15923
book.imagick.php                                   30-Sep-2022 11:06               62149
book.imap.php                                      30-Sep-2022 11:06               10730
book.info.php                                      30-Sep-2022 11:06                8185
book.inotify.php                                   30-Sep-2022 11:06                2513
book.intl.php                                      30-Sep-2022 11:06               44350
book.json.php                                      30-Sep-2022 11:06                2814
book.ldap.php                                      30-Sep-2022 11:06                9339
book.libxml.php                                    30-Sep-2022 11:06                2924
book.lua.php                                       30-Sep-2022 11:06                2604
book.luasandbox.php                                30-Sep-2022 11:06                5525
book.lzf.php                                       30-Sep-2022 11:06                2165
book.mail.php                                      30-Sep-2022 11:06                2071
book.mailparse.php                                 30-Sep-2022 11:06                3875
book.math.php                                      30-Sep-2022 11:06                6253
book.mbstring.php                                  30-Sep-2022 11:06                9513
book.mcrypt.php                                    30-Sep-2022 11:06                6363
book.memcache.php                                  30-Sep-2022 11:06                4203
book.memcached.php                                 30-Sep-2022 11:06                8034
book.mhash.php                                     30-Sep-2022 11:06                2469
book.misc.php                                      30-Sep-2022 11:06                5517
book.mongodb.php                                   30-Sep-2022 11:06               25588
book.mqseries.php                                  30-Sep-2022 11:06                3137
book.mysql-xdevapi.php                             30-Sep-2022 11:06               28940
book.mysql.php                                     30-Sep-2022 11:06                8194
book.mysqli.php                                    30-Sep-2022 11:06               18423
book.mysqlnd.php                                   30-Sep-2022 11:06                2418
book.network.php                                   30-Sep-2022 11:06                6074
book.oauth.php                                     30-Sep-2022 11:06                7145
book.oci8.php                                      30-Sep-2022 11:06               16927
book.opcache.php                                   30-Sep-2022 11:06                2676
book.openal.php                                    30-Sep-2022 11:06                4394
book.openssl.php                                   30-Sep-2022 11:06               11573
book.outcontrol.php                                30-Sep-2022 11:06                4156
book.parallel.php                                  30-Sep-2022 11:06                5694
book.parle.php                                     30-Sep-2022 11:06                8777
book.password.php                                  30-Sep-2022 11:06                2621
book.pcntl.php                                     30-Sep-2022 11:06                5227
book.pcre.php                                      30-Sep-2022 11:06                3872
book.pdo.php                                       30-Sep-2022 11:06                7883
book.pgsql.php                                     30-Sep-2022 11:06               13535
book.phar.php                                      30-Sep-2022 11:06               15690
book.phpdbg.php                                    30-Sep-2022 11:06                2874
book.posix.php                                     30-Sep-2022 11:06                6629
book.ps.php                                        30-Sep-2022 11:06                9135
book.pspell.php                                    30-Sep-2022 11:06                4730
book.pthreads.php                                  30-Sep-2022 11:06                5414
book.quickhash.php                                 30-Sep-2022 11:06                8863
book.radius.php                                    30-Sep-2022 11:06                5492
book.rar.php                                       30-Sep-2022 11:06                5229
book.readline.php                                  30-Sep-2022 11:06                3778
book.recode.php                                    30-Sep-2022 11:06                2274
book.reflection.php                                30-Sep-2022 11:06               36707
book.rpminfo.php                                   30-Sep-2022 11:06                2362
book.rrd.php                                       30-Sep-2022 11:06                5059
book.runkit7.php                                   30-Sep-2022 11:06                4185
book.scoutapm.php                                  30-Sep-2022 11:06                2151
book.seaslog.php                                   30-Sep-2022 11:06                5122
book.sem.php                                       30-Sep-2022 11:06                4430
book.session.php                                   30-Sep-2022 11:06                8263
book.shmop.php                                     30-Sep-2022 11:06                2905
book.simplexml.php                                 30-Sep-2022 11:06                5681
book.snmp.php                                      30-Sep-2022 11:06                5811
book.soap.php                                      30-Sep-2022 11:06                6330
book.sockets.php                                   30-Sep-2022 11:06                7367
book.sodium.php                                    30-Sep-2022 11:06               17291
book.solr.php                                      30-Sep-2022 11:06               53080
book.spl.php                                       30-Sep-2022 11:06               10004
book.sqlite3.php                                   30-Sep-2022 11:06                7146
book.sqlsrv.php                                    30-Sep-2022 11:06                5291
book.ssdeep.php                                    30-Sep-2022 11:06                2275
book.ssh2.php                                      30-Sep-2022 11:06                5408
book.stats.php                                     30-Sep-2022 11:06               11769
book.stomp.php                                     30-Sep-2022 11:06                4093
book.stream.php                                    30-Sep-2022 11:06               11537
book.strings.php                                   30-Sep-2022 11:06               14185
book.svm.php                                       30-Sep-2022 11:06                3627
book.svn.php                                       30-Sep-2022 11:06                7553
book.swoole.php                                    30-Sep-2022 11:06               37278
book.sync.php                                      30-Sep-2022 11:06                4726
book.taint.php                                     30-Sep-2022 11:06                2474
book.tcpwrap.php                                   30-Sep-2022 11:06                2000
book.tidy.php                                      30-Sep-2022 11:06                6537
book.tokenizer.php                                 30-Sep-2022 11:06                3087
book.trader.php                                    30-Sep-2022 11:06               17466
book.ui.php                                        30-Sep-2022 11:06               27886
book.uodbc.php                                     30-Sep-2022 11:06                6797
book.uopz.php                                      30-Sep-2022 11:06                5053
book.url.php                                       30-Sep-2022 11:06                2960
book.v8js.php                                      30-Sep-2022 11:06                3092
book.var.php                                       30-Sep-2022 11:06                5861
book.var_representation.php                        30-Sep-2022 11:06                2096
book.varnish.php                                   30-Sep-2022 11:06                5318
book.wddx.php                                      30-Sep-2022 11:06                2785
book.win32service.php                              30-Sep-2022 11:06                5111
book.wincache.php                                  30-Sep-2022 11:06                5557
book.wkhtmltox.php                                 30-Sep-2022 11:06                3250
book.xattr.php                                     30-Sep-2022 11:06                2392
book.xdiff.php                                     30-Sep-2022 11:06                4047
book.xhprof.php                                    30-Sep-2022 11:06                2403
book.xlswriter.php                                 30-Sep-2022 11:06                4366
book.xml.php                                       30-Sep-2022 11:06                5290
book.xmldiff.php                                   30-Sep-2022 11:06                3071
book.xmlreader.php                                 30-Sep-2022 11:06                5019
book.xmlrpc.php                                    30-Sep-2022 11:06                3698
book.xmlwriter.php                                 30-Sep-2022 11:06                6658
book.xsl.php                                       30-Sep-2022 11:06                3872
book.yac.php                                       30-Sep-2022 11:06                2544
book.yaconf.php                                    30-Sep-2022 11:06                2092
book.yaf.php                                       30-Sep-2022 11:06               34604
book.yaml.php                                      30-Sep-2022 11:06                2719
book.yar.php                                       30-Sep-2022 11:06                3631
book.yaz.php                                       30-Sep-2022 11:06                4303
book.zip.php                                       30-Sep-2022 11:06               10588
book.zlib.php                                      30-Sep-2022 11:06                5146
book.zmq.php                                       30-Sep-2022 11:06                5449
book.zookeeper.php                                 30-Sep-2022 11:06                6602
bzip2.configuration.php                            30-Sep-2022 11:06                1224
bzip2.constants.php                                30-Sep-2022 11:06                1120
bzip2.examples.php                                 30-Sep-2022 11:06                4350
bzip2.installation.php                             30-Sep-2022 11:06                1327
bzip2.requirements.php                             30-Sep-2022 11:06                1347
bzip2.resources.php                                30-Sep-2022 11:06                1220
bzip2.setup.php                                    30-Sep-2022 11:06                1558
cachingiterator.construct.php                      30-Sep-2022 11:06                2748
cachingiterator.count.php                          30-Sep-2022 11:06                2425
cachingiterator.current.php                        30-Sep-2022 11:06                2847
cachingiterator.getcache.php                       30-Sep-2022 11:06                5627
cachingiterator.getflags.php                       30-Sep-2022 11:06                2437
cachingiterator.getinneriterator.php               30-Sep-2022 11:06                2576
cachingiterator.hasnext.php                        30-Sep-2022 11:06                2467
cachingiterator.key.php                            30-Sep-2022 11:06                2216
cachingiterator.next.php                           30-Sep-2022 11:06                2384
cachingiterator.offsetexists.php                   30-Sep-2022 11:06                2722
cachingiterator.offsetget.php                      30-Sep-2022 11:06                2673
cachingiterator.offsetset.php                      30-Sep-2022 11:06                3030
cachingiterator.offsetunset.php                    30-Sep-2022 11:06                2658
cachingiterator.rewind.php                         30-Sep-2022 11:06                2400
cachingiterator.setflags.php                       30-Sep-2022 11:06                2692
cachingiterator.tostring.php                       30-Sep-2022 11:06                2495
cachingiterator.valid.php                          30-Sep-2022 11:06                2498
calendar.configuration.php                         30-Sep-2022 11:06                1245
calendar.constants.php                             30-Sep-2022 11:06               10548
calendar.installation.php                          30-Sep-2022 11:06                1439
calendar.requirements.php                          30-Sep-2022 11:06                1205
calendar.resources.php                             30-Sep-2022 11:06                1188
calendar.setup.php                                 30-Sep-2022 11:06                1595
callbackfilteriterator.accept.php                  30-Sep-2022 11:06                3312
callbackfilteriterator.construct.php               30-Sep-2022 11:06                3837
cc.license.php                                     30-Sep-2022 11:06               21037
changelog.misc.php                                 30-Sep-2022 11:06                3737
changelog.mysql.php                                30-Sep-2022 11:06                2468
changelog.mysql_xdevapi.php                        30-Sep-2022 11:06                2280
changelog.mysqli.php                               30-Sep-2022 11:06                3488
changelog.strings.php                              30-Sep-2022 11:06               12667
class.addressinfo.php                              30-Sep-2022 11:06                1765
class.apcuiterator.php                             30-Sep-2022 11:06                6527
class.appenditerator.php                           30-Sep-2022 11:06                8101
class.argumentcounterror.php                       30-Sep-2022 11:06                6630
class.arithmeticerror.php                          30-Sep-2022 11:06                6873
class.arrayaccess.php                              30-Sep-2022 11:06               13146
class.arrayiterator.php                            30-Sep-2022 11:06               15508
class.arrayobject.php                              30-Sep-2022 11:06               14944
class.assertionerror.php                           30-Sep-2022 11:06                6641
class.backedenum.php                               30-Sep-2022 11:06                4041
class.badfunctioncallexception.php                 30-Sep-2022 11:06                6778
class.badmethodcallexception.php                   30-Sep-2022 11:06                6797
class.cachingiterator.php                          30-Sep-2022 11:06               16133
class.callbackfilteriterator.php                   30-Sep-2022 11:06               12188
class.closure.php                                  30-Sep-2022 11:06                6312
class.collator.php                                 30-Sep-2022 11:06               24174
class.collectable.php                              30-Sep-2022 11:06                2417
class.com-exception.php                            30-Sep-2022 11:06                6556
class.com.php                                      30-Sep-2022 11:06               12905
class.commonmark-cql.php                           30-Sep-2022 11:06                7570
class.commonmark-interfaces-ivisitable.php         30-Sep-2022 11:06                2892
class.commonmark-interfaces-ivisitor.php           30-Sep-2022 11:06                4257
class.commonmark-node-blockquote.php               30-Sep-2022 11:06                8239
class.commonmark-node-bulletlist.php               30-Sep-2022 11:06               10127
class.commonmark-node-code.php                     30-Sep-2022 11:06                9113
class.commonmark-node-codeblock.php                30-Sep-2022 11:06               10322
class.commonmark-node-customblock.php              30-Sep-2022 11:06                8870
class.commonmark-node-custominline.php             30-Sep-2022 11:06                8850
class.commonmark-node-document.php                 30-Sep-2022 11:06                8191
class.commonmark-node-heading.php                  30-Sep-2022 11:06                9483
class.commonmark-node-htmlblock.php                30-Sep-2022 11:06                9171
class.commonmark-node-htmlinline.php               30-Sep-2022 11:06                9147
class.commonmark-node-image.php                    30-Sep-2022 11:06               10207
class.commonmark-node-item.php                     30-Sep-2022 11:06                8206
class.commonmark-node-linebreak.php                30-Sep-2022 11:06                8220
class.commonmark-node-link.php                     30-Sep-2022 11:06               10200
class.commonmark-node-orderedlist.php              30-Sep-2022 11:06               10861
class.commonmark-node-paragraph.php                30-Sep-2022 11:06                8245
class.commonmark-node-softbreak.php                30-Sep-2022 11:06                8238
class.commonmark-node-text-emphasis.php            30-Sep-2022 11:06                8267
class.commonmark-node-text-strong.php              30-Sep-2022 11:06                8256
class.commonmark-node-text.php                     30-Sep-2022 11:06                9517
class.commonmark-node-thematicbreak.php            30-Sep-2022 11:06                8267
class.commonmark-node.php                          30-Sep-2022 11:06                9163
class.commonmark-parser.php                        30-Sep-2022 11:06                3627
class.compersisthelper.php                         30-Sep-2022 11:06                6534
class.compileerror.php                             30-Sep-2022 11:06                6560
class.componere-abstract-definition.php            30-Sep-2022 11:06                4601
class.componere-definition.php                     30-Sep-2022 11:06                9386
class.componere-method.php                         30-Sep-2022 11:06                4361
class.componere-patch.php                          30-Sep-2022 11:06                7772
class.componere-value.php                          30-Sep-2022 11:06                5225
class.countable.php                                30-Sep-2022 11:06                2527
class.curlfile.php                                 30-Sep-2022 11:06                7524
class.curlhandle.php                               30-Sep-2022 11:06                1787
class.curlmultihandle.php                          30-Sep-2022 11:06                1826
class.curlsharehandle.php                          30-Sep-2022 11:06                1822
class.curlstringfile.php                           30-Sep-2022 11:06                5250
class.dateinterval.php                             30-Sep-2022 11:06               13339
class.dateperiod.php                               30-Sep-2022 11:06               13316
class.datetime.php                                 30-Sep-2022 11:06               20879
class.datetimeimmutable.php                        30-Sep-2022 11:06               20561
class.datetimeinterface.php                        30-Sep-2022 11:06               16959
class.datetimezone.php                             30-Sep-2022 11:06               12996
class.deflatecontext.php                           30-Sep-2022 11:06                1830
class.directory.php                                30-Sep-2022 11:06                5407
class.directoryiterator.php                        30-Sep-2022 11:06               23352
class.divisionbyzeroerror.php                      30-Sep-2022 11:06                6618
class.domainexception.php                          30-Sep-2022 11:06                6710
class.domattr.php                                  30-Sep-2022 11:06               21391
class.domcdatasection.php                          30-Sep-2022 11:06               22906
class.domcharacterdata.php                         30-Sep-2022 11:06               24052
class.domchildnode.php                             30-Sep-2022 11:06                3954
class.domcomment.php                               30-Sep-2022 11:06               21852
class.domdocument.php                              30-Sep-2022 11:06               54321
class.domdocumentfragment.php                      30-Sep-2022 11:06               20962
class.domdocumenttype.php                          30-Sep-2022 11:06               21077
class.domelement.php                               30-Sep-2022 11:06               36030
class.domentity.php                                30-Sep-2022 11:06               21405
class.domentityreference.php                       30-Sep-2022 11:06               17468
class.domexception.php                             30-Sep-2022 11:06                7495
class.domimplementation.php                        30-Sep-2022 11:06                5355
class.domnamednodemap.php                          30-Sep-2022 11:06                6491
class.domnode.php                                  30-Sep-2022 11:06               25250
class.domnodelist.php                              30-Sep-2022 11:06                5336
class.domnotation.php                              30-Sep-2022 11:06               17690
class.domparentnode.php                            30-Sep-2022 11:06                3044
class.domprocessinginstruction.php                 30-Sep-2022 11:06               18813
class.domtext.php                                  30-Sep-2022 11:06               24517
class.domxpath.php                                 30-Sep-2022 11:06                7695
class.dotnet.php                                   30-Sep-2022 11:06                6807
class.ds-collection.php                            30-Sep-2022 11:06                5105
class.ds-deque.php                                 30-Sep-2022 11:06               21425
class.ds-hashable.php                              30-Sep-2022 11:06                4070
class.ds-map.php                                   30-Sep-2022 11:06               22629
class.ds-pair.php                                  30-Sep-2022 11:06                4471
class.ds-priorityqueue.php                         30-Sep-2022 11:06                7928
class.ds-queue.php                                 30-Sep-2022 11:06                7484
class.ds-sequence.php                              30-Sep-2022 11:06               19156
class.ds-set.php                                   30-Sep-2022 11:06               18009
class.ds-stack.php                                 30-Sep-2022 11:06                6915
class.ds-vector.php                                30-Sep-2022 11:06               20992
class.emptyiterator.php                            30-Sep-2022 11:06                3938
class.enchantbroker.php                            30-Sep-2022 11:06                1842
class.enchantdictionary.php                        30-Sep-2022 11:06                1832
class.error.php                                    30-Sep-2022 11:06                9924
class.errorexception.php                           30-Sep-2022 11:06               13026
class.ev.php                                       30-Sep-2022 11:06               37653
class.evcheck.php                                  30-Sep-2022 11:06               10078
class.evchild.php                                  30-Sep-2022 11:06               11532
class.evembed.php                                  30-Sep-2022 11:06                9249
class.event.php                                    30-Sep-2022 11:06               17116
class.eventbase.php                                30-Sep-2022 11:06               13336
class.eventbuffer.php                              30-Sep-2022 11:06               20250
class.eventbufferevent.php                         30-Sep-2022 11:06               33483
class.eventconfig.php                              30-Sep-2022 11:06                6840
class.eventdnsbase.php                             30-Sep-2022 11:06               10181
class.eventhttp.php                                30-Sep-2022 11:06                8495
class.eventhttpconnection.php                      30-Sep-2022 11:06                9467
class.eventhttprequest.php                         30-Sep-2022 11:06               19864
class.eventlistener.php                            30-Sep-2022 11:06               11617
class.eventsslcontext.php                          30-Sep-2022 11:06               16463
class.eventutil.php                                30-Sep-2022 11:06               22340
class.evfork.php                                   30-Sep-2022 11:06                8223
class.evidle.php                                   30-Sep-2022 11:06                9255
class.evio.php                                     30-Sep-2022 11:06               11933
class.evloop.php                                   30-Sep-2022 11:06               29231
class.evperiodic.php                               30-Sep-2022 11:06               13913
class.evprepare.php                                30-Sep-2022 11:06               10226
class.evsignal.php                                 30-Sep-2022 11:06               10956
class.evstat.php                                   30-Sep-2022 11:06               13345
class.evtimer.php                                  30-Sep-2022 11:06               13324
class.evwatcher.php                                30-Sep-2022 11:06                9204
class.exception.php                                30-Sep-2022 11:06               10163
class.fannconnection.php                           30-Sep-2022 11:06                6098
class.ffi-cdata.php                                30-Sep-2022 11:06                5469
class.ffi-ctype.php                                30-Sep-2022 11:06                7853
class.ffi-exception.php                            30-Sep-2022 11:06                6400
class.ffi-parserexception.php                      30-Sep-2022 11:06                6456
class.ffi.php                                      30-Sep-2022 11:06               17750
class.fiber.php                                    30-Sep-2022 11:06                7645
class.fibererror.php                               30-Sep-2022 11:06                7306
class.filesystemiterator.php                       30-Sep-2022 11:06               29999
class.filteriterator.php                           30-Sep-2022 11:06                7618
class.finfo.php                                    30-Sep-2022 11:06                5064
class.ftp-connection.php                           30-Sep-2022 11:06                1814
class.gdfont.php                                   30-Sep-2022 11:06                1729
class.gdimage.php                                  30-Sep-2022 11:06                1725
class.gearmanclient.php                            30-Sep-2022 11:06               29671
class.gearmanexception.php                         30-Sep-2022 11:06                6628
class.gearmanjob.php                               30-Sep-2022 11:06                9852
class.gearmantask.php                              30-Sep-2022 11:06                8167
class.gearmanworker.php                            30-Sep-2022 11:06               11349
class.gender.php                                   30-Sep-2022 11:06               33019
class.generator.php                                30-Sep-2022 11:06                6707
class.globiterator.php                             30-Sep-2022 11:06               26163
class.gmagick.php                                  30-Sep-2022 11:06               75802
class.gmagickdraw.php                              30-Sep-2022 11:06               21468
class.gmagickpixel.php                             30-Sep-2022 11:06                5290
class.gmp.php                                      30-Sep-2022 11:06                3262
class.hashcontext.php                              30-Sep-2022 11:06                3227
class.hrtime-performancecounter.php                30-Sep-2022 11:06                3532
class.hrtime-stopwatch.php                         30-Sep-2022 11:06                6289
class.hrtime-unit.php                              30-Sep-2022 11:06                3863
class.imagick.php                                  30-Sep-2022 11:06              240133
class.imagickdraw.php                              30-Sep-2022 11:06               66343
class.imagickkernel.php                            30-Sep-2022 11:06                5638
class.imagickpixel.php                             30-Sep-2022 11:06               11209
class.imagickpixeliterator.php                     30-Sep-2022 11:06                8509
class.imap-connection.php                          30-Sep-2022 11:06                1817
class.infiniteiterator.php                         30-Sep-2022 11:06                5242
class.inflatecontext.php                           30-Sep-2022 11:06                1821
class.internaliterator.php                         30-Sep-2022 11:06                4788
class.intlbreakiterator.php                        30-Sep-2022 11:06               25908
class.intlcalendar.php                             30-Sep-2022 11:06               57662
class.intlchar.php                                 30-Sep-2022 11:06              340834
class.intlcodepointbreakiterator.php               30-Sep-2022 11:06               18398
class.intldateformatter.php                        30-Sep-2022 11:06               23270
class.intldatepatterngenerator.php                 30-Sep-2022 11:06                4126
class.intlexception.php                            30-Sep-2022 11:06                6803
class.intlgregoriancalendar.php                    30-Sep-2022 11:06               38870
class.intliterator.php                             30-Sep-2022 11:06                5079
class.intlpartsiterator.php                        30-Sep-2022 11:06                6742
class.intlrulebasedbreakiterator.php               30-Sep-2022 11:06               20873
class.intltimezone.php                             30-Sep-2022 11:06               18975
class.invalidargumentexception.php                 30-Sep-2022 11:06                6725
class.iterator.php                                 30-Sep-2022 11:06               12745
class.iteratoraggregate.php                        30-Sep-2022 11:06                6552
class.iteratoriterator.php                         30-Sep-2022 11:06                6126
class.jsonexception.php                            30-Sep-2022 11:06                7025
class.jsonserializable.php                         30-Sep-2022 11:06                2872
class.ldap-connection.php                          30-Sep-2022 11:06                1837
class.ldap-result-entry.php                        30-Sep-2022 11:06                1852
class.ldap-result.php                              30-Sep-2022 11:06                1829
class.lengthexception.php                          30-Sep-2022 11:06                6655
class.libxmlerror.php                              30-Sep-2022 11:06                5134
class.limititerator.php                            30-Sep-2022 11:06               11706
class.locale.php                                   30-Sep-2022 11:06               20672
class.logicexception.php                           30-Sep-2022 11:06                6692
class.lua.php                                      30-Sep-2022 11:06                7178
class.luaclosure.php                               30-Sep-2022 11:06                2630
class.luasandbox.php                               30-Sep-2022 11:06               12417
class.luasandboxerror.php                          30-Sep-2022 11:06                8669
class.luasandboxerrorerror.php                     30-Sep-2022 11:06                6705
class.luasandboxfatalerror.php                     30-Sep-2022 11:06                6827
class.luasandboxfunction.php                       30-Sep-2022 11:06                3636
class.luasandboxmemoryerror.php                    30-Sep-2022 11:06                7031
class.luasandboxruntimeerror.php                   30-Sep-2022 11:06                6847
class.luasandboxsyntaxerror.php                    30-Sep-2022 11:06                6709
class.luasandboxtimeouterror.php                   30-Sep-2022 11:06                7015
class.memcache.php                                 30-Sep-2022 11:06               15415
class.memcached.php                                30-Sep-2022 11:06               35719
class.memcachedexception.php                       30-Sep-2022 11:06                6588
class.messageformatter.php                         30-Sep-2022 11:06               10706
class.mongodb-bson-binary.php                      30-Sep-2022 11:06               13711
class.mongodb-bson-binaryinterface.php             30-Sep-2022 11:06                4481
class.mongodb-bson-dbpointer.php                   30-Sep-2022 11:06                5822
class.mongodb-bson-decimal128.php                  30-Sep-2022 11:06                7486
class.mongodb-bson-decimal128interface.php         30-Sep-2022 11:06                3726
class.mongodb-bson-int64.php                       30-Sep-2022 11:06                6551
class.mongodb-bson-javascript.php                  30-Sep-2022 11:06                8091
class.mongodb-bson-javascriptinterface.php         30-Sep-2022 11:06                4653
class.mongodb-bson-maxkey.php                      30-Sep-2022 11:06                5711
class.mongodb-bson-maxkeyinterface.php             30-Sep-2022 11:06                2150
class.mongodb-bson-minkey.php                      30-Sep-2022 11:06                5702
class.mongodb-bson-minkeyinterface.php             30-Sep-2022 11:06                2131
class.mongodb-bson-objectid.php                    30-Sep-2022 11:06                8814
class.mongodb-bson-objectidinterface.php           30-Sep-2022 11:06                4158
class.mongodb-bson-persistable.php                 30-Sep-2022 11:06                4521
class.mongodb-bson-regex.php                       30-Sep-2022 11:06                7743
class.mongodb-bson-regexinterface.php              30-Sep-2022 11:06                4498
class.mongodb-bson-serializable.php                30-Sep-2022 11:06                3769
class.mongodb-bson-symbol.php                      30-Sep-2022 11:06                5710
class.mongodb-bson-timestamp.php                   30-Sep-2022 11:06                7998
class.mongodb-bson-timestampinterface.php          30-Sep-2022 11:06                4660
class.mongodb-bson-type.php                        30-Sep-2022 11:06                1977
class.mongodb-bson-undefined.php                   30-Sep-2022 11:06                5798
class.mongodb-bson-unserializable.php              30-Sep-2022 11:06                3834
class.mongodb-bson-utcdatetime.php                 30-Sep-2022 11:06                7549
class.mongodb-bson-utcdatetimeinterface.php        30-Sep-2022 11:06                4289
class.mongodb-driver-bulkwrite.php                 30-Sep-2022 11:06               25949
class.mongodb-driver-clientencryption.php          30-Sep-2022 11:06               11815
class.mongodb-driver-command.php                   30-Sep-2022 11:06               15983
class.mongodb-driver-cursor.php                    30-Sep-2022 11:06               27613
class.mongodb-driver-cursorid.php                  30-Sep-2022 11:06                5300
class.mongodb-driver-cursorinterface.php           30-Sep-2022 11:06                5937
class.mongodb-driver-exception-authenticationex..> 30-Sep-2022 11:06                8082
class.mongodb-driver-exception-bulkwriteexcepti..> 30-Sep-2022 11:06                8936
class.mongodb-driver-exception-commandexception..> 30-Sep-2022 11:06                9729
class.mongodb-driver-exception-connectionexcept..> 30-Sep-2022 11:06                8151
class.mongodb-driver-exception-connectiontimeou..> 30-Sep-2022 11:06                8539
class.mongodb-driver-exception-encryptionexcept..> 30-Sep-2022 11:06                8085
class.mongodb-driver-exception-exception.php       30-Sep-2022 11:06                2145
class.mongodb-driver-exception-executiontimeout..> 30-Sep-2022 11:06                9190
class.mongodb-driver-exception-invalidargumente..> 30-Sep-2022 11:06                7288
class.mongodb-driver-exception-logicexception.php  30-Sep-2022 11:06                7172
class.mongodb-driver-exception-runtimeexception..> 30-Sep-2022 11:06               10598
class.mongodb-driver-exception-serverexception.php 30-Sep-2022 11:06                8162
class.mongodb-driver-exception-sslconnectionexc..> 30-Sep-2022 11:06                8429
class.mongodb-driver-exception-unexpectedvaluee..> 30-Sep-2022 11:06                7305
class.mongodb-driver-exception-writeexception.php  30-Sep-2022 11:06               11116
class.mongodb-driver-manager.php                   30-Sep-2022 11:06               19689
class.mongodb-driver-monitoring-commandfailedev..> 30-Sep-2022 11:06                7543
class.mongodb-driver-monitoring-commandstartede..> 30-Sep-2022 11:06                7045
class.mongodb-driver-monitoring-commandsubscrib..> 30-Sep-2022 11:06                6148
class.mongodb-driver-monitoring-commandsucceede..> 30-Sep-2022 11:06                7125
class.mongodb-driver-monitoring-sdamsubscriber.php 30-Sep-2022 11:06               11382
class.mongodb-driver-monitoring-serverchangedev..> 30-Sep-2022 11:06                5587
class.mongodb-driver-monitoring-serverclosedeve..> 30-Sep-2022 11:06                4234
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:06                5468
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:06                4353
class.mongodb-driver-monitoring-serverheartbeat..> 30-Sep-2022 11:06                5480
class.mongodb-driver-monitoring-serveropeningev..> 30-Sep-2022 11:06                4254
class.mongodb-driver-monitoring-subscriber.php     30-Sep-2022 11:06                2592
class.mongodb-driver-monitoring-topologychanged..> 30-Sep-2022 11:06                4700
class.mongodb-driver-monitoring-topologyclosede..> 30-Sep-2022 11:06                3311
class.mongodb-driver-monitoring-topologyopening..> 30-Sep-2022 11:06                3325
class.mongodb-driver-query.php                     30-Sep-2022 11:06                3127
class.mongodb-driver-readconcern.php               30-Sep-2022 11:06               16011
class.mongodb-driver-readpreference.php            30-Sep-2022 11:06               18168
class.mongodb-driver-server.php                    30-Sep-2022 11:06               23575
class.mongodb-driver-serverapi.php                 30-Sep-2022 11:06               15180
class.mongodb-driver-serverdescription.php         30-Sep-2022 11:06               14705
class.mongodb-driver-session.php                   30-Sep-2022 11:06               13724
class.mongodb-driver-topologydescription.php       30-Sep-2022 11:06               10209
class.mongodb-driver-writeconcern.php              30-Sep-2022 11:06                9103
class.mongodb-driver-writeconcernerror.php         30-Sep-2022 11:06                4109
class.mongodb-driver-writeerror.php                30-Sep-2022 11:06                4375
class.mongodb-driver-writeresult.php               30-Sep-2022 11:06                7844
class.multipleiterator.php                         30-Sep-2022 11:06               10233
class.mysql-xdevapi-baseresult.php                 30-Sep-2022 11:06                2892
class.mysql-xdevapi-client.php                     30-Sep-2022 11:06                3031
class.mysql-xdevapi-collection.php                 30-Sep-2022 11:06                9949
class.mysql-xdevapi-collectionadd.php              30-Sep-2022 11:06                2909
class.mysql-xdevapi-collectionfind.php             30-Sep-2022 11:06                8267
class.mysql-xdevapi-collectionmodify.php           30-Sep-2022 11:06                9424
class.mysql-xdevapi-collectionremove.php           30-Sep-2022 11:06                5007
class.mysql-xdevapi-columnresult.php               30-Sep-2022 11:06                6023
class.mysql-xdevapi-crudoperationbindable.php      30-Sep-2022 11:06                2887
class.mysql-xdevapi-crudoperationlimitable.php     30-Sep-2022 11:06                2893
class.mysql-xdevapi-crudoperationskippable.php     30-Sep-2022 11:06                2904
class.mysql-xdevapi-crudoperationsortable.php      30-Sep-2022 11:06                2878
class.mysql-xdevapi-databaseobject.php             30-Sep-2022 11:06                3390
class.mysql-xdevapi-docresult.php                  30-Sep-2022 11:06                3779
class.mysql-xdevapi-exception.php                  30-Sep-2022 11:06                2161
class.mysql-xdevapi-executable.php                 30-Sep-2022 11:06                2587
class.mysql-xdevapi-executionstatus.php            30-Sep-2022 11:06                4847
class.mysql-xdevapi-expression.php                 30-Sep-2022 11:06                3168
class.mysql-xdevapi-result.php                     30-Sep-2022 11:06                4105
class.mysql-xdevapi-rowresult.php                  30-Sep-2022 11:06                4702
class.mysql-xdevapi-schema.php                     30-Sep-2022 11:06                7176
class.mysql-xdevapi-schemaobject.php               30-Sep-2022 11:06                2772
class.mysql-xdevapi-session.php                    30-Sep-2022 11:06                8501
class.mysql-xdevapi-sqlstatement.php               30-Sep-2022 11:06                6223
class.mysql-xdevapi-sqlstatementresult.php         30-Sep-2022 11:06                6649
class.mysql-xdevapi-statement.php                  30-Sep-2022 11:06                4645
class.mysql-xdevapi-table.php                      30-Sep-2022 11:06                7329
class.mysql-xdevapi-tabledelete.php                30-Sep-2022 11:06                4912
class.mysql-xdevapi-tableinsert.php                30-Sep-2022 11:06                3411
class.mysql-xdevapi-tableselect.php                30-Sep-2022 11:06                8006
class.mysql-xdevapi-tableupdate.php                30-Sep-2022 11:06                5869
class.mysql-xdevapi-warning.php                    30-Sep-2022 11:06                3731
class.mysqli-driver.php                            30-Sep-2022 11:06                7816
class.mysqli-result.php                            30-Sep-2022 11:06               13609
class.mysqli-sql-exception.php                     30-Sep-2022 11:06                8134
class.mysqli-stmt.php                              30-Sep-2022 11:06               16690
class.mysqli-warning.php                           30-Sep-2022 11:06                4235
class.mysqli.php                                   30-Sep-2022 11:06               33259
class.norewinditerator.php                         30-Sep-2022 11:06                7112
class.normalizer.php                               30-Sep-2022 11:06                8239
class.numberformatter.php                          30-Sep-2022 11:06               39391
class.oauth.php                                    30-Sep-2022 11:06               17216
class.oauthexception.php                           30-Sep-2022 11:06                7646
class.oauthprovider.php                            30-Sep-2022 11:06               11570
class.ocicollection.php                            30-Sep-2022 11:06                6242
class.ocilob.php                                   30-Sep-2022 11:06               12475
class.opensslasymmetrickey.php                     30-Sep-2022 11:06                1905
class.opensslcertificate.php                       30-Sep-2022 11:06                1909
class.opensslcertificatesigningrequest.php         30-Sep-2022 11:06                1996
class.outeriterator.php                            30-Sep-2022 11:06                4312
class.outofboundsexception.php                     30-Sep-2022 11:06                6741
class.outofrangeexception.php                      30-Sep-2022 11:06                6743
class.overflowexception.php                        30-Sep-2022 11:06                6662
class.parallel-channel.php                         30-Sep-2022 11:06                8002
class.parallel-events-event-type.php               30-Sep-2022 11:06                3322
class.parallel-events-event.php                    30-Sep-2022 11:06                3297
class.parallel-events-input.php                    30-Sep-2022 11:06                4559
class.parallel-events.php                          30-Sep-2022 11:06                6673
class.parallel-future.php                          30-Sep-2022 11:06                8243
class.parallel-runtime.php                         30-Sep-2022 11:06                6149
class.parallel-sync.php                            30-Sep-2022 11:06                5225
class.parentiterator.php                           30-Sep-2022 11:06                9536
class.parle-errorinfo.php                          30-Sep-2022 11:06                3697
class.parle-lexer.php                              30-Sep-2022 11:06               11780
class.parle-lexerexception.php                     30-Sep-2022 11:06                6842
class.parle-parser.php                             30-Sep-2022 11:06               14719
class.parle-parserexception.php                    30-Sep-2022 11:06                6824
class.parle-rlexer.php                             30-Sep-2022 11:06               13421
class.parle-rparser.php                            30-Sep-2022 11:06               14870
class.parle-stack.php                              30-Sep-2022 11:06                4656
class.parle-token.php                              30-Sep-2022 11:06                4422
class.parseerror.php                               30-Sep-2022 11:06                7079
class.pdo.php                                      30-Sep-2022 11:06               13006
class.pdoexception.php                             30-Sep-2022 11:06                8464
class.pdostatement.php                             30-Sep-2022 11:06               19465
class.pgsql-connection.php                         30-Sep-2022 11:06                1850
class.pgsql-lob.php                                30-Sep-2022 11:06                1792
class.pgsql-result.php                             30-Sep-2022 11:06                1824
class.phar.php                                     30-Sep-2022 11:06               60253
class.phardata.php                                 30-Sep-2022 11:06               44395
class.pharexception.php                            30-Sep-2022 11:06                6632
class.pharfileinfo.php                             30-Sep-2022 11:06               18282
class.php-user-filter.php                          30-Sep-2022 11:06                6026
class.phptoken.php                                 30-Sep-2022 11:06                7723
class.pool.php                                     30-Sep-2022 11:06                7168
class.pspell-config.php                            30-Sep-2022 11:06                1826
class.pspell-dictionary.php                        30-Sep-2022 11:06                1863
class.quickhashinthash.php                         30-Sep-2022 11:06               12928
class.quickhashintset.php                          30-Sep-2022 11:06               11125
class.quickhashintstringhash.php                   30-Sep-2022 11:06               13742
class.quickhashstringinthash.php                   30-Sep-2022 11:06               11857
class.rangeexception.php                           30-Sep-2022 11:06                6871
class.rararchive.php                               30-Sep-2022 11:06                6949
class.rarentry.php                                 30-Sep-2022 11:06               41848
class.rarexception.php                             30-Sep-2022 11:06                7603
class.recursivearrayiterator.php                   30-Sep-2022 11:06               13694
class.recursivecachingiterator.php                 30-Sep-2022 11:06               13217
class.recursivecallbackfilteriterator.php          30-Sep-2022 11:06               14110
class.recursivedirectoryiterator.php               30-Sep-2022 11:06               29174
class.recursivefilteriterator.php                  30-Sep-2022 11:06                8361
class.recursiveiterator.php                        30-Sep-2022 11:06                4792
class.recursiveiteratoriterator.php                30-Sep-2022 11:06               13280
class.recursiveregexiterator.php                   30-Sep-2022 11:06               13245
class.recursivetreeiterator.php                    30-Sep-2022 11:06               22614
class.reflection.php                               30-Sep-2022 11:06                3190
class.reflectionattribute.php                      30-Sep-2022 11:06                6024
class.reflectionclass.php                          30-Sep-2022 11:06               31055
class.reflectionclassconstant.php                  30-Sep-2022 11:06               13362
class.reflectionenum.php                           30-Sep-2022 11:06               25848
class.reflectionenumbackedcase.php                 30-Sep-2022 11:06               11113
class.reflectionenumunitcase.php                   30-Sep-2022 11:06               10852
class.reflectionexception.php                      30-Sep-2022 11:06                6612
class.reflectionextension.php                      30-Sep-2022 11:06                9061
class.reflectionfiber.php                          30-Sep-2022 11:06                4766
class.reflectionfunction.php                       30-Sep-2022 11:06               17752
class.reflectionfunctionabstract.php               30-Sep-2022 11:06               17257
class.reflectiongenerator.php                      30-Sep-2022 11:06                6032
class.reflectionintersectiontype.php               30-Sep-2022 11:06                3333
class.reflectionmethod.php                         30-Sep-2022 11:06               27317
class.reflectionnamedtype.php                      30-Sep-2022 11:06                3588
class.reflectionobject.php                         30-Sep-2022 11:06               23480
class.reflectionparameter.php                      30-Sep-2022 11:06               14214
class.reflectionproperty.php                       30-Sep-2022 11:06               18868
class.reflectionreference.php                      30-Sep-2022 11:06                3882
class.reflectiontype.php                           30-Sep-2022 11:06                4470
class.reflectionuniontype.php                      30-Sep-2022 11:06                3219
class.reflectionzendextension.php                  30-Sep-2022 11:06                6724
class.reflector.php                                30-Sep-2022 11:06                3867
class.regexiterator.php                            30-Sep-2022 11:06               15446
class.resourcebundle.php                           30-Sep-2022 11:06                9370
class.rrdcreator.php                               30-Sep-2022 11:06                4034
class.rrdgraph.php                                 30-Sep-2022 11:06                3604
class.rrdupdater.php                               30-Sep-2022 11:06                3012
class.runtimeexception.php                         30-Sep-2022 11:06                6649
class.seaslog.php                                  30-Sep-2022 11:06               17891
class.seekableiterator.php                         30-Sep-2022 11:06               12744
class.serializable.php                             30-Sep-2022 11:06                8612
class.sessionhandler.php                           30-Sep-2022 11:06               27469
class.sessionhandlerinterface.php                  30-Sep-2022 11:06               16854
class.sessionidinterface.php                       30-Sep-2022 11:06                3269
class.sessionupdatetimestamphandlerinterface.php   30-Sep-2022 11:06                4296
class.shmop.php                                    30-Sep-2022 11:06                1724
class.simplexmlelement.php                         30-Sep-2022 11:06               12955
class.simplexmliterator.php                        30-Sep-2022 11:06               12658
class.snmp.php                                     30-Sep-2022 11:06               23838
class.snmpexception.php                            30-Sep-2022 11:06                7576
class.soapclient.php                               30-Sep-2022 11:06               29851
class.soapfault.php                                30-Sep-2022 11:06               12750
class.soapheader.php                               30-Sep-2022 11:06                5552
class.soapparam.php                                30-Sep-2022 11:06                3739
class.soapserver.php                               30-Sep-2022 11:06                9229
class.soapvar.php                                  30-Sep-2022 11:06                7067
class.socket.php                                   30-Sep-2022 11:06                1788
class.sodiumexception.php                          30-Sep-2022 11:06                6580
class.solrclient.php                               30-Sep-2022 11:06               21492
class.solrclientexception.php                      30-Sep-2022 11:06                8509
class.solrcollapsefunction.php                     30-Sep-2022 11:06               10444
class.solrdismaxquery.php                          30-Sep-2022 11:06               95099
class.solrdocument.php                             30-Sep-2022 11:06               20256
class.solrdocumentfield.php                        30-Sep-2022 11:06                4502
class.solrexception.php                            30-Sep-2022 11:06                9046
class.solrgenericresponse.php                      30-Sep-2022 11:06               10990
class.solrillegalargumentexception.php             30-Sep-2022 11:06                8649
class.solrillegaloperationexception.php            30-Sep-2022 11:06                8689
class.solrinputdocument.php                        30-Sep-2022 11:06               16778
class.solrmissingmandatoryparameterexception.php   30-Sep-2022 11:06                7840
class.solrmodifiableparams.php                     30-Sep-2022 11:06                7958
class.solrobject.php                               30-Sep-2022 11:06                5390
class.solrparams.php                               30-Sep-2022 11:06                8117
class.solrpingresponse.php                         30-Sep-2022 11:06               10373
class.solrquery.php                                30-Sep-2022 11:06              104307
class.solrqueryresponse.php                        30-Sep-2022 11:06               10918
class.solrresponse.php                             30-Sep-2022 11:06               13039
class.solrserverexception.php                      30-Sep-2022 11:06                8521
class.solrupdateresponse.php                       30-Sep-2022 11:06               10975
class.solrutils.php                                30-Sep-2022 11:06                4483
class.spldoublylinkedlist.php                      30-Sep-2022 11:06               16295
class.splfileinfo.php                              30-Sep-2022 11:06               15509
class.splfileobject.php                            30-Sep-2022 11:06               30411
class.splfixedarray.php                            30-Sep-2022 11:06               17198
class.splheap.php                                  30-Sep-2022 11:06                7589
class.splmaxheap.php                               30-Sep-2022 11:06                7002
class.splminheap.php                               30-Sep-2022 11:06                7012
class.splobjectstorage.php                         30-Sep-2022 11:06               20155
class.splobserver.php                              30-Sep-2022 11:06                2817
class.splpriorityqueue.php                         30-Sep-2022 11:06                9396
class.splqueue.php                                 30-Sep-2022 11:06               12313
class.splstack.php                                 30-Sep-2022 11:06               11343
class.splsubject.php                               30-Sep-2022 11:06                3636
class.spltempfileobject.php                        30-Sep-2022 11:06               25466
class.spoofchecker.php                             30-Sep-2022 11:06               13190
class.sqlite3.php                                  30-Sep-2022 11:06               15710
class.sqlite3result.php                            30-Sep-2022 11:06                5186
class.sqlite3stmt.php                              30-Sep-2022 11:06                7254
class.stomp.php                                    30-Sep-2022 11:06               16990
class.stompexception.php                           30-Sep-2022 11:06                5242
class.stompframe.php                               30-Sep-2022 11:06                4092
class.streamwrapper.php                            30-Sep-2022 11:06               17125
class.stringable.php                               30-Sep-2022 11:06                9065
class.svm.php                                      30-Sep-2022 11:06               15558
class.svmmodel.php                                 30-Sep-2022 11:06                6043
class.swoole-async.php                             30-Sep-2022 11:06                7057
class.swoole-atomic.php                            30-Sep-2022 11:06                4402
class.swoole-buffer.php                            30-Sep-2022 11:06                6514
class.swoole-channel.php                           30-Sep-2022 11:06                3719
class.swoole-client.php                            30-Sep-2022 11:06               14265
class.swoole-connection-iterator.php               30-Sep-2022 11:06                7042
class.swoole-coroutine.php                         30-Sep-2022 11:06               20040
class.swoole-event.php                             30-Sep-2022 11:06                6604
class.swoole-exception.php                         30-Sep-2022 11:06                4130
class.swoole-http-client.php                       30-Sep-2022 11:06               12903
class.swoole-http-request.php                      30-Sep-2022 11:06                2860
class.swoole-http-response.php                     30-Sep-2022 11:06                9468
class.swoole-http-server.php                       30-Sep-2022 11:06               21513
class.swoole-lock.php                              30-Sep-2022 11:06                4440
class.swoole-mmap.php                              30-Sep-2022 11:06                2848
class.swoole-mysql-exception.php                   30-Sep-2022 11:06                4171
class.swoole-mysql.php                             30-Sep-2022 11:06                5125
class.swoole-process.php                           30-Sep-2022 11:06               11864
class.swoole-redis-server.php                      30-Sep-2022 11:06               26087
class.swoole-serialize.php                         30-Sep-2022 11:06                3359
class.swoole-server.php                            30-Sep-2022 11:06               24764
class.swoole-table.php                             30-Sep-2022 11:06               10966
class.swoole-timer.php                             30-Sep-2022 11:06                4485
class.swoole-websocket-frame.php                   30-Sep-2022 11:06                1859
class.swoole-websocket-server.php                  30-Sep-2022 11:06                6991
class.syncevent.php                                30-Sep-2022 11:06                4292
class.syncmutex.php                                30-Sep-2022 11:06                3787
class.syncreaderwriter.php                         30-Sep-2022 11:06                4648
class.syncsemaphore.php                            30-Sep-2022 11:06                4104
class.syncsharedmemory.php                         30-Sep-2022 11:06                4947
class.sysvmessagequeue.php                         30-Sep-2022 11:06                1834
class.sysvsemaphore.php                            30-Sep-2022 11:06                1819
class.sysvsharedmemory.php                         30-Sep-2022 11:06                1822
class.thread.php                                   30-Sep-2022 11:06               10121
class.threaded.php                                 30-Sep-2022 11:06                8013
class.throwable.php                                30-Sep-2022 11:06                6844
class.tidy.php                                     30-Sep-2022 11:06               17364
class.tidynode.php                                 30-Sep-2022 11:06               10469
class.transliterator.php                           30-Sep-2022 11:06                8466
class.traversable.php                              30-Sep-2022 11:06                4000
class.typeerror.php                                30-Sep-2022 11:06                7658
class.uconverter.php                               30-Sep-2022 11:06               32293
class.ui-area.php                                  30-Sep-2022 11:06               11107
class.ui-control.php                               30-Sep-2022 11:06                5212
class.ui-controls-box.php                          30-Sep-2022 11:06                9131
class.ui-controls-button.php                       30-Sep-2022 11:06                6232
class.ui-controls-check.php                        30-Sep-2022 11:06                6958
class.ui-controls-colorbutton.php                  30-Sep-2022 11:06                6268
class.ui-controls-combo.php                        30-Sep-2022 11:06                6204
class.ui-controls-editablecombo.php                30-Sep-2022 11:06                6312
class.ui-controls-entry.php                        30-Sep-2022 11:06                8700
class.ui-controls-form.php                         30-Sep-2022 11:06                7324
class.ui-controls-grid.php                         30-Sep-2022 11:06               11292
class.ui-controls-group.php                        30-Sep-2022 11:06                7798
class.ui-controls-label.php                        30-Sep-2022 11:06                5983
class.ui-controls-multilineentry.php               30-Sep-2022 11:06                8983
class.ui-controls-picker.php                       30-Sep-2022 11:06                6866
class.ui-controls-progress.php                     30-Sep-2022 11:06                5548
class.ui-controls-radio.php                        30-Sep-2022 11:06                6183
class.ui-controls-separator.php                    30-Sep-2022 11:06                6484
class.ui-controls-slider.php                       30-Sep-2022 11:06                6515
class.ui-controls-spin.php                         30-Sep-2022 11:06                6385
class.ui-controls-tab.php                          30-Sep-2022 11:06                8249
class.ui-draw-brush-gradient.php                   30-Sep-2022 11:06                6326
class.ui-draw-brush-lineargradient.php             30-Sep-2022 11:06                5686
class.ui-draw-brush-radialgradient.php             30-Sep-2022 11:06                5814
class.ui-draw-brush.php                            30-Sep-2022 11:06                4182
class.ui-draw-color.php                            30-Sep-2022 11:06                7722
class.ui-draw-line-cap.php                         30-Sep-2022 11:06                2400
class.ui-draw-line-join.php                        30-Sep-2022 11:06                2360
class.ui-draw-matrix.php                           30-Sep-2022 11:06                5421
class.ui-draw-path.php                             30-Sep-2022 11:06                9451
class.ui-draw-pen.php                              30-Sep-2022 11:06                7929
class.ui-draw-stroke.php                           30-Sep-2022 11:06                6100
class.ui-draw-text-font-descriptor.php             30-Sep-2022 11:06                5374
class.ui-draw-text-font-italic.php                 30-Sep-2022 11:06                2590
class.ui-draw-text-font-stretch.php                30-Sep-2022 11:06                3989
class.ui-draw-text-font-weight.php                 30-Sep-2022 11:06                3968
class.ui-draw-text-font.php                        30-Sep-2022 11:06                4497
class.ui-draw-text-layout.php                      30-Sep-2022 11:06                4731
class.ui-exception-invalidargumentexception.php    30-Sep-2022 11:06                6858
class.ui-exception-runtimeexception.php            30-Sep-2022 11:06                6781
class.ui-executor.php                              30-Sep-2022 11:06                4832
class.ui-key.php                                   30-Sep-2022 11:06                9132
class.ui-menu.php                                  30-Sep-2022 11:06                5726
class.ui-menuitem.php                              30-Sep-2022 11:06                3558
class.ui-point.php                                 30-Sep-2022 11:06                5826
class.ui-size.php                                  30-Sep-2022 11:06                5922
class.ui-window.php                                30-Sep-2022 11:06               11806
class.underflowexception.php                       30-Sep-2022 11:06                6733
class.unexpectedvalueexception.php                 30-Sep-2022 11:06                6894
class.unhandledmatcherror.php                      30-Sep-2022 11:06                6624
class.unitenum.php                                 30-Sep-2022 11:06                2722
class.v8js.php                                     30-Sep-2022 11:06                7870
class.v8jsexception.php                            30-Sep-2022 11:06               10199
class.valueerror.php                               30-Sep-2022 11:06                6704
class.variant.php                                  30-Sep-2022 11:06                5759
class.varnishadmin.php                             30-Sep-2022 11:06                9886
class.varnishlog.php                               30-Sep-2022 11:06               28020
class.varnishstat.php                              30-Sep-2022 11:06                2809
class.volatile.php                                 30-Sep-2022 11:06               11572
class.vtiful-kernel-excel.php                      30-Sep-2022 11:06               10235
class.vtiful-kernel-format.php                     30-Sep-2022 11:06               13142
class.weakmap.php                                  30-Sep-2022 11:06                9773
class.weakreference.php                            30-Sep-2022 11:06                5505
class.win32serviceexception.php                    30-Sep-2022 11:06                6910
class.wkhtmltox-image-converter.php                30-Sep-2022 11:06                3781
class.wkhtmltox-pdf-converter.php                  30-Sep-2022 11:06                4141
class.wkhtmltox-pdf-object.php                     30-Sep-2022 11:06                2795
class.worker.php                                   30-Sep-2022 11:06                7644
class.xmldiff-base.php                             30-Sep-2022 11:06                4223
class.xmldiff-dom.php                              30-Sep-2022 11:06                5237
class.xmldiff-file.php                             30-Sep-2022 11:06                4853
class.xmldiff-memory.php                           30-Sep-2022 11:06                4885
class.xmlparser.php                                30-Sep-2022 11:06                1805
class.xmlreader.php                                30-Sep-2022 11:06               32702
class.xmlwriter.php                                30-Sep-2022 11:06               25323
class.xsltprocessor.php                            30-Sep-2022 11:06                9172
class.yac.php                                      30-Sep-2022 11:06                8367
class.yaconf.php                                   30-Sep-2022 11:06                3309
class.yaf-action-abstract.php                      30-Sep-2022 11:06               11562
class.yaf-application.php                          30-Sep-2022 11:06               12369
class.yaf-bootstrap-abstract.php                   30-Sep-2022 11:06                6169
class.yaf-config-abstract.php                      30-Sep-2022 11:06                5058
class.yaf-config-ini.php                           30-Sep-2022 11:06               16574
class.yaf-config-simple.php                        30-Sep-2022 11:06               12001
class.yaf-controller-abstract.php                  30-Sep-2022 11:06               18696
class.yaf-dispatcher.php                           30-Sep-2022 11:06               19357
class.yaf-exception-dispatchfailed.php             30-Sep-2022 11:06                2545
class.yaf-exception-loadfailed-action.php          30-Sep-2022 11:06                2616
class.yaf-exception-loadfailed-controller.php      30-Sep-2022 11:06                2641
class.yaf-exception-loadfailed-module.php          30-Sep-2022 11:06                2605
class.yaf-exception-loadfailed-view.php            30-Sep-2022 11:06                2545
class.yaf-exception-loadfailed.php                 30-Sep-2022 11:06                2519
class.yaf-exception-routerfailed.php               30-Sep-2022 11:06                2530
class.yaf-exception-startuperror.php               30-Sep-2022 11:06                2528
class.yaf-exception-typeerror.php                  30-Sep-2022 11:06                2499
class.yaf-exception.php                            30-Sep-2022 11:06                7537
class.yaf-loader.php                               30-Sep-2022 11:06               17995
class.yaf-plugin-abstract.php                      30-Sep-2022 11:06               18346
class.yaf-registry.php                             30-Sep-2022 11:06                5563
class.yaf-request-abstract.php                     30-Sep-2022 11:06               21249
class.yaf-request-http.php                         30-Sep-2022 11:06               20495
class.yaf-request-simple.php                       30-Sep-2022 11:06               19743
class.yaf-response-abstract.php                    30-Sep-2022 11:06               10510
class.yaf-route-interface.php                      30-Sep-2022 11:06                3424
class.yaf-route-map.php                            30-Sep-2022 11:06                6034
class.yaf-route-regex.php                          30-Sep-2022 11:06                7519
class.yaf-route-rewrite.php                        30-Sep-2022 11:06                6794
class.yaf-route-simple.php                         30-Sep-2022 11:06                6051
class.yaf-route-static.php                         30-Sep-2022 11:06                4659
class.yaf-route-supervar.php                       30-Sep-2022 11:06                4381
class.yaf-router.php                               30-Sep-2022 11:06               11721
class.yaf-session.php                              30-Sep-2022 11:06               11413
class.yaf-view-interface.php                       30-Sep-2022 11:06                5344
class.yaf-view-simple.php                          30-Sep-2022 11:06                9896
class.yar-client-exception.php                     30-Sep-2022 11:06                6014
class.yar-client.php                               30-Sep-2022 11:06                5470
class.yar-concurrent-client.php                    30-Sep-2022 11:06                6159
class.yar-server-exception.php                     30-Sep-2022 11:06                6474
class.yar-server.php                               30-Sep-2022 11:06                3297
class.ziparchive.php                               30-Sep-2022 11:06               39594
class.zmq.php                                      30-Sep-2022 11:06               33634
class.zmqcontext.php                               30-Sep-2022 11:06                5051
class.zmqdevice.php                                30-Sep-2022 11:06                6808
class.zmqpoll.php                                  30-Sep-2022 11:06                4676
class.zmqsocket.php                                30-Sep-2022 11:06                9975
class.zookeeper.php                                30-Sep-2022 11:06               46821
class.zookeeperauthenticationexception.php         30-Sep-2022 11:06                6788
class.zookeeperconfig.php                          30-Sep-2022 11:06                5392
class.zookeeperconnectionexception.php             30-Sep-2022 11:06                6783
class.zookeeperexception.php                       30-Sep-2022 11:06                6649
class.zookeepermarshallingexception.php            30-Sep-2022 11:06                6804
class.zookeepernonodeexception.php                 30-Sep-2022 11:06                6771
class.zookeeperoperationtimeoutexception.php       30-Sep-2022 11:06                6814
class.zookeepersessionexception.php                30-Sep-2022 11:06                6733
classobj.configuration.php                         30-Sep-2022 11:06                1245
classobj.constants.php                             30-Sep-2022 11:06                1151
classobj.examples.php                              30-Sep-2022 11:06               15262
classobj.installation.php                          30-Sep-2022 11:06                1229
classobj.requirements.php                          30-Sep-2022 11:06                1205
classobj.resources.php                             30-Sep-2022 11:06                1188
classobj.setup.php                                 30-Sep-2022 11:06                1581
closure.bind.php                                   30-Sep-2022 11:06                7727
closure.bindto.php                                 30-Sep-2022 11:06                9157
closure.call.php                                   30-Sep-2022 11:06                6583
closure.construct.php                              30-Sep-2022 11:06                2426
closure.fromcallable.php                           30-Sep-2022 11:06                3780
cmark.installation.php                             30-Sep-2022 11:06                1938
cmark.requirements.php                             30-Sep-2022 11:06                1273
cmark.setup.php                                    30-Sep-2022 11:06                1407
collator.asort.php                                 30-Sep-2022 11:06                9029
collator.compare.php                               30-Sep-2022 11:06               10612
collator.construct.php                             30-Sep-2022 11:06                5576
collator.create.php                                30-Sep-2022 11:06                5380
collator.getattribute.php                          30-Sep-2022 11:06                5876
collator.geterrorcode.php                          30-Sep-2022 11:06                5162
collator.geterrormessage.php                       30-Sep-2022 11:06                5224
collator.getlocale.php                             30-Sep-2022 11:06                6557
collator.getsortkey.php                            30-Sep-2022 11:06                6655
collator.getstrength.php                           30-Sep-2022 11:06                4811
collator.setattribute.php                          30-Sep-2022 11:06                6433
collator.setstrength.php                           30-Sep-2022 11:06               12821
collator.sort.php                                  30-Sep-2022 11:06                7734
collator.sortwithsortkeys.php                      30-Sep-2022 11:06                6310
collectable.isgarbage.php                          30-Sep-2022 11:06                2671
com.configuration.php                              30-Sep-2022 11:06                7703
com.constants.php                                  30-Sep-2022 11:06               18674
com.construct.php                                  30-Sep-2022 11:06                8703
com.error-handling.php                             30-Sep-2022 11:06                1557
com.examples.arrays.php                            30-Sep-2022 11:06                2054
com.examples.foreach.php                           30-Sep-2022 11:06                2962
com.examples.php                                   30-Sep-2022 11:06                1403
com.installation.php                               30-Sep-2022 11:06                1566
com.requirements.php                               30-Sep-2022 11:06                1233
com.resources.php                                  30-Sep-2022 11:06                1153
com.setup.php                                      30-Sep-2022 11:06                1531
commonmark-cql.construct.php                       30-Sep-2022 11:06                2127
commonmark-cql.invoke.php                          30-Sep-2022 11:06                3745
commonmark-interfaces-ivisitable.accept.php        30-Sep-2022 11:06                3108
commonmark-interfaces-ivisitor.enter.php           30-Sep-2022 11:06                4108
commonmark-interfaces-ivisitor.leave.php           30-Sep-2022 11:06                4110
commonmark-node-bulletlist.construct.php           30-Sep-2022 11:06                3005
commonmark-node-codeblock.construct.php            30-Sep-2022 11:06                2716
commonmark-node-heading.construct.php              30-Sep-2022 11:06                2562
commonmark-node-image.construct.php                30-Sep-2022 11:06                3099
commonmark-node-link.construct.php                 30-Sep-2022 11:06                3096
commonmark-node-orderedlist.construct.php          30-Sep-2022 11:06                3820
commonmark-node-text.construct.php                 30-Sep-2022 11:06                2600
commonmark-node.accept.php                         30-Sep-2022 11:06                2848
commonmark-node.appendchild.php                    30-Sep-2022 11:06                2701
commonmark-node.insertafter.php                    30-Sep-2022 11:06                2726
commonmark-node.insertbefore.php                   30-Sep-2022 11:06                2724
commonmark-node.prependchild.php                   30-Sep-2022 11:06                2728
commonmark-node.replace.php                        30-Sep-2022 11:06                2672
commonmark-node.unlink.php                         30-Sep-2022 11:06                2346
commonmark-parser.construct.php                    30-Sep-2022 11:06                3252
commonmark-parser.finish.php                       30-Sep-2022 11:06                2401
commonmark-parser.parse.php                        30-Sep-2022 11:06                2546
compersisthelper.construct.php                     30-Sep-2022 11:06                3462
compersisthelper.getcurfilename.php                30-Sep-2022 11:06                3025
compersisthelper.getmaxstreamsize.php              30-Sep-2022 11:06                3059
compersisthelper.initnew.php                       30-Sep-2022 11:06                2920
compersisthelper.loadfromfile.php                  30-Sep-2022 11:06                4021
compersisthelper.loadfromstream.php                30-Sep-2022 11:06                3289
compersisthelper.savetofile.php                    30-Sep-2022 11:06                5924
compersisthelper.savetostream.php                  30-Sep-2022 11:06                3316
componere-abstract-definition.addinterface.php     30-Sep-2022 11:06                3251
componere-abstract-definition.addmethod.php        30-Sep-2022 11:06                4019
componere-abstract-definition.addtrait.php         30-Sep-2022 11:06                3203
componere-abstract-definition.getreflector.php     30-Sep-2022 11:06                2360
componere-definition.addconstant.php               30-Sep-2022 11:06                4307
componere-definition.addproperty.php               30-Sep-2022 11:06                3714
componere-definition.construct.php                 30-Sep-2022 11:06                5463
componere-definition.getclosure.php                30-Sep-2022 11:06                3379
componere-definition.getclosures.php               30-Sep-2022 11:06                2622
componere-definition.isregistered.php              30-Sep-2022 11:06                2183
componere-definition.register.php                  30-Sep-2022 11:06                2403
componere-method.construct.php                     30-Sep-2022 11:06                2183
componere-method.getreflector.php                  30-Sep-2022 11:06                2163
componere-method.setprivate.php                    30-Sep-2022 11:06                2425
componere-method.setprotected.php                  30-Sep-2022 11:06                2440
componere-method.setstatic.php                     30-Sep-2022 11:06                2021
componere-patch.apply.php                          30-Sep-2022 11:06                1823
componere-patch.construct.php                      30-Sep-2022 11:06                3423
componere-patch.derive.php                         30-Sep-2022 11:06                3162
componere-patch.getclosure.php                     30-Sep-2022 11:06                2971
componere-patch.getclosures.php                    30-Sep-2022 11:06                2105
componere-patch.isapplied.php                      30-Sep-2022 11:06                1743
componere-patch.revert.php                         30-Sep-2022 11:06                1820
componere-value.construct.php                      30-Sep-2022 11:06                2617
componere-value.hasdefault.php                     30-Sep-2022 11:06                1791
componere-value.isprivate.php                      30-Sep-2022 11:06                1808
componere-value.isprotected.php                    30-Sep-2022 11:06                1818
componere-value.isstatic.php                       30-Sep-2022 11:06                1802
componere-value.setprivate.php                     30-Sep-2022 11:06                2447
componere-value.setprotected.php                   30-Sep-2022 11:06                2461
componere-value.setstatic.php                      30-Sep-2022 11:06                2037
componere.cast.php                                 30-Sep-2022 11:06                4888
componere.cast_by_ref.php                          30-Sep-2022 11:06                5061
componere.installation.php                         30-Sep-2022 11:06                1309
componere.requirements.php                         30-Sep-2022 11:06                1163
componere.setup.php                                30-Sep-2022 11:06                1446
configuration.changes.modes.php                    30-Sep-2022 11:06                3853
configuration.changes.php                          30-Sep-2022 11:06                9114
configuration.file.per-user.php                    30-Sep-2022 11:06                3219
configuration.file.php                             30-Sep-2022 11:06               10599
configuration.php                                  30-Sep-2022 11:06                1661
configure.about.php                                30-Sep-2022 11:06               12915
configure.php                                      30-Sep-2022 11:06                1390
context.curl.php                                   30-Sep-2022 11:06                8896
context.ftp.php                                    30-Sep-2022 11:06                4124
context.http.php                                   30-Sep-2022 11:06               15549
context.params.php                                 30-Sep-2022 11:06                2484
context.phar.php                                   30-Sep-2022 11:06                2742
context.php                                        30-Sep-2022 11:06                2816
context.socket.php                                 30-Sep-2022 11:06               10011
context.ssl.php                                    30-Sep-2022 11:06               11537
context.zip.php                                    30-Sep-2022 11:06                4367
control-structures.alternative-syntax.php          30-Sep-2022 11:06                7303
control-structures.break.php                       30-Sep-2022 11:06                5582
control-structures.continue.php                    30-Sep-2022 11:06                7759
control-structures.declare.php                     30-Sep-2022 11:06               10917
control-structures.do.while.php                    30-Sep-2022 11:06                5530
control-structures.else.php                        30-Sep-2022 11:06                4867
control-structures.elseif.php                      30-Sep-2022 11:06                7745
control-structures.for.php                         30-Sep-2022 11:06               12336
control-structures.foreach.php                     30-Sep-2022 11:06               23352
control-structures.goto.php                        30-Sep-2022 11:06                7347
control-structures.if.php                          30-Sep-2022 11:06                4822
control-structures.intro.php                       30-Sep-2022 11:06                2587
control-structures.match.php                       30-Sep-2022 11:06               19570
control-structures.switch.php                      30-Sep-2022 11:06               22408
control-structures.while.php                       30-Sep-2022 11:06                4652
copyright.php                                      30-Sep-2022 11:06                2087
countable.count.php                                30-Sep-2022 11:06                5497
csprng.configuration.php                           30-Sep-2022 11:06                1231
csprng.constants.php                               30-Sep-2022 11:06                1131
csprng.installation.php                            30-Sep-2022 11:06                1215
csprng.requirements.php                            30-Sep-2022 11:06                1191
csprng.resources.php                               30-Sep-2022 11:06                1174
csprng.setup.php                                   30-Sep-2022 11:06                1548
ctype.configuration.php                            30-Sep-2022 11:06                1224
ctype.constants.php                                30-Sep-2022 11:06                1122
ctype.installation.php                             30-Sep-2022 11:06                1397
ctype.requirements.php                             30-Sep-2022 11:06                1196
ctype.resources.php                                30-Sep-2022 11:06                1167
ctype.setup.php                                    30-Sep-2022 11:06                1542
cubrid.configuration.php                           30-Sep-2022 11:06                1172
cubrid.constants.php                               30-Sep-2022 11:06               13779
cubrid.examples.php                                30-Sep-2022 11:06               21176
cubrid.installation.php                            30-Sep-2022 11:06                2058
cubrid.requirements.php                            30-Sep-2022 11:06                1239
cubrid.resources.php                               30-Sep-2022 11:06                3063
cubrid.setup.php                                   30-Sep-2022 11:06                1554
cubridmysql.cubrid.php                             30-Sep-2022 11:06                4907
curl.configuration.php                             30-Sep-2022 11:06                2400
curl.constants.php                                 30-Sep-2022 11:06               99346
curl.examples-basic.php                            30-Sep-2022 11:06                4716
curl.examples.php                                  30-Sep-2022 11:06                1339
curl.installation.php                              30-Sep-2022 11:06                2524
curl.requirements.php                              30-Sep-2022 11:06                1434
curl.resources.php                                 30-Sep-2022 11:06                1341
curl.setup.php                                     30-Sep-2022 11:06                1550
curlfile.construct.php                             30-Sep-2022 11:06               21178
curlfile.getfilename.php                           30-Sep-2022 11:06                2072
curlfile.getmimetype.php                           30-Sep-2022 11:06                2074
curlfile.getpostfilename.php                       30-Sep-2022 11:06                2130
curlfile.setmimetype.php                           30-Sep-2022 11:06                2350
curlfile.setpostfilename.php                       30-Sep-2022 11:06                2396
curlstringfile.construct.php                       30-Sep-2022 11:06                6884
dateinterval.construct.php                         30-Sep-2022 11:06               13277
dateinterval.createfromdatestring.php              30-Sep-2022 11:06               15333
dateinterval.format.php                            30-Sep-2022 11:06               15010
dateperiod.construct.php                           30-Sep-2022 11:06               19108
dateperiod.getdateinterval.php                     30-Sep-2022 11:06                4763
dateperiod.getenddate.php                          30-Sep-2022 11:06                7771
dateperiod.getrecurrences.php                      30-Sep-2022 11:06                2638
dateperiod.getstartdate.php                        30-Sep-2022 11:06                5220
datetime.add.php                                   30-Sep-2022 11:06                5038
datetime.configuration.php                         30-Sep-2022 11:06                5639
datetime.constants.php                             30-Sep-2022 11:06                2479
datetime.construct.php                             30-Sep-2022 11:06                5039
datetime.createfromformat.php                      30-Sep-2022 11:06                5534
datetime.createfromimmutable.php                   30-Sep-2022 11:06                4367
datetime.createfrominterface.php                   30-Sep-2022 11:06                4979
datetime.diff.php                                  30-Sep-2022 11:06               14957
datetime.examples-arithmetic.php                   30-Sep-2022 11:06               16393
datetime.examples.php                              30-Sep-2022 11:06                1413
datetime.format.php                                30-Sep-2022 11:06               23371
datetime.formats.compound.php                      30-Sep-2022 11:06               12658
datetime.formats.date.php                          30-Sep-2022 11:06               15127
datetime.formats.php                               30-Sep-2022 11:06                7679
datetime.formats.relative.php                      30-Sep-2022 11:06               16834
datetime.formats.time.php                          30-Sep-2022 11:06                7681
datetime.getlasterrors.php                         30-Sep-2022 11:06                3505
datetime.getoffset.php                             30-Sep-2022 11:06                8269
datetime.gettimestamp.php                          30-Sep-2022 11:06                7110
datetime.gettimezone.php                           30-Sep-2022 11:06                7735
datetime.installation.php                          30-Sep-2022 11:06                1619
datetime.modify.php                                30-Sep-2022 11:06               10586
datetime.requirements.php                          30-Sep-2022 11:06                1205
datetime.resources.php                             30-Sep-2022 11:06                1188
datetime.set-state.php                             30-Sep-2022 11:06                2789
datetime.setdate.php                               30-Sep-2022 11:06                5378
datetime.setisodate.php                            30-Sep-2022 11:06                5507
datetime.settime.php                               30-Sep-2022 11:06                6862
datetime.settimestamp.php                          30-Sep-2022 11:06                5017
datetime.settimezone.php                           30-Sep-2022 11:06                9506
datetime.setup.php                                 30-Sep-2022 11:06                1613
datetime.sub.php                                   30-Sep-2022 11:06                4916
datetime.wakeup.php                                30-Sep-2022 11:06                2924
datetimeimmutable.add.php                          30-Sep-2022 11:06               10951
datetimeimmutable.construct.php                    30-Sep-2022 11:06               18672
datetimeimmutable.createfromformat.php             30-Sep-2022 11:06               46107
datetimeimmutable.createfrominterface.php          30-Sep-2022 11:06                5230
datetimeimmutable.createfrommutable.php            30-Sep-2022 11:06                4521
datetimeimmutable.getlasterrors.php                30-Sep-2022 11:06                4998
datetimeimmutable.modify.php                       30-Sep-2022 11:06                8480
datetimeimmutable.set-state.php                    30-Sep-2022 11:06                2704
datetimeimmutable.setdate.php                      30-Sep-2022 11:06                9313
datetimeimmutable.setisodate.php                   30-Sep-2022 11:06               13032
datetimeimmutable.settime.php                      30-Sep-2022 11:06               12206
datetimeimmutable.settimestamp.php                 30-Sep-2022 11:06                5951
datetimeimmutable.settimezone.php                  30-Sep-2022 11:06                6104
datetimeimmutable.sub.php                          30-Sep-2022 11:06               11164
datetimezone.construct.php                         30-Sep-2022 11:06               10009
datetimezone.getlocation.php                       30-Sep-2022 11:06                5771
datetimezone.getname.php                           30-Sep-2022 11:06                3600
datetimezone.getoffset.php                         30-Sep-2022 11:06                8038
datetimezone.gettransitions.php                    30-Sep-2022 11:06               11075
datetimezone.listabbreviations.php                 30-Sep-2022 11:06                6022
datetimezone.listidentifiers.php                   30-Sep-2022 11:06               14378
dba.configuration.php                              30-Sep-2022 11:06                2173
dba.constants.php                                  30-Sep-2022 11:06                1952
dba.example.php                                    30-Sep-2022 11:06                6922
dba.examples.php                                   30-Sep-2022 11:06                1328
dba.installation.php                               30-Sep-2022 11:06               10535
dba.requirements.php                               30-Sep-2022 11:06                7645
dba.resources.php                                  30-Sep-2022 11:06                1459
dba.setup.php                                      30-Sep-2022 11:06                1532
dbase.configuration.php                            30-Sep-2022 11:06                1224
dbase.constants.php                                30-Sep-2022 11:06                3119
dbase.installation.php                             30-Sep-2022 11:06                1521
dbase.requirements.php                             30-Sep-2022 11:06                1184
dbase.resources.php                                30-Sep-2022 11:06                1442
dbase.setup.php                                    30-Sep-2022 11:06                1558
debugger-about.php                                 30-Sep-2022 11:06                1807
debugger.php                                       30-Sep-2022 11:06                1346
dio.configuration.php                              30-Sep-2022 11:06                1210
dio.constants.php                                  30-Sep-2022 11:06                7234
dio.installation.php                               30-Sep-2022 11:06                1982
dio.requirements.php                               30-Sep-2022 11:06                1170
dio.resources.php                                  30-Sep-2022 11:06                1313
dio.setup.php                                      30-Sep-2022 11:06                1539
dir.configuration.php                              30-Sep-2022 11:06                1210
dir.constants.php                                  30-Sep-2022 11:06                2195
dir.installation.php                               30-Sep-2022 11:06                1194
dir.requirements.php                               30-Sep-2022 11:06                1170
dir.resources.php                                  30-Sep-2022 11:06                1153
dir.setup.php                                      30-Sep-2022 11:06                1550
directory.close.php                                30-Sep-2022 11:06                2154
directory.read.php                                 30-Sep-2022 11:06                2227
directory.rewind.php                               30-Sep-2022 11:06                2172
directoryiterator.construct.php                    30-Sep-2022 11:06                5862
directoryiterator.current.php                      30-Sep-2022 11:06                6284
directoryiterator.getatime.php                     30-Sep-2022 11:06                5689
directoryiterator.getbasename.php                  30-Sep-2022 11:06                6730
directoryiterator.getctime.php                     30-Sep-2022 11:06                5781
directoryiterator.getextension.php                 30-Sep-2022 11:06                6115
directoryiterator.getfilename.php                  30-Sep-2022 11:06                5395
directoryiterator.getgroup.php                     30-Sep-2022 11:06                5847
directoryiterator.getinode.php                     30-Sep-2022 11:06                4650
directoryiterator.getmtime.php                     30-Sep-2022 11:06                5701
directoryiterator.getowner.php                     30-Sep-2022 11:06                5238
directoryiterator.getpath.php                      30-Sep-2022 11:06                4795
directoryiterator.getpathname.php                  30-Sep-2022 11:06                5190
directoryiterator.getperms.php                     30-Sep-2022 11:06                6104
directoryiterator.getsize.php                      30-Sep-2022 11:06                4944
directoryiterator.gettype.php                      30-Sep-2022 11:06                5734
directoryiterator.isdir.php                        30-Sep-2022 11:06                5578
directoryiterator.isdot.php                        30-Sep-2022 11:06                5812
directoryiterator.isexecutable.php                 30-Sep-2022 11:06                5463
directoryiterator.isfile.php                       30-Sep-2022 11:06                5733
directoryiterator.islink.php                       30-Sep-2022 11:06                7364
directoryiterator.isreadable.php                   30-Sep-2022 11:06                5315
directoryiterator.iswritable.php                   30-Sep-2022 11:06                5491
directoryiterator.key.php                          30-Sep-2022 11:06                6717
directoryiterator.next.php                         30-Sep-2022 11:06                5544
directoryiterator.rewind.php                       30-Sep-2022 11:06                5447
directoryiterator.seek.php                         30-Sep-2022 11:06                5345
directoryiterator.tostring.php                     30-Sep-2022 11:06                4615
directoryiterator.valid.php                        30-Sep-2022 11:06                5744
doc.changelog.php                                  30-Sep-2022 11:06              278788
dom.configuration.php                              30-Sep-2022 11:06                1210
dom.constants.php                                  30-Sep-2022 11:06               14275
dom.examples.php                                   30-Sep-2022 11:06                2924
dom.installation.php                               30-Sep-2022 11:06                1287
dom.requirements.php                               30-Sep-2022 11:06                1465
dom.resources.php                                  30-Sep-2022 11:06                1153
dom.setup.php                                      30-Sep-2022 11:06                1525
domattr.construct.php                              30-Sep-2022 11:06                5505
domattr.isid.php                                   30-Sep-2022 11:06                4996
domcdatasection.construct.php                      30-Sep-2022 11:06                5178
domcharacterdata.appenddata.php                    30-Sep-2022 11:06                3676
domcharacterdata.deletedata.php                    30-Sep-2022 11:06                4683
domcharacterdata.insertdata.php                    30-Sep-2022 11:06                4403
domcharacterdata.replacedata.php                   30-Sep-2022 11:06                5023
domcharacterdata.substringdata.php                 30-Sep-2022 11:06                4678
domchildnode.after.php                             30-Sep-2022 11:06                3491
domchildnode.before.php                            30-Sep-2022 11:06                3306
domchildnode.remove.php                            30-Sep-2022 11:06                3100
domchildnode.replacewith.php                       30-Sep-2022 11:06                3712
domcomment.construct.php                           30-Sep-2022 11:06                5007
domdocument.construct.php                          30-Sep-2022 11:06                4290
domdocument.createattribute.php                    30-Sep-2022 11:06                5800
domdocument.createattributens.php                  30-Sep-2022 11:06                6645
domdocument.createcdatasection.php                 30-Sep-2022 11:06                5473
domdocument.createcomment.php                      30-Sep-2022 11:06                5874
domdocument.createdocumentfragment.php             30-Sep-2022 11:06                5764
domdocument.createelement.php                      30-Sep-2022 11:06               11391
domdocument.createelementns.php                    30-Sep-2022 11:06               14102
domdocument.createentityreference.php              30-Sep-2022 11:06                6117
domdocument.createprocessinginstruction.php        30-Sep-2022 11:06                6381
domdocument.createtextnode.php                     30-Sep-2022 11:06                5862
domdocument.getelementbyid.php                     30-Sep-2022 11:06                7625
domdocument.getelementsbytagname.php               30-Sep-2022 11:06                6154
domdocument.getelementsbytagnamens.php             30-Sep-2022 11:06                7627
domdocument.importnode.php                         30-Sep-2022 11:06                8964
domdocument.load.php                               30-Sep-2022 11:06                6178
domdocument.loadhtml.php                           30-Sep-2022 11:06                6828
domdocument.loadhtmlfile.php                       30-Sep-2022 11:06                6575
domdocument.loadxml.php                            30-Sep-2022 11:06                6929
domdocument.normalizedocument.php                  30-Sep-2022 11:06                2951
domdocument.registernodeclass.php                  30-Sep-2022 11:06               21196
domdocument.relaxngvalidate.php                    30-Sep-2022 11:06                3835
domdocument.relaxngvalidatesource.php              30-Sep-2022 11:06                3868
domdocument.save.php                               30-Sep-2022 11:06                7550
domdocument.savehtml.php                           30-Sep-2022 11:06                7439
domdocument.savehtmlfile.php                       30-Sep-2022 11:06                7988
domdocument.savexml.php                            30-Sep-2022 11:06                8885
domdocument.schemavalidate.php                     30-Sep-2022 11:06                4167
domdocument.schemavalidatesource.php               30-Sep-2022 11:06                4229
domdocument.validate.php                           30-Sep-2022 11:06                5974
domdocument.xinclude.php                           30-Sep-2022 11:06                7109
domdocumentfragment.appendxml.php                  30-Sep-2022 11:06                5340
domdocumentfragment.construct.php                  30-Sep-2022 11:06                2081
domelement.construct.php                           30-Sep-2022 11:06                6501
domelement.getattribute.php                        30-Sep-2022 11:06                3418
domelement.getattributenode.php                    30-Sep-2022 11:06                3941
domelement.getattributenodens.php                  30-Sep-2022 11:06                4325
domelement.getattributens.php                      30-Sep-2022 11:06                3876
domelement.getelementsbytagname.php                30-Sep-2022 11:06                3557
domelement.getelementsbytagnamens.php              30-Sep-2022 11:06                4274
domelement.hasattribute.php                        30-Sep-2022 11:06                3639
domelement.hasattributens.php                      30-Sep-2022 11:06                4013
domelement.removeattribute.php                     30-Sep-2022 11:06                3788
domelement.removeattributenode.php                 30-Sep-2022 11:06                4223
domelement.removeattributens.php                   30-Sep-2022 11:06                4193
domelement.setattribute.php                        30-Sep-2022 11:06                5974
domelement.setattributenode.php                    30-Sep-2022 11:06                3956
domelement.setattributenodens.php                  30-Sep-2022 11:06                3954
domelement.setattributens.php                      30-Sep-2022 11:06                4858
domelement.setidattribute.php                      30-Sep-2022 11:06                4486
domelement.setidattributenode.php                  30-Sep-2022 11:06                4540
domelement.setidattributens.php                    30-Sep-2022 11:06                4853
domentityreference.construct.php                   30-Sep-2022 11:06                4839
domimplementation.construct.php                    30-Sep-2022 11:06                2110
domimplementation.createdocument.php               30-Sep-2022 11:06                6777
domimplementation.createdocumenttype.php           30-Sep-2022 11:06                9299
domimplementation.hasfeature.php                   30-Sep-2022 11:06                9686
domnamednodemap.count.php                          30-Sep-2022 11:06                2329
domnamednodemap.getnameditem.php                   30-Sep-2022 11:06                3259
domnamednodemap.getnameditemns.php                 30-Sep-2022 11:06                3637
domnamednodemap.item.php                           30-Sep-2022 11:06                2843
domnode.appendchild.php                            30-Sep-2022 11:06                8517
domnode.c14n.php                                   30-Sep-2022 11:06                4275
domnode.c14nfile.php                               30-Sep-2022 11:06                4555
domnode.clonenode.php                              30-Sep-2022 11:06                2612
domnode.getlineno.php                              30-Sep-2022 11:06                4883
domnode.getnodepath.php                            30-Sep-2022 11:06                5165
domnode.hasattributes.php                          30-Sep-2022 11:06                2727
domnode.haschildnodes.php                          30-Sep-2022 11:06                2649
domnode.insertbefore.php                           30-Sep-2022 11:06                4997
domnode.isdefaultnamespace.php                     30-Sep-2022 11:06                2663
domnode.issamenode.php                             30-Sep-2022 11:06                2629
domnode.issupported.php                            30-Sep-2022 11:06                3522
domnode.lookupnamespaceuri.php                     30-Sep-2022 11:06                2943
domnode.lookupprefix.php                           30-Sep-2022 11:06                2919
domnode.normalize.php                              30-Sep-2022 11:06                2777
domnode.removechild.php                            30-Sep-2022 11:06                6886
domnode.replacechild.php                           30-Sep-2022 11:06                5397
domnodelist.count.php                              30-Sep-2022 11:06                2242
domnodelist.item.php                               30-Sep-2022 11:06                6792
domparentnode.append.php                           30-Sep-2022 11:06                2997
domparentnode.prepend.php                          30-Sep-2022 11:06                3030
domprocessinginstruction.construct.php             30-Sep-2022 11:06                6638
domtext.construct.php                              30-Sep-2022 11:06                4805
domtext.iselementcontentwhitespace.php             30-Sep-2022 11:06                2451
domtext.iswhitespaceinelementcontent.php           30-Sep-2022 11:06                2638
domtext.splittext.php                              30-Sep-2022 11:06                3111
domxpath.construct.php                             30-Sep-2022 11:06                2737
domxpath.evaluate.php                              30-Sep-2022 11:06                7422
domxpath.query.php                                 30-Sep-2022 11:06               12235
domxpath.registernamespace.php                     30-Sep-2022 11:06                3000
domxpath.registerphpfunctions.php                  30-Sep-2022 11:06               14030
dotnet.construct.php                               30-Sep-2022 11:06                2860
ds-collection.clear.php                            30-Sep-2022 11:06                3981
ds-collection.copy.php                             30-Sep-2022 11:06                4418
ds-collection.isempty.php                          30-Sep-2022 11:06                4261
ds-collection.toarray.php                          30-Sep-2022 11:06                4142
ds-deque.allocate.php                              30-Sep-2022 11:06                4633
ds-deque.apply.php                                 30-Sep-2022 11:06                5111
ds-deque.capacity.php                              30-Sep-2022 11:06                3933
ds-deque.clear.php                                 30-Sep-2022 11:06                3863
ds-deque.construct.php                             30-Sep-2022 11:06                4431
ds-deque.contains.php                              30-Sep-2022 11:06                7534
ds-deque.copy.php                                  30-Sep-2022 11:06                4245
ds-deque.count.php                                 30-Sep-2022 11:06                1529
ds-deque.filter.php                                30-Sep-2022 11:06                7554
ds-deque.find.php                                  30-Sep-2022 11:06                5503
ds-deque.first.php                                 30-Sep-2022 11:06                3846
ds-deque.get.php                                   30-Sep-2022 11:06                6716
ds-deque.insert.php                                30-Sep-2022 11:06                7051
ds-deque.isempty.php                               30-Sep-2022 11:06                4108
ds-deque.join.php                                  30-Sep-2022 11:06                5793
ds-deque.jsonserialize.php                         30-Sep-2022 11:06                1812
ds-deque.last.php                                  30-Sep-2022 11:06                3834
ds-deque.map.php                                   30-Sep-2022 11:06                5483
ds-deque.merge.php                                 30-Sep-2022 11:06                4940
ds-deque.pop.php                                   30-Sep-2022 11:06                4331
ds-deque.push.php                                  30-Sep-2022 11:06                4744
ds-deque.reduce.php                                30-Sep-2022 11:06                8729
ds-deque.remove.php                                30-Sep-2022 11:06                4899
ds-deque.reverse.php                               30-Sep-2022 11:06                3699
ds-deque.reversed.php                              30-Sep-2022 11:06                4063
ds-deque.rotate.php                                30-Sep-2022 11:06                5121
ds-deque.set.php                                   30-Sep-2022 11:06                6192
ds-deque.shift.php                                 30-Sep-2022 11:06                4432
ds-deque.slice.php                                 30-Sep-2022 11:06                7260
ds-deque.sort.php                                  30-Sep-2022 11:06                7499
ds-deque.sorted.php                                30-Sep-2022 11:06                7546
ds-deque.sum.php                                   30-Sep-2022 11:06                5174
ds-deque.toarray.php                               30-Sep-2022 11:06                3993
ds-deque.unshift.php                               30-Sep-2022 11:06                4827
ds-hashable.equals.php                             30-Sep-2022 11:06                3398
ds-hashable.hash.php                               30-Sep-2022 11:06                8545
ds-map.allocate.php                                30-Sep-2022 11:06                4499
ds-map.apply.php                                   30-Sep-2022 11:06                5883
ds-map.capacity.php                                30-Sep-2022 11:06                3218
ds-map.clear.php                                   30-Sep-2022 11:06                4419
ds-map.construct.php                               30-Sep-2022 11:06                4963
ds-map.copy.php                                    30-Sep-2022 11:06                4175
ds-map.count.php                                   30-Sep-2022 11:06                1490
ds-map.diff.php                                    30-Sep-2022 11:06                5666
ds-map.filter.php                                  30-Sep-2022 11:06                8419
ds-map.first.php                                   30-Sep-2022 11:06                4134
ds-map.get.php                                     30-Sep-2022 11:06                8734
ds-map.haskey.php                                  30-Sep-2022 11:06                4660
ds-map.hasvalue.php                                30-Sep-2022 11:06                4704
ds-map.intersect.php                               30-Sep-2022 11:06                6190
ds-map.isempty.php                                 30-Sep-2022 11:06                4360
ds-map.jsonserialize.php                           30-Sep-2022 11:06                1790
ds-map.keys.php                                    30-Sep-2022 11:06                4012
ds-map.ksort.php                                   30-Sep-2022 11:06                8231
ds-map.ksorted.php                                 30-Sep-2022 11:06                8340
ds-map.last.php                                    30-Sep-2022 11:06                4119
ds-map.map.php                                     30-Sep-2022 11:06                6523
ds-map.merge.php                                   30-Sep-2022 11:06                5904
ds-map.pairs.php                                   30-Sep-2022 11:06                4403
ds-map.put.php                                     30-Sep-2022 11:06               14915
ds-map.putall.php                                  30-Sep-2022 11:06                5530
ds-map.reduce.php                                  30-Sep-2022 11:06                9779
ds-map.remove.php                                  30-Sep-2022 11:06                7147
ds-map.reverse.php                                 30-Sep-2022 11:06                4181
ds-map.reversed.php                                30-Sep-2022 11:06                4303
ds-map.skip.php                                    30-Sep-2022 11:06                4623
ds-map.slice.php                                   30-Sep-2022 11:06                8161
ds-map.sort.php                                    30-Sep-2022 11:06                8149
ds-map.sorted.php                                  30-Sep-2022 11:06                8319
ds-map.sum.php                                     30-Sep-2022 11:06                5701
ds-map.toarray.php                                 30-Sep-2022 11:06                5006
ds-map.union.php                                   30-Sep-2022 11:06                6174
ds-map.values.php                                  30-Sep-2022 11:06                4006
ds-map.xor.php                                     30-Sep-2022 11:06                5728
ds-pair.clear.php                                  30-Sep-2022 11:06                3759
ds-pair.construct.php                              30-Sep-2022 11:06                2636
ds-pair.copy.php                                   30-Sep-2022 11:06                4164
ds-pair.isempty.php                                30-Sep-2022 11:06                4053
ds-pair.jsonserialize.php                          30-Sep-2022 11:06                1810
ds-pair.toarray.php                                30-Sep-2022 11:06                3918
ds-priorityqueue.allocate.php                      30-Sep-2022 11:06                4799
ds-priorityqueue.capacity.php                      30-Sep-2022 11:06                3427
ds-priorityqueue.clear.php                         30-Sep-2022 11:06                4530
ds-priorityqueue.construct.php                     30-Sep-2022 11:06                2955
ds-priorityqueue.copy.php                          30-Sep-2022 11:06                4548
ds-priorityqueue.count.php                         30-Sep-2022 11:06                1638
ds-priorityqueue.isempty.php                       30-Sep-2022 11:06                5028
ds-priorityqueue.jsonserialize.php                 30-Sep-2022 11:06                1930
ds-priorityqueue.peek.php                          30-Sep-2022 11:06                4834
ds-priorityqueue.pop.php                           30-Sep-2022 11:06                5607
ds-priorityqueue.push.php                          30-Sep-2022 11:06                5626
ds-priorityqueue.toarray.php                       30-Sep-2022 11:06                5105
ds-queue.allocate.php                              30-Sep-2022 11:06                4829
ds-queue.capacity.php                              30-Sep-2022 11:06                3939
ds-queue.clear.php                                 30-Sep-2022 11:06                3848
ds-queue.construct.php                             30-Sep-2022 11:06                4429
ds-queue.copy.php                                  30-Sep-2022 11:06                4382
ds-queue.count.php                                 30-Sep-2022 11:06                1526
ds-queue.isempty.php                               30-Sep-2022 11:06                4124
ds-queue.jsonserialize.php                         30-Sep-2022 11:06                1818
ds-queue.peek.php                                  30-Sep-2022 11:06                4418
ds-queue.pop.php                                   30-Sep-2022 11:06                4952
ds-queue.push.php                                  30-Sep-2022 11:06                4779
ds-queue.toarray.php                               30-Sep-2022 11:06                4156
ds-sequence.allocate.php                           30-Sep-2022 11:06                4534
ds-sequence.apply.php                              30-Sep-2022 11:06                5226
ds-sequence.capacity.php                           30-Sep-2022 11:06                4498
ds-sequence.contains.php                           30-Sep-2022 11:06                7661
ds-sequence.filter.php                             30-Sep-2022 11:06                7693
ds-sequence.find.php                               30-Sep-2022 11:06                5615
ds-sequence.first.php                              30-Sep-2022 11:06                3961
ds-sequence.get.php                                30-Sep-2022 11:06                6844
ds-sequence.insert.php                             30-Sep-2022 11:06                7170
ds-sequence.join.php                               30-Sep-2022 11:06                5889
ds-sequence.last.php                               30-Sep-2022 11:06                3928
ds-sequence.map.php                                30-Sep-2022 11:06                5612
ds-sequence.merge.php                              30-Sep-2022 11:06                5066
ds-sequence.pop.php                                30-Sep-2022 11:06                4443
ds-sequence.push.php                               30-Sep-2022 11:06                4866
ds-sequence.reduce.php                             30-Sep-2022 11:06                8848
ds-sequence.remove.php                             30-Sep-2022 11:06                5011
ds-sequence.reverse.php                            30-Sep-2022 11:06                3812
ds-sequence.reversed.php                           30-Sep-2022 11:06                4186
ds-sequence.rotate.php                             30-Sep-2022 11:06                5258
ds-sequence.set.php                                30-Sep-2022 11:06                6316
ds-sequence.shift.php                              30-Sep-2022 11:06                4544
ds-sequence.slice.php                              30-Sep-2022 11:06                7425
ds-sequence.sort.php                               30-Sep-2022 11:06                7626
ds-sequence.sorted.php                             30-Sep-2022 11:06                7673
ds-sequence.sum.php                                30-Sep-2022 11:06                5299
ds-sequence.unshift.php                            30-Sep-2022 11:06                4938
ds-set.add.php                                     30-Sep-2022 11:06               13096
ds-set.allocate.php                                30-Sep-2022 11:06                4512
ds-set.capacity.php                                30-Sep-2022 11:06                3892
ds-set.clear.php                                   30-Sep-2022 11:06                3794
ds-set.construct.php                               30-Sep-2022 11:06                4383
ds-set.contains.php                                30-Sep-2022 11:06                7492
ds-set.copy.php                                    30-Sep-2022 11:06                4321
ds-set.count.php                                   30-Sep-2022 11:06                1490
ds-set.diff.php                                    30-Sep-2022 11:06                4896
ds-set.filter.php                                  30-Sep-2022 11:06                7502
ds-set.first.php                                   30-Sep-2022 11:06                3799
ds-set.get.php                                     30-Sep-2022 11:06                6660
ds-set.intersect.php                               30-Sep-2022 11:06                5127
ds-set.isempty.php                                 30-Sep-2022 11:06                4066
ds-set.join.php                                    30-Sep-2022 11:06                5739
ds-set.jsonserialize.php                           30-Sep-2022 11:06                1784
ds-set.last.php                                    30-Sep-2022 11:06                3800
ds-set.merge.php                                   30-Sep-2022 11:06                4866
ds-set.reduce.php                                  30-Sep-2022 11:06                8675
ds-set.remove.php                                  30-Sep-2022 11:06                5255
ds-set.reverse.php                                 30-Sep-2022 11:06                3647
ds-set.reversed.php                                30-Sep-2022 11:06                4001
ds-set.slice.php                                   30-Sep-2022 11:06                7174
ds-set.sort.php                                    30-Sep-2022 11:06                7435
ds-set.sorted.php                                  30-Sep-2022 11:06                7482
ds-set.sum.php                                     30-Sep-2022 11:06                5114
ds-set.toarray.php                                 30-Sep-2022 11:06                3939
ds-set.union.php                                   30-Sep-2022 11:06                5090
ds-set.xor.php                                     30-Sep-2022 11:06                5062
ds-stack.allocate.php                              30-Sep-2022 11:06                2730
ds-stack.capacity.php                              30-Sep-2022 11:06                2081
ds-stack.clear.php                                 30-Sep-2022 11:06                3844
ds-stack.construct.php                             30-Sep-2022 11:06                4395
ds-stack.copy.php                                  30-Sep-2022 11:06                4382
ds-stack.count.php                                 30-Sep-2022 11:06                1526
ds-stack.isempty.php                               30-Sep-2022 11:06                4124
ds-stack.jsonserialize.php                         30-Sep-2022 11:06                1818
ds-stack.peek.php                                  30-Sep-2022 11:06                4412
ds-stack.pop.php                                   30-Sep-2022 11:06                4946
ds-stack.push.php                                  30-Sep-2022 11:06                4779
ds-stack.toarray.php                               30-Sep-2022 11:06                3980
ds-vector.allocate.php                             30-Sep-2022 11:06                4451
ds-vector.apply.php                                30-Sep-2022 11:06                5137
ds-vector.capacity.php                             30-Sep-2022 11:06                4403
ds-vector.clear.php                                30-Sep-2022 11:06                3875
ds-vector.construct.php                            30-Sep-2022 11:06                4463
ds-vector.contains.php                             30-Sep-2022 11:06                7564
ds-vector.copy.php                                 30-Sep-2022 11:06                4406
ds-vector.count.php                                30-Sep-2022 11:06                1543
ds-vector.filter.php                               30-Sep-2022 11:06                7588
ds-vector.find.php                                 30-Sep-2022 11:06                5528
ds-vector.first.php                                30-Sep-2022 11:06                3872
ds-vector.get.php                                  30-Sep-2022 11:06                6747
ds-vector.insert.php                               30-Sep-2022 11:06                7081
ds-vector.isempty.php                              30-Sep-2022 11:06                4132
ds-vector.join.php                                 30-Sep-2022 11:06                5820
ds-vector.jsonserialize.php                        30-Sep-2022 11:06                1826
ds-vector.last.php                                 30-Sep-2022 11:06                3859
ds-vector.map.php                                  30-Sep-2022 11:06                5515
ds-vector.merge.php                                30-Sep-2022 11:06                4971
ds-vector.pop.php                                  30-Sep-2022 11:06                4356
ds-vector.push.php                                 30-Sep-2022 11:06                4773
ds-vector.reduce.php                               30-Sep-2022 11:06                8757
ds-vector.remove.php                               30-Sep-2022 11:06                4924
ds-vector.reverse.php                              30-Sep-2022 11:06                3725
ds-vector.reversed.php                             30-Sep-2022 11:06                4093
ds-vector.rotate.php                               30-Sep-2022 11:06                5155
ds-vector.set.php                                  30-Sep-2022 11:06                6223
ds-vector.shift.php                                30-Sep-2022 11:06                4457
ds-vector.slice.php                                30-Sep-2022 11:06                7306
ds-vector.sort.php                                 30-Sep-2022 11:06                7531
ds-vector.sorted.php                               30-Sep-2022 11:06                7578
ds-vector.sum.php                                  30-Sep-2022 11:06                5204
ds-vector.toarray.php                              30-Sep-2022 11:06                4018
ds-vector.unshift.php                              30-Sep-2022 11:06                4857
ds.constants.php                                   30-Sep-2022 11:06                1109
ds.examples.php                                    30-Sep-2022 11:06                4917
ds.installation.php                                30-Sep-2022 11:06                2473
ds.requirements.php                                30-Sep-2022 11:06                1164
ds.setup.php                                       30-Sep-2022 11:06                1383
eio.configuration.php                              30-Sep-2022 11:06                1208
eio.constants.php                                  30-Sep-2022 11:06               16098
eio.examples.php                                   30-Sep-2022 11:06               29538
eio.installation.php                               30-Sep-2022 11:06                1659
eio.requirements.php                               30-Sep-2022 11:06                1284
eio.resources.php                                  30-Sep-2022 11:06                1193
eio.setup.php                                      30-Sep-2022 11:06                1537
emptyiterator.current.php                          30-Sep-2022 11:06                2693
emptyiterator.key.php                              30-Sep-2022 11:06                2657
emptyiterator.next.php                             30-Sep-2022 11:06                2356
emptyiterator.rewind.php                           30-Sep-2022 11:06                2378
emptyiterator.valid.php                            30-Sep-2022 11:06                2350
enchant.configuration.php                          30-Sep-2022 11:06                1238
enchant.constants.php                              30-Sep-2022 11:06                2533
enchant.examples.php                               30-Sep-2022 11:06                5852
enchant.installation.php                           30-Sep-2022 11:06                3149
enchant.requirements.php                           30-Sep-2022 11:06                1767
enchant.resources.php                              30-Sep-2022 11:06                1300
enchant.setup.php                                  30-Sep-2022 11:06                1582
error.clone.php                                    30-Sep-2022 11:06                2800
error.construct.php                                30-Sep-2022 11:06                3261
error.getcode.php                                  30-Sep-2022 11:06                4013
error.getfile.php                                  30-Sep-2022 11:06                3774
error.getline.php                                  30-Sep-2022 11:06                4050
error.getmessage.php                               30-Sep-2022 11:06                3853
error.getprevious.php                              30-Sep-2022 11:06                6922
error.gettrace.php                                 30-Sep-2022 11:06                4227
error.gettraceasstring.php                         30-Sep-2022 11:06                4114
error.tostring.php                                 30-Sep-2022 11:06                3935
errorexception.construct.php                       30-Sep-2022 11:06                5468
errorexception.getseverity.php                     30-Sep-2022 11:06                4373
errorfunc.configuration.php                        30-Sep-2022 11:06               22516
errorfunc.constants.php                            30-Sep-2022 11:06               10126
errorfunc.examples.php                             30-Sep-2022 11:06               24024
errorfunc.installation.php                         30-Sep-2022 11:06                1236
errorfunc.requirements.php                         30-Sep-2022 11:06                1212
errorfunc.resources.php                            30-Sep-2022 11:06                1195
errorfunc.setup.php                                30-Sep-2022 11:06                1599
ev.backend.php                                     30-Sep-2022 11:06                3401
ev.configuration.php                               30-Sep-2022 11:06                1203
ev.depth.php                                       30-Sep-2022 11:06                3179
ev.embeddablebackends.php                          30-Sep-2022 11:06                6940
ev.examples.php                                    30-Sep-2022 11:06               47812
ev.feedsignal.php                                  30-Sep-2022 11:06                3285
ev.feedsignalevent.php                             30-Sep-2022 11:06                3072
ev.global.constants.php                            30-Sep-2022 11:06                1264
ev.installation.php                                30-Sep-2022 11:06                1647
ev.iteration.php                                   30-Sep-2022 11:06                2553
ev.now.php                                         30-Sep-2022 11:06                3024
ev.nowupdate.php                                   30-Sep-2022 11:06                3163
ev.periodic-modes.php                              30-Sep-2022 11:06                7867
ev.recommendedbackends.php                         30-Sep-2022 11:06                7682
ev.requirements.php                                30-Sep-2022 11:06                1219
ev.resources.php                                   30-Sep-2022 11:06                1153
ev.resume.php                                      30-Sep-2022 11:06                3753
ev.run.php                                         30-Sep-2022 11:06                4779
ev.setup.php                                       30-Sep-2022 11:06                1492
ev.sleep.php                                       30-Sep-2022 11:06                2331
ev.stop.php                                        30-Sep-2022 11:06                2801
ev.supportedbackends.php                           30-Sep-2022 11:06                6922
ev.suspend.php                                     30-Sep-2022 11:06                3486
ev.time.php                                        30-Sep-2022 11:06                2598
ev.verify.php                                      30-Sep-2022 11:06                2230
ev.watcher-callbacks.php                           30-Sep-2022 11:06                4117
ev.watchers.php                                    30-Sep-2022 11:06                3459
evcheck.construct.php                              30-Sep-2022 11:06                3642
evcheck.createstopped.php                          30-Sep-2022 11:06                3511
evchild.construct.php                              30-Sep-2022 11:06                6426
evchild.createstopped.php                          30-Sep-2022 11:06                4951
evchild.set.php                                    30-Sep-2022 11:06                3066
evembed.construct.php                              30-Sep-2022 11:06                8483
evembed.createstopped.php                          30-Sep-2022 11:06                4681
evembed.set.php                                    30-Sep-2022 11:06                2453
evembed.sweep.php                                  30-Sep-2022 11:06                3034
event.add.php                                      30-Sep-2022 11:06               11118
event.addsignal.php                                30-Sep-2022 11:06                1638
event.addtimer.php                                 30-Sep-2022 11:06                1647
event.callbacks.php                                30-Sep-2022 11:06                5402
event.configuration.php                            30-Sep-2022 11:06                1224
event.construct.php                                30-Sep-2022 11:06                4749
event.constructing.signal.events.php               30-Sep-2022 11:06                6854
event.del.php                                      30-Sep-2022 11:06                2470
event.delsignal.php                                30-Sep-2022 11:06                1638
event.deltimer.php                                 30-Sep-2022 11:06                1635
event.examples.php                                 30-Sep-2022 11:06              198992
event.flags.php                                    30-Sep-2022 11:06                2320
event.free.php                                     30-Sep-2022 11:06                2939
event.getsupportedmethods.php                      30-Sep-2022 11:06                2595
event.installation.php                             30-Sep-2022 11:06                1674
event.pending.php                                  30-Sep-2022 11:06                2662
event.persistence.php                              30-Sep-2022 11:06                2752
event.requirements.php                             30-Sep-2022 11:06                1437
event.resources.php                                30-Sep-2022 11:06                1151
event.set.php                                      30-Sep-2022 11:06                4512
event.setpriority.php                              30-Sep-2022 11:06                2380
event.settimer.php                                 30-Sep-2022 11:06                4028
event.setup.php                                    30-Sep-2022 11:06                1531
event.signal.php                                   30-Sep-2022 11:06                4239
event.timer.php                                    30-Sep-2022 11:06                3570
eventbase.construct.php                            30-Sep-2022 11:06                2798
eventbase.dispatch.php                             30-Sep-2022 11:06                3215
eventbase.exit.php                                 30-Sep-2022 11:06                2892
eventbase.free.php                                 30-Sep-2022 11:06                3294
eventbase.getfeatures.php                          30-Sep-2022 11:06                5989
eventbase.getmethod.php                            30-Sep-2022 11:06                4619
eventbase.gettimeofdaycached.php                   30-Sep-2022 11:06                2636
eventbase.gotexit.php                              30-Sep-2022 11:06                3212
eventbase.gotstop.php                              30-Sep-2022 11:06                3184
eventbase.loop.php                                 30-Sep-2022 11:06                3452
eventbase.priorityinit.php                         30-Sep-2022 11:06                2869
eventbase.reinit.php                               30-Sep-2022 11:06                2241
eventbase.stop.php                                 30-Sep-2022 11:06                2738
eventbuffer.add.php                                30-Sep-2022 11:06                2868
eventbuffer.addbuffer.php                          30-Sep-2022 11:06                3280
eventbuffer.appendfrom.php                         30-Sep-2022 11:06                4868
eventbuffer.construct.php                          30-Sep-2022 11:06                2141
eventbuffer.copyout.php                            30-Sep-2022 11:06                3813
eventbuffer.drain.php                              30-Sep-2022 11:06                3360
eventbuffer.enablelocking.php                      30-Sep-2022 11:06                2872
eventbuffer.expand.php                             30-Sep-2022 11:06                2653
eventbuffer.freeze.php                             30-Sep-2022 11:06                2917
eventbuffer.lock.php                               30-Sep-2022 11:06                3014
eventbuffer.prepend.php                            30-Sep-2022 11:06                3373
eventbuffer.prependbuffer.php                      30-Sep-2022 11:06                3595
eventbuffer.pullup.php                             30-Sep-2022 11:06                4569
eventbuffer.read.php                               30-Sep-2022 11:06                4835
eventbuffer.readfrom.php                           30-Sep-2022 11:06                4320
eventbuffer.readline.php                           30-Sep-2022 11:06                4144
eventbuffer.search.php                             30-Sep-2022 11:06                8717
eventbuffer.searcheol.php                          30-Sep-2022 11:06                4643
eventbuffer.substr.php                             30-Sep-2022 11:06                3306
eventbuffer.unfreeze.php                           30-Sep-2022 11:06                2931
eventbuffer.unlock.php                             30-Sep-2022 11:06                2698
eventbuffer.write.php                              30-Sep-2022 11:06                3423
eventbufferevent.about.callbacks.php               30-Sep-2022 11:06                5612
eventbufferevent.close.php                         30-Sep-2022 11:06                2462
eventbufferevent.connect.php                       30-Sep-2022 11:06               27059
eventbufferevent.connecthost.php                   30-Sep-2022 11:06               18524
eventbufferevent.construct.php                     30-Sep-2022 11:06                6893
eventbufferevent.createpair.php                    30-Sep-2022 11:06                4037
eventbufferevent.disable.php                       30-Sep-2022 11:06                3167
eventbufferevent.enable.php                        30-Sep-2022 11:06                3431
eventbufferevent.free.php                          30-Sep-2022 11:06                2769
eventbufferevent.getdnserrorstring.php             30-Sep-2022 11:06                3063
eventbufferevent.getenabled.php                    30-Sep-2022 11:06                3029
eventbufferevent.getinput.php                      30-Sep-2022 11:06                5201
eventbufferevent.getoutput.php                     30-Sep-2022 11:06                8357
eventbufferevent.read.php                          30-Sep-2022 11:06                2974
eventbufferevent.readbuffer.php                    30-Sep-2022 11:06                3117
eventbufferevent.setcallbacks.php                  30-Sep-2022 11:06                4619
eventbufferevent.setpriority.php                   30-Sep-2022 11:06                2763
eventbufferevent.settimeouts.php                   30-Sep-2022 11:06                2933
eventbufferevent.setwatermark.php                  30-Sep-2022 11:06                3834
eventbufferevent.sslerror.php                      30-Sep-2022 11:06                6344
eventbufferevent.sslfilter.php                     30-Sep-2022 11:06               41033
eventbufferevent.sslgetcipherinfo.php              30-Sep-2022 11:06                2829
eventbufferevent.sslgetciphername.php              30-Sep-2022 11:06                2715
eventbufferevent.sslgetcipherversion.php           30-Sep-2022 11:06                2744
eventbufferevent.sslgetprotocol.php                30-Sep-2022 11:06                2673
eventbufferevent.sslrenegotiate.php                30-Sep-2022 11:06                2805
eventbufferevent.sslsocket.php                     30-Sep-2022 11:06                5512
eventbufferevent.write.php                         30-Sep-2022 11:06                3085
eventbufferevent.writebuffer.php                   30-Sep-2022 11:06                3254
eventconfig.avoidmethod.php                        30-Sep-2022 11:06                4292
eventconfig.construct.php                          30-Sep-2022 11:06                4521
eventconfig.requirefeatures.php                    30-Sep-2022 11:06                6102
eventconfig.setflags.php                           30-Sep-2022 11:06                3172
eventconfig.setmaxdispatchinterval.php             30-Sep-2022 11:06                4288
eventdnsbase.addnameserverip.php                   30-Sep-2022 11:06                2787
eventdnsbase.addsearch.php                         30-Sep-2022 11:06                2483
eventdnsbase.clearsearch.php                       30-Sep-2022 11:06                2803
eventdnsbase.construct.php                         30-Sep-2022 11:06                3225
eventdnsbase.countnameservers.php                  30-Sep-2022 11:06                2479
eventdnsbase.loadhosts.php                         30-Sep-2022 11:06                2660
eventdnsbase.parseresolvconf.php                   30-Sep-2022 11:06                4078
eventdnsbase.setoption.php                         30-Sep-2022 11:06                3178
eventdnsbase.setsearchndots.php                    30-Sep-2022 11:06                2724
eventhttp.accept.php                               30-Sep-2022 11:06               13288
eventhttp.addserveralias.php                       30-Sep-2022 11:06                6489
eventhttp.bind.php                                 30-Sep-2022 11:06                7887
eventhttp.construct.php                            30-Sep-2022 11:06               19950
eventhttp.removeserveralias.php                    30-Sep-2022 11:06                3063
eventhttp.setallowedmethods.php                    30-Sep-2022 11:06                3324
eventhttp.setcallback.php                          30-Sep-2022 11:06               19793
eventhttp.setdefaultcallback.php                   30-Sep-2022 11:06                7855
eventhttp.setmaxbodysize.php                       30-Sep-2022 11:06                2852
eventhttp.setmaxheaderssize.php                    30-Sep-2022 11:06                2764
eventhttp.settimeout.php                           30-Sep-2022 11:06                2438
eventhttpconnection.construct.php                  30-Sep-2022 11:06                5216
eventhttpconnection.getbase.php                    30-Sep-2022 11:06                2560
eventhttpconnection.getpeer.php                    30-Sep-2022 11:06                2898
eventhttpconnection.makerequest.php                30-Sep-2022 11:06               12589
eventhttpconnection.setclosecallback.php           30-Sep-2022 11:06               11821
eventhttpconnection.setlocaladdress.php            30-Sep-2022 11:06                3149
eventhttpconnection.setlocalport.php               30-Sep-2022 11:06                3030
eventhttpconnection.setmaxbodysize.php             30-Sep-2022 11:06                3074
eventhttpconnection.setmaxheaderssize.php          30-Sep-2022 11:06                3095
eventhttpconnection.setretries.php                 30-Sep-2022 11:06                2668
eventhttpconnection.settimeout.php                 30-Sep-2022 11:06                2565
eventhttprequest.addheader.php                     30-Sep-2022 11:06                3675
eventhttprequest.cancel.php                        30-Sep-2022 11:06                2823
eventhttprequest.clearheaders.php                  30-Sep-2022 11:06                2788
eventhttprequest.closeconnection.php               30-Sep-2022 11:06                2378
eventhttprequest.construct.php                     30-Sep-2022 11:06               12717
eventhttprequest.findheader.php                    30-Sep-2022 11:06                3363
eventhttprequest.free.php                          30-Sep-2022 11:06                2286
eventhttprequest.getbufferevent.php                30-Sep-2022 11:06                3685
eventhttprequest.getcommand.php                    30-Sep-2022 11:06                2651
eventhttprequest.getconnection.php                 30-Sep-2022 11:06                4454
eventhttprequest.gethost.php                       30-Sep-2022 11:06                2821
eventhttprequest.getinputbuffer.php                30-Sep-2022 11:06                2768
eventhttprequest.getinputheaders.php               30-Sep-2022 11:06                2801
eventhttprequest.getoutputbuffer.php               30-Sep-2022 11:06                2827
eventhttprequest.getoutputheaders.php              30-Sep-2022 11:06                2785
eventhttprequest.getresponsecode.php               30-Sep-2022 11:06                3118
eventhttprequest.geturi.php                        30-Sep-2022 11:06                3029
eventhttprequest.removeheader.php                  30-Sep-2022 11:06                3374
eventhttprequest.senderror.php                     30-Sep-2022 11:06                5708
eventhttprequest.sendreply.php                     30-Sep-2022 11:06                3950
eventhttprequest.sendreplychunk.php                30-Sep-2022 11:06                3432
eventhttprequest.sendreplyend.php                  30-Sep-2022 11:06                3036
eventhttprequest.sendreplystart.php                30-Sep-2022 11:06                4205
eventlistener.construct.php                        30-Sep-2022 11:06               27659
eventlistener.disable.php                          30-Sep-2022 11:06                2674
eventlistener.enable.php                           30-Sep-2022 11:06                2660
eventlistener.getbase.php                          30-Sep-2022 11:06                2290
eventlistener.getsocketname.php                    30-Sep-2022 11:06                3200
eventlistener.setcallback.php                      30-Sep-2022 11:06                5725
eventlistener.seterrorcallback.php                 30-Sep-2022 11:06                4242
eventsslcontext.construct.php                      30-Sep-2022 11:06                5825
eventutil.construct.php                            30-Sep-2022 11:06                2339
eventutil.getlastsocketerrno.php                   30-Sep-2022 11:06                3236
eventutil.getlastsocketerror.php                   30-Sep-2022 11:06                3101
eventutil.getsocketfd.php                          30-Sep-2022 11:06                3140
eventutil.getsocketname.php                        30-Sep-2022 11:06                3648
eventutil.setsocketoption.php                      30-Sep-2022 11:06                5510
eventutil.sslrandpoll.php                          30-Sep-2022 11:06                2328
evfork.construct.php                               30-Sep-2022 11:06                3617
evfork.createstopped.php                           30-Sep-2022 11:06                3713
evidle.construct.php                               30-Sep-2022 11:06                3672
evidle.createstopped.php                           30-Sep-2022 11:06                4029
evio.construct.php                                 30-Sep-2022 11:06                4720
evio.createstopped.php                             30-Sep-2022 11:06                5095
evio.set.php                                       30-Sep-2022 11:06                2795
evloop.backend.php                                 30-Sep-2022 11:06                2654
evloop.check.php                                   30-Sep-2022 11:06                3115
evloop.child.php                                   30-Sep-2022 11:06                3477
evloop.construct.php                               30-Sep-2022 11:06                3912
evloop.defaultloop.php                             30-Sep-2022 11:06                4508
evloop.embed.php                                   30-Sep-2022 11:06                3580
evloop.fork.php                                    30-Sep-2022 11:06                3309
evloop.idle.php                                    30-Sep-2022 11:06                3329
evloop.invokepending.php                           30-Sep-2022 11:06                2193
evloop.io.php                                      30-Sep-2022 11:06                3748
evloop.loopfork.php                                30-Sep-2022 11:06                2493
evloop.now.php                                     30-Sep-2022 11:06                2768
evloop.nowupdate.php                               30-Sep-2022 11:06                3140
evloop.periodic.php                                30-Sep-2022 11:06                3787
evloop.prepare.php                                 30-Sep-2022 11:06                3327
evloop.resume.php                                  30-Sep-2022 11:06                2800
evloop.run.php                                     30-Sep-2022 11:06                4745
evloop.signal.php                                  30-Sep-2022 11:06                3574
evloop.stat.php                                    30-Sep-2022 11:06                3695
evloop.stop.php                                    30-Sep-2022 11:06                2928
evloop.suspend.php                                 30-Sep-2022 11:06                2792
evloop.timer.php                                   30-Sep-2022 11:06                3714
evloop.verify.php                                  30-Sep-2022 11:06                2567
evperiodic.again.php                               30-Sep-2022 11:06                2540
evperiodic.at.php                                  30-Sep-2022 11:06                2558
evperiodic.construct.php                           30-Sep-2022 11:06               10171
evperiodic.createstopped.php                       30-Sep-2022 11:06                5651
evperiodic.set.php                                 30-Sep-2022 11:06                3053
evprepare.construct.php                            30-Sep-2022 11:06                3397
evprepare.createstopped.php                        30-Sep-2022 11:06                4261
evsignal.construct.php                             30-Sep-2022 11:06                5491
evsignal.createstopped.php                         30-Sep-2022 11:06                4749
evsignal.set.php                                   30-Sep-2022 11:06                2407
evstat.attr.php                                    30-Sep-2022 11:06                8669
evstat.construct.php                               30-Sep-2022 11:06                7415
evstat.createstopped.php                           30-Sep-2022 11:06                5045
evstat.prev.php                                    30-Sep-2022 11:06                2914
evstat.set.php                                     30-Sep-2022 11:06                2728
evstat.stat.php                                    30-Sep-2022 11:06                2834
evtimer.again.php                                  30-Sep-2022 11:06                3035
evtimer.construct.php                              30-Sep-2022 11:06               13523
evtimer.createstopped.php                          30-Sep-2022 11:06                8507
evtimer.set.php                                    30-Sep-2022 11:06                2870
evwatcher.clear.php                                30-Sep-2022 11:06                2747
evwatcher.construct.php                            30-Sep-2022 11:06                2084
evwatcher.feed.php                                 30-Sep-2022 11:06                2520
evwatcher.getloop.php                              30-Sep-2022 11:06                2289
evwatcher.invoke.php                               30-Sep-2022 11:06                2527
evwatcher.keepalive.php                            30-Sep-2022 11:06                5124
evwatcher.setcallback.php                          30-Sep-2022 11:06                2540
evwatcher.start.php                                30-Sep-2022 11:06                2482
evwatcher.stop.php                                 30-Sep-2022 11:06                2451
example.xml-external-entity.php                    30-Sep-2022 11:06               26027
example.xml-map-tags.php                           30-Sep-2022 11:06                9083
example.xml-structure.php                          30-Sep-2022 11:06                6942
example.xmlwriter-namespace.php                    30-Sep-2022 11:06                5477
example.xmlwriter-oop.php                          30-Sep-2022 11:06                3405
example.xmlwriter-simple.php                       30-Sep-2022 11:06                8928
exception.clone.php                                30-Sep-2022 11:06                2847
exception.construct.php                            30-Sep-2022 11:06                3680
exception.getcode.php                              30-Sep-2022 11:06                4601
exception.getfile.php                              30-Sep-2022 11:06                3918
exception.getline.php                              30-Sep-2022 11:06                4162
exception.getmessage.php                           30-Sep-2022 11:06                3966
exception.getprevious.php                          30-Sep-2022 11:06                7194
exception.gettrace.php                             30-Sep-2022 11:06                4350
exception.gettraceasstring.php                     30-Sep-2022 11:06                4206
exception.tostring.php                             30-Sep-2022 11:06                4053
exec.configuration.php                             30-Sep-2022 11:06                1217
exec.constants.php                                 30-Sep-2022 11:06                1155
exec.installation.php                              30-Sep-2022 11:06                1201
exec.requirements.php                              30-Sep-2022 11:06                1177
exec.resources.php                                 30-Sep-2022 11:06                1325
exec.setup.php                                     30-Sep-2022 11:06                1557
exif.configuration.php                             30-Sep-2022 11:06                7116
exif.constants.php                                 30-Sep-2022 11:06                1895
exif.installation.php                              30-Sep-2022 11:06                1693
exif.requirements.php                              30-Sep-2022 11:06                1780
exif.resources.php                                 30-Sep-2022 11:06                1160
exif.setup.php                                     30-Sep-2022 11:06                1551
expect.configuration.php                           30-Sep-2022 11:06                5079
expect.constants.php                               30-Sep-2022 11:06                3245
expect.examples-usage.php                          30-Sep-2022 11:06               17172
expect.examples.php                                30-Sep-2022 11:06                1360
expect.installation.php                            30-Sep-2022 11:06                2334
expect.requirements.php                            30-Sep-2022 11:06                1301
expect.resources.php                               30-Sep-2022 11:06                1404
expect.setup.php                                   30-Sep-2022 11:06                1575
ext-weakmap.construct.php                          30-Sep-2022 11:06                1853
extensions.alphabetical.php                        30-Sep-2022 11:06               20610
extensions.membership.php                          30-Sep-2022 11:06               20340
extensions.php                                     30-Sep-2022 11:06                1645
extensions.state.php                               30-Sep-2022 11:06                2724
fann.configuration.php                             30-Sep-2022 11:06                1217
fann.constants.php                                 30-Sep-2022 11:06               17659
fann.examples-1.php                                30-Sep-2022 11:06                9055
fann.examples.php                                  30-Sep-2022 11:06                1314
fann.installation.php                              30-Sep-2022 11:06                5005
fann.requirements.php                              30-Sep-2022 11:06                1145
fann.resources.php                                 30-Sep-2022 11:06                1114
fann.setup.php                                     30-Sep-2022 11:06                1522
fannconnection.construct.php                       30-Sep-2022 11:06                2816
fannconnection.getfromneuron.php                   30-Sep-2022 11:06                2284
fannconnection.gettoneuron.php                     30-Sep-2022 11:06                2272
fannconnection.getweight.php                       30-Sep-2022 11:06                2240
fannconnection.setweight.php                       30-Sep-2022 11:06                2839
faq.build.php                                      30-Sep-2022 11:06               24668
faq.com.php                                        30-Sep-2022 11:06               12329
faq.databases.php                                  30-Sep-2022 11:06                8241
faq.general.php                                    30-Sep-2022 11:06                5031
faq.html.php                                       30-Sep-2022 11:06               21296
faq.installation.php                               30-Sep-2022 11:06               26777
faq.mailinglist.php                                30-Sep-2022 11:06               11349
faq.misc.php                                       30-Sep-2022 11:06                4477
faq.obtaining.php                                  30-Sep-2022 11:06               10945
faq.passwords.php                                  30-Sep-2022 11:06               10276
faq.php                                            30-Sep-2022 11:06                2003
faq.using.php                                      30-Sep-2022 11:06               24046
fdf.configuration.php                              30-Sep-2022 11:06                1210
fdf.constants.php                                  30-Sep-2022 11:06                6259
fdf.examples.php                                   30-Sep-2022 11:06                7766
fdf.installation.php                               30-Sep-2022 11:06                3570
fdf.requirements.php                               30-Sep-2022 11:06                1588
fdf.resources.php                                  30-Sep-2022 11:06                1746
fdf.setup.php                                      30-Sep-2022 11:06                1531
features.commandline.differences.php               30-Sep-2022 11:06               12458
features.commandline.ini.php                       30-Sep-2022 11:06                2181
features.commandline.interactive.php               30-Sep-2022 11:06                9184
features.commandline.introduction.php              30-Sep-2022 11:06                6689
features.commandline.io-streams.php                30-Sep-2022 11:06                6086
features.commandline.options.php                   30-Sep-2022 11:06               26726
features.commandline.php                           30-Sep-2022 11:06                2002
features.commandline.usage.php                     30-Sep-2022 11:06               14849
features.commandline.webserver.php                 30-Sep-2022 11:06               13554
features.connection-handling.php                   30-Sep-2022 11:06                6325
features.cookies.php                               30-Sep-2022 11:06                3152
features.dtrace.dtrace.php                         30-Sep-2022 11:06               14729
features.dtrace.introduction.php                   30-Sep-2022 11:06                3721
features.dtrace.php                                30-Sep-2022 11:06                1699
features.dtrace.systemtap.php                      30-Sep-2022 11:06                8207
features.file-upload.common-pitfalls.php           30-Sep-2022 11:06                5133
features.file-upload.errors.php                    30-Sep-2022 11:06                3946
features.file-upload.errors.seealso.php            30-Sep-2022 11:06                1333
features.file-upload.multiple.php                  30-Sep-2022 11:06                6789
features.file-upload.php                           30-Sep-2022 11:06                1842
features.file-upload.post-method.php               30-Sep-2022 11:06               16691
features.file-upload.put-method.php                30-Sep-2022 11:06                5741
features.gc.collecting-cycles.php                  30-Sep-2022 11:06                8899
features.gc.performance-considerations.php         30-Sep-2022 11:06               15060
features.gc.php                                    30-Sep-2022 11:06                1814
features.gc.refcounting-basics.php                 30-Sep-2022 11:06               22516
features.http-auth.php                             30-Sep-2022 11:06               26092
features.persistent-connections.php                30-Sep-2022 11:06                9304
features.php                                       30-Sep-2022 11:06                4153
features.remote-files.php                          30-Sep-2022 11:06                8683
features.session.security.management.php           30-Sep-2022 11:06               27093
features.sessions.php                              30-Sep-2022 11:06                1404
features.xforms.php                                30-Sep-2022 11:06                5482
ffi-ctype.getalignment.php                         30-Sep-2022 11:06                2276
ffi-ctype.getarrayelementtype.php                  30-Sep-2022 11:06                2420
ffi-ctype.getarraylength.php                       30-Sep-2022 11:06                2319
ffi-ctype.getattributes.php                        30-Sep-2022 11:06                2295
ffi-ctype.getenumkind.php                          30-Sep-2022 11:06                2271
ffi-ctype.getfuncabi.php                           30-Sep-2022 11:06                2279
ffi-ctype.getfuncparametercount.php                30-Sep-2022 11:06                2385
ffi-ctype.getfuncparametertype.php                 30-Sep-2022 11:06                2628
ffi-ctype.getfuncreturntype.php                    30-Sep-2022 11:06                2402
ffi-ctype.getkind.php                              30-Sep-2022 11:06                2233
ffi-ctype.getname.php                              30-Sep-2022 11:06                2237
ffi-ctype.getpointertype.php                       30-Sep-2022 11:06                2346
ffi-ctype.getsize.php                              30-Sep-2022 11:06                2251
ffi-ctype.getstructfieldnames.php                  30-Sep-2022 11:06                2361
ffi-ctype.getstructfieldoffset.php                 30-Sep-2022 11:06                2564
ffi-ctype.getstructfieldtype.php                   30-Sep-2022 11:06                2584
ffi.addr.php                                       30-Sep-2022 11:06                2755
ffi.alignof.php                                    30-Sep-2022 11:06                2827
ffi.arraytype.php                                  30-Sep-2022 11:06                4446
ffi.cast.php                                       30-Sep-2022 11:06                4892
ffi.cdef.php                                       30-Sep-2022 11:06                4132
ffi.configuration.php                              30-Sep-2022 11:06                4075
ffi.constants.php                                  30-Sep-2022 11:06                1104
ffi.examples-basic.php                             30-Sep-2022 11:06               17302
ffi.examples-callback.php                          30-Sep-2022 11:06                5065
ffi.examples-complete.php                          30-Sep-2022 11:06                5822
ffi.examples.php                                   30-Sep-2022 11:06                1471
ffi.free.php                                       30-Sep-2022 11:06                2379
ffi.installation.php                               30-Sep-2022 11:06                1386
ffi.isnull.php                                     30-Sep-2022 11:06                2356
ffi.load.php                                       30-Sep-2022 11:06                4148
ffi.memcmp.php                                     30-Sep-2022 11:06                3746
ffi.memcpy.php                                     30-Sep-2022 11:06                3121
ffi.memset.php                                     30-Sep-2022 11:06                2963
ffi.new.php                                        30-Sep-2022 11:06                5277
ffi.requirements.php                               30-Sep-2022 11:06                1241
ffi.resources.php                                  30-Sep-2022 11:06                1153
ffi.scope.php                                      30-Sep-2022 11:06                3060
ffi.setup.php                                      30-Sep-2022 11:06                1520
ffi.sizeof.php                                     30-Sep-2022 11:06                2668
ffi.string.php                                     30-Sep-2022 11:06                3639
ffi.type.php                                       30-Sep-2022 11:06                3520
ffi.typeof.php                                     30-Sep-2022 11:06                2819
fiber.construct.php                                30-Sep-2022 11:06                2324
fiber.getcurrent.php                               30-Sep-2022 11:06                2370
fiber.getreturn.php                                30-Sep-2022 11:06                2591
fiber.isrunning.php                                30-Sep-2022 11:06                2536
fiber.isstarted.php                                30-Sep-2022 11:06                2150
fiber.issuspended.php                              30-Sep-2022 11:06                2165
fiber.isterminated.php                             30-Sep-2022 11:06                2222
fiber.resume.php                                   30-Sep-2022 11:06                3285
fiber.start.php                                    30-Sep-2022 11:06                3013
fiber.suspend.php                                  30-Sep-2022 11:06                4052
fiber.throw.php                                    30-Sep-2022 11:06                3155
fibererror.construct.php                           30-Sep-2022 11:06                2148
fileinfo.configuration.php                         30-Sep-2022 11:06                1245
fileinfo.constants.php                             30-Sep-2022 11:06                4848
fileinfo.installation.php                          30-Sep-2022 11:06                1740
fileinfo.requirements.php                          30-Sep-2022 11:06                1205
fileinfo.resources.php                             30-Sep-2022 11:06                1401
fileinfo.setup.php                                 30-Sep-2022 11:06                1597
filesystem.configuration.php                       30-Sep-2022 11:06                7034
filesystem.constants.php                           30-Sep-2022 11:06                8829
filesystem.installation.php                        30-Sep-2022 11:06                1243
filesystem.requirements.php                        30-Sep-2022 11:06                1219
filesystem.resources.php                           30-Sep-2022 11:06                1344
filesystem.setup.php                               30-Sep-2022 11:06                1624
filesystemiterator.construct.php                   30-Sep-2022 11:06                6975
filesystemiterator.current.php                     30-Sep-2022 11:06                5369
filesystemiterator.getflags.php                    30-Sep-2022 11:06                3138
filesystemiterator.key.php                         30-Sep-2022 11:06                5261
filesystemiterator.next.php                        30-Sep-2022 11:06                4546
filesystemiterator.rewind.php                      30-Sep-2022 11:06                5165
filesystemiterator.setflags.php                    30-Sep-2022 11:06                6718
filter.configuration.php                           30-Sep-2022 11:06                5029
filter.constants.php                               30-Sep-2022 11:06               18114
filter.examples.php                                30-Sep-2022 11:06                1421
filter.examples.sanitization.php                   30-Sep-2022 11:06                6078
filter.examples.validation.php                     30-Sep-2022 11:06               11170
filter.filters.flags.php                           30-Sep-2022 11:06               12617
filter.filters.misc.php                            30-Sep-2022 11:06                1883
filter.filters.php                                 30-Sep-2022 11:06                1603
filter.filters.sanitize.php                        30-Sep-2022 11:06               10605
filter.filters.validate.php                        30-Sep-2022 11:06               11622
filter.installation.php                            30-Sep-2022 11:06                1300
filter.requirements.php                            30-Sep-2022 11:06                1191
filter.resources.php                               30-Sep-2022 11:06                1159
filter.setup.php                                   30-Sep-2022 11:06                1561
filteriterator.accept.php                          30-Sep-2022 11:06                5484
filteriterator.construct.php                       30-Sep-2022 11:06                3077
filteriterator.current.php                         30-Sep-2022 11:06                3044
filteriterator.getinneriterator.php                30-Sep-2022 11:06                2497
filteriterator.key.php                             30-Sep-2022 11:06                2976
filteriterator.next.php                            30-Sep-2022 11:06                2917
filteriterator.rewind.php                          30-Sep-2022 11:06                3110
filteriterator.valid.php                           30-Sep-2022 11:06                2454
filters.compression.php                            30-Sep-2022 11:06               16911
filters.convert.php                                30-Sep-2022 11:06               12297
filters.encryption.php                             30-Sep-2022 11:06               46536
filters.php                                        30-Sep-2022 11:06                3609
filters.string.php                                 30-Sep-2022 11:06               10646
finfo.buffer.php                                   30-Sep-2022 11:06                2443
finfo.construct.php                                30-Sep-2022 11:06                2764
finfo.file.php                                     30-Sep-2022 11:06                2434
finfo.set-flags.php                                30-Sep-2022 11:06                1940
fpm.observability.php                              30-Sep-2022 11:06                1355
fpm.setup.php                                      30-Sep-2022 11:06                1272
fpm.status.php                                     30-Sep-2022 11:06                9935
ftp.configuration.php                              30-Sep-2022 11:06                1210
ftp.constants.php                                  30-Sep-2022 11:06                4094
ftp.examples-basic.php                             30-Sep-2022 11:06                5271
ftp.examples.php                                   30-Sep-2022 11:06                1334
ftp.installation.php                               30-Sep-2022 11:06                1435
ftp.requirements.php                               30-Sep-2022 11:06                1170
ftp.resources.php                                  30-Sep-2022 11:06                1477
ftp.setup.php                                      30-Sep-2022 11:06                1531
funchand.configuration.php                         30-Sep-2022 11:06                1245
funchand.constants.php                             30-Sep-2022 11:06                1167
funchand.installation.php                          30-Sep-2022 11:06                1229
funchand.requirements.php                          30-Sep-2022 11:06                1205
funchand.resources.php                             30-Sep-2022 11:06                1188
funchand.setup.php                                 30-Sep-2022 11:06                1583
funcref.php                                        30-Sep-2022 11:06               13985
function.abs.php                                   30-Sep-2022 11:06                5139
function.acos.php                                  30-Sep-2022 11:06                3350
function.acosh.php                                 30-Sep-2022 11:06                3197
function.addcslashes.php                           30-Sep-2022 11:06                8239
function.addslashes.php                            30-Sep-2022 11:06                6646
function.apache-child-terminate.php                30-Sep-2022 11:06                3442
function.apache-get-modules.php                    30-Sep-2022 11:06                3277
function.apache-get-version.php                    30-Sep-2022 11:06                3801
function.apache-getenv.php                         30-Sep-2022 11:06                4975
function.apache-lookup-uri.php                     30-Sep-2022 11:06                6057
function.apache-note.php                           30-Sep-2022 11:06                7289
function.apache-request-headers.php                30-Sep-2022 11:06                5765
function.apache-response-headers.php               30-Sep-2022 11:06                4290
function.apache-setenv.php                         30-Sep-2022 11:06                5485
function.apcu-add.php                              30-Sep-2022 11:06                8243
function.apcu-cache-info.php                       30-Sep-2022 11:06                6453
function.apcu-cas.php                              30-Sep-2022 11:06                8884
function.apcu-clear-cache.php                      30-Sep-2022 11:06                2480
function.apcu-dec.php                              30-Sep-2022 11:06                8020
function.apcu-delete.php                           30-Sep-2022 11:06                5983
function.apcu-enabled.php                          30-Sep-2022 11:06                2204
function.apcu-entry.php                            30-Sep-2022 11:06                8805
function.apcu-exists.php                           30-Sep-2022 11:06                7025
function.apcu-fetch.php                            30-Sep-2022 11:06                5684
function.apcu-inc.php                              30-Sep-2022 11:06                8004
function.apcu-key-info.php                         30-Sep-2022 11:06                4767
function.apcu-sma-info.php                         30-Sep-2022 11:06                4302
function.apcu-store.php                            30-Sep-2022 11:06                7045
function.array-change-key-case.php                 30-Sep-2022 11:06                5610
function.array-chunk.php                           30-Sep-2022 11:06                7388
function.array-column.php                          30-Sep-2022 11:06               18517
function.array-combine.php                         30-Sep-2022 11:06                7114
function.array-count-values.php                    30-Sep-2022 11:06                5565
function.array-diff-assoc.php                      30-Sep-2022 11:06               11360
function.array-diff-key.php                        30-Sep-2022 11:06               13450
function.array-diff-uassoc.php                     30-Sep-2022 11:06               12132
function.array-diff-ukey.php                       30-Sep-2022 11:06               12408
function.array-diff.php                            30-Sep-2022 11:06               12783
function.array-fill-keys.php                       30-Sep-2022 11:06                5434
function.array-fill.php                            30-Sep-2022 11:06                9201
function.array-filter.php                          30-Sep-2022 11:06               17314
function.array-flip.php                            30-Sep-2022 11:06                7221
function.array-intersect-assoc.php                 30-Sep-2022 11:06                9137
function.array-intersect-key.php                   30-Sep-2022 11:06               10701
function.array-intersect-uassoc.php                30-Sep-2022 11:06                8643
function.array-intersect-ukey.php                  30-Sep-2022 11:06               12186
function.array-intersect.php                       30-Sep-2022 11:06                7032
function.array-is-list.php                         30-Sep-2022 11:06                7182
function.array-key-exists.php                      30-Sep-2022 11:06                8788
function.array-key-first.php                       30-Sep-2022 11:06                7342
function.array-key-last.php                        30-Sep-2022 11:06                3184
function.array-keys.php                            30-Sep-2022 11:06                8542
function.array-map.php                             30-Sep-2022 11:06               28667
function.array-merge-recursive.php                 30-Sep-2022 11:06                6938
function.array-merge.php                           30-Sep-2022 11:06               12991
function.array-multisort.php                       30-Sep-2022 11:06               24418
function.array-pad.php                             30-Sep-2022 11:06                7205
function.array-pop.php                             30-Sep-2022 11:06                5664
function.array-product.php                         30-Sep-2022 11:06                4316
function.array-push.php                            30-Sep-2022 11:06                7215
function.array-rand.php                            30-Sep-2022 11:06                6833
function.array-reduce.php                          30-Sep-2022 11:06               10474
function.array-replace-recursive.php               30-Sep-2022 11:06               11486
function.array-replace.php                         30-Sep-2022 11:06                6844
function.array-reverse.php                         30-Sep-2022 11:06                6068
function.array-search.php                          30-Sep-2022 11:06                8403
function.array-shift.php                           30-Sep-2022 11:06                5777
function.array-slice.php                           30-Sep-2022 11:06               14023
function.array-splice.php                          30-Sep-2022 11:06               18029
function.array-sum.php                             30-Sep-2022 11:06                5002
function.array-udiff-assoc.php                     30-Sep-2022 11:06               14876
function.array-udiff-uassoc.php                    30-Sep-2022 11:06               16543
function.array-udiff.php                           30-Sep-2022 11:06               29696
function.array-uintersect-assoc.php                30-Sep-2022 11:06                8129
function.array-uintersect-uassoc.php               30-Sep-2022 11:06                8472
function.array-uintersect.php                      30-Sep-2022 11:06                7704
function.array-unique.php                          30-Sep-2022 11:06                9547
function.array-unshift.php                         30-Sep-2022 11:06                6104
function.array-values.php                          30-Sep-2022 11:06                4576
function.array-walk-recursive.php                  30-Sep-2022 11:06                7620
function.array-walk.php                            30-Sep-2022 11:06               14333
function.array.php                                 30-Sep-2022 11:06               12303
function.arsort.php                                30-Sep-2022 11:06                8491
function.asin.php                                  30-Sep-2022 11:06                3347
function.asinh.php                                 30-Sep-2022 11:06                3232
function.asort.php                                 30-Sep-2022 11:06                8474
function.assert-options.php                        30-Sep-2022 11:06               12401
function.assert.php                                30-Sep-2022 11:06               27560
function.atan.php                                  30-Sep-2022 11:06                3348
function.atan2.php                                 30-Sep-2022 11:06                3271
function.atanh.php                                 30-Sep-2022 11:06                3213
function.autoload.php                              30-Sep-2022 11:06                3184
function.base-convert.php                          30-Sep-2022 11:06                6758
function.base64-decode.php                         30-Sep-2022 11:06                4921
function.base64-encode.php                         30-Sep-2022 11:06                4734
function.basename.php                              30-Sep-2022 11:06                7593
function.bcadd.php                                 30-Sep-2022 11:06                5607
function.bccomp.php                                30-Sep-2022 11:06                5577
function.bcdiv.php                                 30-Sep-2022 11:06                5087
function.bcmod.php                                 30-Sep-2022 11:06                7375
function.bcmul.php                                 30-Sep-2022 11:06                7055
function.bcpow.php                                 30-Sep-2022 11:06                7053
function.bcpowmod.php                              30-Sep-2022 11:06                7039
function.bcscale.php                               30-Sep-2022 11:06                5394
function.bcsqrt.php                                30-Sep-2022 11:06                4691
function.bcsub.php                                 30-Sep-2022 11:06                5564
function.bin2hex.php                               30-Sep-2022 11:06                4512
function.bind-textdomain-codeset.php               30-Sep-2022 11:06                4349
function.bindec.php                                30-Sep-2022 11:06               15862
function.bindtextdomain.php                        30-Sep-2022 11:06                5349
function.boolval.php                               30-Sep-2022 11:06               10702
function.bzclose.php                               30-Sep-2022 11:06                2947
function.bzcompress.php                            30-Sep-2022 11:06                5040
function.bzdecompress.php                          30-Sep-2022 11:06                6317
function.bzerrno.php                               30-Sep-2022 11:06                3064
function.bzerror.php                               30-Sep-2022 11:06                4321
function.bzerrstr.php                              30-Sep-2022 11:06                3072
function.bzflush.php                               30-Sep-2022 11:06                3178
function.bzopen.php                                30-Sep-2022 11:06                4882
function.bzread.php                                30-Sep-2022 11:06                6564
function.bzwrite.php                               30-Sep-2022 11:06                6168
function.cal-days-in-month.php                     30-Sep-2022 11:06                4552
function.cal-from-jd.php                           30-Sep-2022 11:06                6903
function.cal-info.php                              30-Sep-2022 11:06                5992
function.cal-to-jd.php                             30-Sep-2022 11:06                5507
function.call-user-func-array.php                  30-Sep-2022 11:06               14287
function.call-user-func.php                        30-Sep-2022 11:06               15260
function.ceil.php                                  30-Sep-2022 11:06                4979
function.chdir.php                                 30-Sep-2022 11:06                5412
function.checkdate.php                             30-Sep-2022 11:06                5402
function.checkdnsrr.php                            30-Sep-2022 11:06                5070
function.chgrp.php                                 30-Sep-2022 11:06                6713
function.chmod.php                                 30-Sep-2022 11:06                9361
function.chop.php                                  30-Sep-2022 11:06                2015
function.chown.php                                 30-Sep-2022 11:06                6754
function.chr.php                                   30-Sep-2022 11:06                9268
function.chroot.php                                30-Sep-2022 11:06                4584
function.chunk-split.php                           30-Sep-2022 11:06                5273
function.class-alias.php                           30-Sep-2022 11:06                7397
function.class-exists.php                          30-Sep-2022 11:06                7286
function.class-implements.php                      30-Sep-2022 11:06                6266
function.class-parents.php                         30-Sep-2022 11:06                5953
function.class-uses.php                            30-Sep-2022 11:06                6038
function.clearstatcache.php                        30-Sep-2022 11:06               10995
function.cli-get-process-title.php                 30-Sep-2022 11:06                4305
function.cli-set-process-title.php                 30-Sep-2022 11:06                5689
function.closedir.php                              30-Sep-2022 11:06                5071
function.closelog.php                              30-Sep-2022 11:06                2913
function.com-create-guid.php                       30-Sep-2022 11:06                2731
function.com-event-sink.php                        30-Sep-2022 11:06               10466
function.com-get-active-object.php                 30-Sep-2022 11:06                5416
function.com-load-typelib.php                      30-Sep-2022 11:06                5103
function.com-message-pump.php                      30-Sep-2022 11:06                3777
function.com-print-typeinfo.php                    30-Sep-2022 11:06                4666
function.commonmark-parse.php                      30-Sep-2022 11:06                3522
function.commonmark-render-html.php                30-Sep-2022 11:06                3958
function.commonmark-render-latex.php               30-Sep-2022 11:06                4234
function.commonmark-render-man.php                 30-Sep-2022 11:06                4216
function.commonmark-render-xml.php                 30-Sep-2022 11:06                3915
function.commonmark-render.php                     30-Sep-2022 11:06                4162
function.compact.php                               30-Sep-2022 11:06                7727
function.connection-aborted.php                    30-Sep-2022 11:06                3084
function.connection-status.php                     30-Sep-2022 11:06                3168
function.constant.php                              30-Sep-2022 11:06                7790
function.convert-cyr-string.php                    30-Sep-2022 11:06                4982
function.convert-uudecode.php                      30-Sep-2022 11:06                4373
function.convert-uuencode.php                      30-Sep-2022 11:06                5421
function.copy.php                                  30-Sep-2022 11:06                5829
function.cos.php                                   30-Sep-2022 11:06                3930
function.cosh.php                                  30-Sep-2022 11:06                3162
function.count-chars.php                           30-Sep-2022 11:06                7419
function.count.php                                 30-Sep-2022 11:06               16723
function.crc32.php                                 30-Sep-2022 11:06                7239
function.create-function.php                       30-Sep-2022 11:06               34459
function.crypt.php                                 30-Sep-2022 11:06               19454
function.ctype-alnum.php                           30-Sep-2022 11:06                6774
function.ctype-alpha.php                           30-Sep-2022 11:06                7120
function.ctype-cntrl.php                           30-Sep-2022 11:06                6681
function.ctype-digit.php                           30-Sep-2022 11:06                9103
function.ctype-graph.php                           30-Sep-2022 11:06                7480
function.ctype-lower.php                           30-Sep-2022 11:06                6798
function.ctype-print.php                           30-Sep-2022 11:06                7508
function.ctype-punct.php                           30-Sep-2022 11:06                6790
function.ctype-space.php                           30-Sep-2022 11:06                7627
function.ctype-upper.php                           30-Sep-2022 11:06                6842
function.ctype-xdigit.php                          30-Sep-2022 11:06                6569
function.cubrid-affected-rows.php                  30-Sep-2022 11:06                9329
function.cubrid-bind.php                           30-Sep-2022 11:06               21486
function.cubrid-client-encoding.php                30-Sep-2022 11:06                5175
function.cubrid-close-prepare.php                  30-Sep-2022 11:06                6680
function.cubrid-close-request.php                  30-Sep-2022 11:06                6691
function.cubrid-close.php                          30-Sep-2022 11:06                6510
function.cubrid-col-get.php                        30-Sep-2022 11:06                8495
function.cubrid-col-size.php                       30-Sep-2022 11:06                8610
function.cubrid-column-names.php                   30-Sep-2022 11:06                8665
function.cubrid-column-types.php                   30-Sep-2022 11:06                8645
function.cubrid-commit.php                         30-Sep-2022 11:06               16209
function.cubrid-connect-with-url.php               30-Sep-2022 11:06               15545
function.cubrid-connect.php                        30-Sep-2022 11:06               12155
function.cubrid-current-oid.php                    30-Sep-2022 11:06                5906
function.cubrid-data-seek.php                      30-Sep-2022 11:06                7262
function.cubrid-db-name.php                        30-Sep-2022 11:06                6412
function.cubrid-disconnect.php                     30-Sep-2022 11:06                7473
function.cubrid-drop.php                           30-Sep-2022 11:06               11576
function.cubrid-errno.php                          30-Sep-2022 11:06                6958
function.cubrid-error-code-facility.php            30-Sep-2022 11:06                5976
function.cubrid-error-code.php                     30-Sep-2022 11:06                5911
function.cubrid-error-msg.php                      30-Sep-2022 11:06                5309
function.cubrid-error.php                          30-Sep-2022 11:06                6516
function.cubrid-execute.php                        30-Sep-2022 11:06               14307
function.cubrid-fetch-array.php                    30-Sep-2022 11:06                9952
function.cubrid-fetch-assoc.php                    30-Sep-2022 11:06                9162
function.cubrid-fetch-field.php                    30-Sep-2022 11:06               14207
function.cubrid-fetch-lengths.php                  30-Sep-2022 11:06                6038
function.cubrid-fetch-object.php                   30-Sep-2022 11:06               12281
function.cubrid-fetch-row.php                      30-Sep-2022 11:06                9046
function.cubrid-fetch.php                          30-Sep-2022 11:06               10224
function.cubrid-field-flags.php                    30-Sep-2022 11:06                7702
function.cubrid-field-len.php                      30-Sep-2022 11:06                8283
function.cubrid-field-name.php                     30-Sep-2022 11:06                7117
function.cubrid-field-seek.php                     30-Sep-2022 11:06               10857
function.cubrid-field-table.php                    30-Sep-2022 11:06                7340
function.cubrid-field-type.php                     30-Sep-2022 11:06                7402
function.cubrid-free-result.php                    30-Sep-2022 11:06                5694
function.cubrid-get-autocommit.php                 30-Sep-2022 11:06                3538
function.cubrid-get-charset.php                    30-Sep-2022 11:06                4908
function.cubrid-get-class-name.php                 30-Sep-2022 11:06                6207
function.cubrid-get-client-info.php                30-Sep-2022 11:06                8278
function.cubrid-get-db-parameter.php               30-Sep-2022 11:06               14417
function.cubrid-get-query-timeout.php              30-Sep-2022 11:06                6641
function.cubrid-get-server-info.php                30-Sep-2022 11:06                8510
function.cubrid-get.php                            30-Sep-2022 11:06               10043
function.cubrid-insert-id.php                      30-Sep-2022 11:06                7111
function.cubrid-is-instance.php                    30-Sep-2022 11:06                7360
function.cubrid-list-dbs.php                       30-Sep-2022 11:06                4385
function.cubrid-load-from-glo.php                  30-Sep-2022 11:06                6814
function.cubrid-lob-close.php                      30-Sep-2022 11:06                7263
function.cubrid-lob-export.php                     30-Sep-2022 11:06                7720
function.cubrid-lob-get.php                        30-Sep-2022 11:06                7631
function.cubrid-lob-send.php                       30-Sep-2022 11:06                6926
function.cubrid-lob-size.php                       30-Sep-2022 11:06                5768
function.cubrid-lob2-bind.php                      30-Sep-2022 11:06                9671
function.cubrid-lob2-close.php                     30-Sep-2022 11:06                3192
function.cubrid-lob2-export.php                    30-Sep-2022 11:06                8688
function.cubrid-lob2-import.php                    30-Sep-2022 11:06                8552
function.cubrid-lob2-new.php                       30-Sep-2022 11:06                3702
function.cubrid-lob2-read.php                      30-Sep-2022 11:06               14407
function.cubrid-lob2-seek.php                      30-Sep-2022 11:06               11242
function.cubrid-lob2-seek64.php                    30-Sep-2022 11:06               12783
function.cubrid-lob2-size.php                      30-Sep-2022 11:06                4235
function.cubrid-lob2-size64.php                    30-Sep-2022 11:06                4413
function.cubrid-lob2-tell.php                      30-Sep-2022 11:06                4254
function.cubrid-lob2-tell64.php                    30-Sep-2022 11:06                4450
function.cubrid-lob2-write.php                     30-Sep-2022 11:06               14340
function.cubrid-lock-read.php                      30-Sep-2022 11:06                9162
function.cubrid-lock-write.php                     30-Sep-2022 11:06                9580
function.cubrid-move-cursor.php                    30-Sep-2022 11:06                9307
function.cubrid-new-glo.php                        30-Sep-2022 11:06                6969
function.cubrid-next-result.php                    30-Sep-2022 11:06               17242
function.cubrid-num-cols.php                       30-Sep-2022 11:06                5916
function.cubrid-num-fields.php                     30-Sep-2022 11:06                5602
function.cubrid-num-rows.php                       30-Sep-2022 11:06                7115
function.cubrid-pconnect-with-url.php              30-Sep-2022 11:06               14984
function.cubrid-pconnect.php                       30-Sep-2022 11:06               12043
function.cubrid-ping.php                           30-Sep-2022 11:06                6249
function.cubrid-prepare.php                        30-Sep-2022 11:06               10341
function.cubrid-put.php                            30-Sep-2022 11:06               11472
function.cubrid-query.php                          30-Sep-2022 11:06               15239
function.cubrid-real-escape-string.php             30-Sep-2022 11:06                8127
function.cubrid-result.php                         30-Sep-2022 11:06                7327
function.cubrid-rollback.php                       30-Sep-2022 11:06               15489
function.cubrid-save-to-glo.php                    30-Sep-2022 11:06                6727
function.cubrid-schema.php                         30-Sep-2022 11:06               20243
function.cubrid-send-glo.php                       30-Sep-2022 11:06                6160
function.cubrid-seq-drop.php                       30-Sep-2022 11:06                9681
function.cubrid-seq-insert.php                     30-Sep-2022 11:06               10136
function.cubrid-seq-put.php                        30-Sep-2022 11:06               10063
function.cubrid-set-add.php                        30-Sep-2022 11:06                9436
function.cubrid-set-autocommit.php                 30-Sep-2022 11:06                3945
function.cubrid-set-db-parameter.php               30-Sep-2022 11:06                7964
function.cubrid-set-drop.php                       30-Sep-2022 11:06                9413
function.cubrid-set-query-timeout.php              30-Sep-2022 11:06                3289
function.cubrid-unbuffered-query.php               30-Sep-2022 11:06                7120
function.cubrid-version.php                        30-Sep-2022 11:06                8901
function.curl-close.php                            30-Sep-2022 11:06                6229
function.curl-copy-handle.php                      30-Sep-2022 11:06                6452
function.curl-errno.php                            30-Sep-2022 11:06                6189
function.curl-error.php                            30-Sep-2022 11:06                6138
function.curl-escape.php                           30-Sep-2022 11:06                7554
function.curl-exec.php                             30-Sep-2022 11:06                7366
function.curl-getinfo.php                          30-Sep-2022 11:06               31539
function.curl-init.php                             30-Sep-2022 11:06                7311
function.curl-multi-add-handle.php                 30-Sep-2022 11:06               10561
function.curl-multi-close.php                      30-Sep-2022 11:06                9957
function.curl-multi-errno.php                      30-Sep-2022 11:06                3759
function.curl-multi-exec.php                       30-Sep-2022 11:06               10672
function.curl-multi-getcontent.php                 30-Sep-2022 11:06                3944
function.curl-multi-info-read.php                  30-Sep-2022 11:06               12225
function.curl-multi-init.php                       30-Sep-2022 11:06                9120
function.curl-multi-remove-handle.php              30-Sep-2022 11:06                5422
function.curl-multi-select.php                     30-Sep-2022 11:06                4272
function.curl-multi-setopt.php                     30-Sep-2022 11:06               10850
function.curl-multi-strerror.php                   30-Sep-2022 11:06                7283
function.curl-pause.php                            30-Sep-2022 11:06                3563
function.curl-reset.php                            30-Sep-2022 11:06                6522
function.curl-setopt-array.php                     30-Sep-2022 11:06                7670
function.curl-setopt.php                           30-Sep-2022 11:06              127848
function.curl-share-close.php                      30-Sep-2022 11:06                8236
function.curl-share-errno.php                      30-Sep-2022 11:06                3835
function.curl-share-init.php                       30-Sep-2022 11:06                7759
function.curl-share-setopt.php                     30-Sep-2022 11:06               10296
function.curl-share-strerror.php                   30-Sep-2022 11:06                3179
function.curl-strerror.php                         30-Sep-2022 11:06                6227
function.curl-unescape.php                         30-Sep-2022 11:06                7951
function.curl-version.php                          30-Sep-2022 11:06                7185
function.curl_upkeep.php                           30-Sep-2022 11:06                6865
function.current.php                               30-Sep-2022 11:06               10893
function.date-add.php                              30-Sep-2022 11:06                1699
function.date-create-from-format.php               30-Sep-2022 11:06                1874
function.date-create-immutable-from-format.php     30-Sep-2022 11:06                1986
function.date-create-immutable.php                 30-Sep-2022 11:06                1878
function.date-create.php                           30-Sep-2022 11:06                4259
function.date-date-set.php                         30-Sep-2022 11:06                1758
function.date-default-timezone-get.php             30-Sep-2022 11:06                7152
function.date-default-timezone-set.php             30-Sep-2022 11:06                5686
function.date-diff.php                             30-Sep-2022 11:06                1718
function.date-format.php                           30-Sep-2022 11:06                1726
function.date-get-last-errors.php                  30-Sep-2022 11:06                1855
function.date-interval-create-from-date-string.php 30-Sep-2022 11:06                2002
function.date-interval-format.php                  30-Sep-2022 11:06                1853
function.date-isodate-set.php                      30-Sep-2022 11:06                1781
function.date-modify.php                           30-Sep-2022 11:06                1730
function.date-offset-get.php                       30-Sep-2022 11:06                1774
function.date-parse-from-format.php                30-Sep-2022 11:06               13660
function.date-parse.php                            30-Sep-2022 11:06               19847
function.date-sub.php                              30-Sep-2022 11:06                2359
function.date-sun-info.php                         30-Sep-2022 11:06               16521
function.date-sunrise.php                          30-Sep-2022 11:06               13588
function.date-sunset.php                           30-Sep-2022 11:06               13608
function.date-time-set.php                         30-Sep-2022 11:06                1744
function.date-timestamp-get.php                    30-Sep-2022 11:06                1803
function.date-timestamp-set.php                    30-Sep-2022 11:06                1811
function.date-timezone-get.php                     30-Sep-2022 11:06                1800
function.date-timezone-set.php                     30-Sep-2022 11:06                1772
function.date.php                                  30-Sep-2022 11:06               23579
function.db2-autocommit.php                        30-Sep-2022 11:06               10989
function.db2-bind-param.php                        30-Sep-2022 11:06               22746
function.db2-client-info.php                       30-Sep-2022 11:06               12167
function.db2-close.php                             30-Sep-2022 11:06                5537
function.db2-column-privileges.php                 30-Sep-2022 11:06                7928
function.db2-columns.php                           30-Sep-2022 11:06                9824
function.db2-commit.php                            30-Sep-2022 11:06                3514
function.db2-conn-error.php                        30-Sep-2022 11:06                6670
function.db2-conn-errormsg.php                     30-Sep-2022 11:06                6442
function.db2-connect.php                           30-Sep-2022 11:06               40653
function.db2-cursor-type.php                       30-Sep-2022 11:06                3060
function.db2-escape-string.php                     30-Sep-2022 11:06                7991
function.db2-exec.php                              30-Sep-2022 11:06               28860
function.db2-execute.php                           30-Sep-2022 11:06               27787
function.db2-fetch-array.php                       30-Sep-2022 11:06               11430
function.db2-fetch-assoc.php                       30-Sep-2022 11:06               11446
function.db2-fetch-both.php                        30-Sep-2022 11:06               11979
function.db2-fetch-object.php                      30-Sep-2022 11:06                9041
function.db2-fetch-row.php                         30-Sep-2022 11:06               16726
function.db2-field-display-size.php                30-Sep-2022 11:06                4813
function.db2-field-name.php                        30-Sep-2022 11:06                4699
function.db2-field-num.php                         30-Sep-2022 11:06                4709
function.db2-field-precision.php                   30-Sep-2022 11:06                4741
function.db2-field-scale.php                       30-Sep-2022 11:06                4703
function.db2-field-type.php                        30-Sep-2022 11:06                4704
function.db2-field-width.php                       30-Sep-2022 11:06                4911
function.db2-foreign-keys.php                      30-Sep-2022 11:06                8545
function.db2-free-result.php                       30-Sep-2022 11:06                3157
function.db2-free-stmt.php                         30-Sep-2022 11:06                3145
function.db2-get-option.php                        30-Sep-2022 11:06               24976
function.db2-last-insert-id.php                    30-Sep-2022 11:06                8590
function.db2-lob-read.php                          30-Sep-2022 11:06               17763
function.db2-next-result.php                       30-Sep-2022 11:06                8996
function.db2-num-fields.php                        30-Sep-2022 11:06                7180
function.db2-num-rows.php                          30-Sep-2022 11:06                4250
function.db2-pclose.php                            30-Sep-2022 11:06                5728
function.db2-pconnect.php                          30-Sep-2022 11:06               32556
function.db2-prepare.php                           30-Sep-2022 11:06               10585
function.db2-primary-keys.php                      30-Sep-2022 11:06                7179
function.db2-procedure-columns.php                 30-Sep-2022 11:06               11234
function.db2-procedures.php                        30-Sep-2022 11:06                7617
function.db2-result.php                            30-Sep-2022 11:06                7908
function.db2-rollback.php                          30-Sep-2022 11:06                9839
function.db2-server-info.php                       30-Sep-2022 11:06               24297
function.db2-set-option.php                        30-Sep-2022 11:06               70737
function.db2-special-columns.php                   30-Sep-2022 11:06                9764
function.db2-statistics.php                        30-Sep-2022 11:06               11900
function.db2-stmt-error.php                        30-Sep-2022 11:06                4318
function.db2-stmt-errormsg.php                     30-Sep-2022 11:06                3949
function.db2-table-privileges.php                  30-Sep-2022 11:06                7708
function.db2-tables.php                            30-Sep-2022 11:06                7738
function.dba-close.php                             30-Sep-2022 11:06                3203
function.dba-delete.php                            30-Sep-2022 11:06                4014
function.dba-exists.php                            30-Sep-2022 11:06                4082
function.dba-fetch.php                             30-Sep-2022 11:06                5584
function.dba-firstkey.php                          30-Sep-2022 11:06                3619
function.dba-handlers.php                          30-Sep-2022 11:06                5491
function.dba-insert.php                            30-Sep-2022 11:06                4671
function.dba-key-split.php                         30-Sep-2022 11:06                3725
function.dba-list.php                              30-Sep-2022 11:06                2174
function.dba-nextkey.php                           30-Sep-2022 11:06                3531
function.dba-open.php                              30-Sep-2022 11:06               12352
function.dba-optimize.php                          30-Sep-2022 11:06                3050
function.dba-popen.php                             30-Sep-2022 11:06                6761
function.dba-replace.php                           30-Sep-2022 11:06                4468
function.dba-sync.php                              30-Sep-2022 11:06                3117
function.dbase-add-record.php                      30-Sep-2022 11:06                6893
function.dbase-close.php                           30-Sep-2022 11:06                5106
function.dbase-create.php                          30-Sep-2022 11:06                8172
function.dbase-delete-record.php                   30-Sep-2022 11:06                4719
function.dbase-get-header-info.php                 30-Sep-2022 11:06                7046
function.dbase-get-record-with-names.php           30-Sep-2022 11:06                8903
function.dbase-get-record.php                      30-Sep-2022 11:06                5462
function.dbase-numfields.php                       30-Sep-2022 11:06                5853
function.dbase-numrecords.php                      30-Sep-2022 11:06                7206
function.dbase-open.php                            30-Sep-2022 11:06                6329
function.dbase-pack.php                            30-Sep-2022 11:06                6325
function.dbase-replace-record.php                  30-Sep-2022 11:06                9651
function.dcgettext.php                             30-Sep-2022 11:06                3290
function.dcngettext.php                            30-Sep-2022 11:06                3808
function.debug-backtrace.php                       30-Sep-2022 11:06                9634
function.debug-print-backtrace.php                 30-Sep-2022 11:06                6753
function.debug-zval-dump.php                       30-Sep-2022 11:06                9850
function.decbin.php                                30-Sep-2022 11:06                8850
function.dechex.php                                30-Sep-2022 11:06                7319
function.decoct.php                                30-Sep-2022 11:06                4880
function.define.php                                30-Sep-2022 11:06               11760
function.defined.php                               30-Sep-2022 11:06                5388
function.deflate-add.php                           30-Sep-2022 11:06                5077
function.deflate-init.php                          30-Sep-2022 11:06                7132
function.deg2rad.php                               30-Sep-2022 11:06                3939
function.delete.php                                30-Sep-2022 11:06                2417
function.dgettext.php                              30-Sep-2022 11:06                3074
function.die.php                                   30-Sep-2022 11:06                1524
function.dio-close.php                             30-Sep-2022 11:06                3972
function.dio-fcntl.php                             30-Sep-2022 11:06                9324
function.dio-open.php                              30-Sep-2022 11:06                7664
function.dio-read.php                              30-Sep-2022 11:06                3269
function.dio-seek.php                              30-Sep-2022 11:06                7240
function.dio-stat.php                              30-Sep-2022 11:06                3770
function.dio-tcsetattr.php                         30-Sep-2022 11:06                6955
function.dio-truncate.php                          30-Sep-2022 11:06                3433
function.dio-write.php                             30-Sep-2022 11:06                3626
function.dir.php                                   30-Sep-2022 11:06                7089
function.dirname.php                               30-Sep-2022 11:06                9902
function.disk-free-space.php                       30-Sep-2022 11:06                5575
function.disk-total-space.php                      30-Sep-2022 11:06                5244
function.diskfreespace.php                         30-Sep-2022 11:06                1728
function.dl.php                                    30-Sep-2022 11:06               10233
function.dngettext.php                             30-Sep-2022 11:06                3620
function.dns-check-record.php                      30-Sep-2022 11:06                1711
function.dns-get-mx.php                            30-Sep-2022 11:06                1681
function.dns-get-record.php                        30-Sep-2022 11:06               23041
function.dom-import-simplexml.php                  30-Sep-2022 11:06                7215
function.doubleval.php                             30-Sep-2022 11:06                1675
function.each.php                                  30-Sep-2022 11:06               11738
function.easter-date.php                           30-Sep-2022 11:06               11838
function.easter-days.php                           30-Sep-2022 11:06                7189
function.echo.php                                  30-Sep-2022 11:06               19985
function.eio-busy.php                              30-Sep-2022 11:06                4422
function.eio-cancel.php                            30-Sep-2022 11:06                7399
function.eio-chmod.php                             30-Sep-2022 11:06                5729
function.eio-chown.php                             30-Sep-2022 11:06                5876
function.eio-close.php                             30-Sep-2022 11:06                5312
function.eio-custom.php                            30-Sep-2022 11:06               10384
function.eio-dup2.php                              30-Sep-2022 11:06                5394
function.eio-event-loop.php                        30-Sep-2022 11:06                5844
function.eio-fallocate.php                         30-Sep-2022 11:06                6838
function.eio-fchmod.php                            30-Sep-2022 11:06                5785
function.eio-fchown.php                            30-Sep-2022 11:06                6033
function.eio-fdatasync.php                         30-Sep-2022 11:06                5213
function.eio-fstat.php                             30-Sep-2022 11:06               11664
function.eio-fstatvfs.php                          30-Sep-2022 11:06                5354
function.eio-fsync.php                             30-Sep-2022 11:06                5328
function.eio-ftruncate.php                         30-Sep-2022 11:06                5803
function.eio-futime.php                            30-Sep-2022 11:06                6055
function.eio-get-event-stream.php                  30-Sep-2022 11:06                8507
function.eio-get-last-error.php                    30-Sep-2022 11:06                3007
function.eio-grp-add.php                           30-Sep-2022 11:06               12119
function.eio-grp-cancel.php                        30-Sep-2022 11:06                3042
function.eio-grp-limit.php                         30-Sep-2022 11:06                2887
function.eio-grp.php                               30-Sep-2022 11:06               12241
function.eio-init.php                              30-Sep-2022 11:06                2539
function.eio-link.php                              30-Sep-2022 11:06               12611
function.eio-lstat.php                             30-Sep-2022 11:06                9678
function.eio-mkdir.php                             30-Sep-2022 11:06                9020
function.eio-mknod.php                             30-Sep-2022 11:06               10934
function.eio-nop.php                               30-Sep-2022 11:06                4940
function.eio-npending.php                          30-Sep-2022 11:06                2953
function.eio-nready.php                            30-Sep-2022 11:06                2701
function.eio-nreqs.php                             30-Sep-2022 11:06                5584
function.eio-nthreads.php                          30-Sep-2022 11:06                3420
function.eio-open.php                              30-Sep-2022 11:06               11590
function.eio-poll.php                              30-Sep-2022 11:06                5746
function.eio-read.php                              30-Sep-2022 11:06               12905
function.eio-readahead.php                         30-Sep-2022 11:06                5774
function.eio-readdir.php                           30-Sep-2022 11:06               15718
function.eio-readlink.php                          30-Sep-2022 11:06               12315
function.eio-realpath.php                          30-Sep-2022 11:06                5121
function.eio-rename.php                            30-Sep-2022 11:06                9130
function.eio-rmdir.php                             30-Sep-2022 11:06                8060
function.eio-seek.php                              30-Sep-2022 11:06                6467
function.eio-sendfile.php                          30-Sep-2022 11:06                6043
function.eio-set-max-idle.php                      30-Sep-2022 11:06                3066
function.eio-set-max-parallel.php                  30-Sep-2022 11:06                3115
function.eio-set-max-poll-reqs.php                 30-Sep-2022 11:06                2390
function.eio-set-max-poll-time.php                 30-Sep-2022 11:06                2460
function.eio-set-min-parallel.php                  30-Sep-2022 11:06                3104
function.eio-stat.php                              30-Sep-2022 11:06                9650
function.eio-statvfs.php                           30-Sep-2022 11:06                8025
function.eio-symlink.php                           30-Sep-2022 11:06               10748
function.eio-sync-file-range.php                   30-Sep-2022 11:06                6630
function.eio-sync.php                              30-Sep-2022 11:06                2736
function.eio-syncfs.php                            30-Sep-2022 11:06                4896
function.eio-truncate.php                          30-Sep-2022 11:06                5679
function.eio-unlink.php                            30-Sep-2022 11:06                4901
function.eio-utime.php                             30-Sep-2022 11:06                5663
function.eio-write.php                             30-Sep-2022 11:06                6426
function.empty.php                                 30-Sep-2022 11:06                9654
function.enchant-broker-describe.php               30-Sep-2022 11:06                5938
function.enchant-broker-dict-exists.php            30-Sep-2022 11:06                5593
function.enchant-broker-free-dict.php              30-Sep-2022 11:06                4703
function.enchant-broker-free.php                   30-Sep-2022 11:06                4240
function.enchant-broker-get-dict-path.php          30-Sep-2022 11:06                5057
function.enchant-broker-get-error.php              30-Sep-2022 11:06                3518
function.enchant-broker-init.php                   30-Sep-2022 11:06                3398
function.enchant-broker-list-dicts.php             30-Sep-2022 11:06                6798
function.enchant-broker-request-dict.php           30-Sep-2022 11:06                7032
function.enchant-broker-request-pwl-dict.php       30-Sep-2022 11:06                5273
function.enchant-broker-set-dict-path.php          30-Sep-2022 11:06                5264
function.enchant-broker-set-ordering.php           30-Sep-2022 11:06                4528
function.enchant-dict-add-to-personal.php          30-Sep-2022 11:06                2192
function.enchant-dict-add-to-session.php           30-Sep-2022 11:06                4360
function.enchant-dict-add.php                      30-Sep-2022 11:06                6258
function.enchant-dict-check.php                    30-Sep-2022 11:06                3916
function.enchant-dict-describe.php                 30-Sep-2022 11:06                6433
function.enchant-dict-get-error.php                30-Sep-2022 11:06                3721
function.enchant-dict-is-added.php                 30-Sep-2022 11:06                4263
function.enchant-dict-is-in-session.php            30-Sep-2022 11:06                2178
function.enchant-dict-quick-check.php              30-Sep-2022 11:06                7996
function.enchant-dict-store-replacement.php        30-Sep-2022 11:06                4473
function.enchant-dict-suggest.php                  30-Sep-2022 11:06                7679
function.end.php                                   30-Sep-2022 11:06                6150
function.enum-exists.php                           30-Sep-2022 11:06                5286
function.error-clear-last.php                      30-Sep-2022 11:06                4575
function.error-get-last.php                        30-Sep-2022 11:06                4826
function.error-log.php                             30-Sep-2022 11:06               10938
function.error-reporting.php                       30-Sep-2022 11:06                9068
function.escapeshellarg.php                        30-Sep-2022 11:06                5580
function.escapeshellcmd.php                        30-Sep-2022 11:06                7821
function.eval.php                                  30-Sep-2022 11:06                8896
function.exec.php                                  30-Sep-2022 11:06                9065
function.exif-imagetype.php                        30-Sep-2022 11:06                8397
function.exif-read-data.php                        30-Sep-2022 11:06               22843
function.exif-tagname.php                          30-Sep-2022 11:06                4620
function.exif-thumbnail.php                        30-Sep-2022 11:06                8718
function.exit.php                                  30-Sep-2022 11:06                9631
function.exp.php                                   30-Sep-2022 11:06                4200
function.expect-expectl.php                        30-Sep-2022 11:06               11456
function.expect-popen.php                          30-Sep-2022 11:06                4549
function.explode.php                               30-Sep-2022 11:06               15930
function.expm1.php                                 30-Sep-2022 11:06                3382
function.extension-loaded.php                      30-Sep-2022 11:06                5561
function.extract.php                               30-Sep-2022 11:06               13672
function.ezmlm-hash.php                            30-Sep-2022 11:06                4585
function.fann-cascadetrain-on-data.php             30-Sep-2022 11:06                6183
function.fann-cascadetrain-on-file.php             30-Sep-2022 11:06                5200
function.fann-clear-scaling-params.php             30-Sep-2022 11:06                2521
function.fann-copy.php                             30-Sep-2022 11:06                3128
function.fann-create-from-file.php                 30-Sep-2022 11:06                3148
function.fann-create-shortcut-array.php            30-Sep-2022 11:06                3945
function.fann-create-shortcut.php                  30-Sep-2022 11:06                4857
function.fann-create-sparse-array.php              30-Sep-2022 11:06                4530
function.fann-create-sparse.php                    30-Sep-2022 11:06                5180
function.fann-create-standard-array.php            30-Sep-2022 11:06                4258
function.fann-create-standard.php                  30-Sep-2022 11:06                4925
function.fann-create-train-from-callback.php       30-Sep-2022 11:06                9243
function.fann-create-train.php                     30-Sep-2022 11:06                4414
function.fann-descale-input.php                    30-Sep-2022 11:06                3555
function.fann-descale-output.php                   30-Sep-2022 11:06                3571
function.fann-descale-train.php                    30-Sep-2022 11:06                3567
function.fann-destroy-train.php                    30-Sep-2022 11:06                2480
function.fann-destroy.php                          30-Sep-2022 11:06                2508
function.fann-duplicate-train-data.php             30-Sep-2022 11:06                2712
function.fann-get-activation-function.php          30-Sep-2022 11:06                5070
function.fann-get-activation-steepness.php         30-Sep-2022 11:06                5483
function.fann-get-bias-array.php                   30-Sep-2022 11:06                2497
function.fann-get-bit-fail-limit.php               30-Sep-2022 11:06                3618
function.fann-get-bit-fail.php                     30-Sep-2022 11:06                4841
function.fann-get-cascade-activation-functions-..> 30-Sep-2022 11:06                3730
function.fann-get-cascade-activation-functions.php 30-Sep-2022 11:06                4186
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:06                3786
function.fann-get-cascade-activation-steepnesse..> 30-Sep-2022 11:06                3937
function.fann-get-cascade-candidate-change-frac..> 30-Sep-2022 11:06                5058
function.fann-get-cascade-candidate-limit.php      30-Sep-2022 11:06                3418
function.fann-get-cascade-candidate-stagnation-..> 30-Sep-2022 11:06                4169
function.fann-get-cascade-max-cand-epochs.php      30-Sep-2022 11:06                3300
function.fann-get-cascade-max-out-epochs.php       30-Sep-2022 11:06                3221
function.fann-get-cascade-min-cand-epochs.php      30-Sep-2022 11:06                3629
function.fann-get-cascade-min-out-epochs.php       30-Sep-2022 11:06                3586
function.fann-get-cascade-num-candidate-groups.php 30-Sep-2022 11:06                3698
function.fann-get-cascade-num-candidates.php       30-Sep-2022 11:06                5892
function.fann-get-cascade-output-change-fractio..> 30-Sep-2022 11:06                4986
function.fann-get-cascade-output-stagnation-epo..> 30-Sep-2022 11:06                4112
function.fann-get-cascade-weight-multiplier.php    30-Sep-2022 11:06                3376
function.fann-get-connection-array.php             30-Sep-2022 11:06                2524
function.fann-get-connection-rate.php              30-Sep-2022 11:06                2595
function.fann-get-errno.php                        30-Sep-2022 11:06                3076
function.fann-get-errstr.php                       30-Sep-2022 11:06                3079
function.fann-get-layer-array.php                  30-Sep-2022 11:06                2598
function.fann-get-learning-momentum.php            30-Sep-2022 11:06                3606
function.fann-get-learning-rate.php                30-Sep-2022 11:06                3464
function.fann-get-mse.php                          30-Sep-2022 11:06                3081
function.fann-get-network-type.php                 30-Sep-2022 11:06                2565
function.fann-get-num-input.php                    30-Sep-2022 11:06                2452
function.fann-get-num-layers.php                   30-Sep-2022 11:06                2507
function.fann-get-num-output.php                   30-Sep-2022 11:06                2471
function.fann-get-quickprop-decay.php              30-Sep-2022 11:06                3233
function.fann-get-quickprop-mu.php                 30-Sep-2022 11:06                3126
function.fann-get-rprop-decrease-factor.php        30-Sep-2022 11:06                3187
function.fann-get-rprop-delta-max.php              30-Sep-2022 11:06                3264
function.fann-get-rprop-delta-min.php              30-Sep-2022 11:06                3060
function.fann-get-rprop-delta-zero.php             30-Sep-2022 11:06                3463
function.fann-get-rprop-increase-factor.php        30-Sep-2022 11:06                3212
function.fann-get-sarprop-step-error-shift.php     30-Sep-2022 11:06                3546
function.fann-get-sarprop-step-error-threshold-..> 30-Sep-2022 11:06                3698
function.fann-get-sarprop-temperature.php          30-Sep-2022 11:06                3460
function.fann-get-sarprop-weight-decay-shift.php   30-Sep-2022 11:06                3527
function.fann-get-total-connections.php            30-Sep-2022 11:06                2644
function.fann-get-total-neurons.php                30-Sep-2022 11:06                2691
function.fann-get-train-error-function.php         30-Sep-2022 11:06                3403
function.fann-get-train-stop-function.php          30-Sep-2022 11:06                3391
function.fann-get-training-algorithm.php           30-Sep-2022 11:06                3563
function.fann-init-weights.php                     30-Sep-2022 11:06                4218
function.fann-length-train-data.php                30-Sep-2022 11:06                2645
function.fann-merge-train-data.php                 30-Sep-2022 11:06                2941
function.fann-num-input-train-data.php             30-Sep-2022 11:06                3374
function.fann-num-output-train-data.php            30-Sep-2022 11:06                3372
function.fann-print-error.php                      30-Sep-2022 11:06                2909
function.fann-randomize-weights.php                30-Sep-2022 11:06                3676
function.fann-read-train-from-file.php             30-Sep-2022 11:06                4978
function.fann-reset-errno.php                      30-Sep-2022 11:06                3100
function.fann-reset-errstr.php                     30-Sep-2022 11:06                3081
function.fann-reset-mse.php                        30-Sep-2022 11:06                3305
function.fann-run.php                              30-Sep-2022 11:06                2707
function.fann-save-train.php                       30-Sep-2022 11:06                3284
function.fann-save.php                             30-Sep-2022 11:06                4091
function.fann-scale-input-train-data.php           30-Sep-2022 11:06                3874
function.fann-scale-input.php                      30-Sep-2022 11:06                3569
function.fann-scale-output-train-data.php          30-Sep-2022 11:06                3902
function.fann-scale-output.php                     30-Sep-2022 11:06                3573
function.fann-scale-train-data.php                 30-Sep-2022 11:06                3872
function.fann-scale-train.php                      30-Sep-2022 11:06                3585
function.fann-set-activation-function-hidden.php   30-Sep-2022 11:06                4294
function.fann-set-activation-function-layer.php    30-Sep-2022 11:06                4754
function.fann-set-activation-function-output.php   30-Sep-2022 11:06                4310
function.fann-set-activation-function.php          30-Sep-2022 11:06                6018
function.fann-set-activation-steepness-hidden.php  30-Sep-2022 11:06                4595
function.fann-set-activation-steepness-layer.php   30-Sep-2022 11:06                5006
function.fann-set-activation-steepness-output.php  30-Sep-2022 11:06                4576
function.fann-set-activation-steepness.php         30-Sep-2022 11:06                5848
function.fann-set-bit-fail-limit.php               30-Sep-2022 11:06                3238
function.fann-set-callback.php                     30-Sep-2022 11:06                5292
function.fann-set-cascade-activation-functions.php 30-Sep-2022 11:06                3909
function.fann-set-cascade-activation-steepnesse..> 30-Sep-2022 11:06                4122
function.fann-set-cascade-candidate-change-frac..> 30-Sep-2022 11:06                3589
function.fann-set-cascade-candidate-limit.php      30-Sep-2022 11:06                3396
function.fann-set-cascade-candidate-stagnation-..> 30-Sep-2022 11:06                3651
function.fann-set-cascade-max-cand-epochs.php      30-Sep-2022 11:06                3397
function.fann-set-cascade-max-out-epochs.php       30-Sep-2022 11:06                3348
function.fann-set-cascade-min-cand-epochs.php      30-Sep-2022 11:06                3731
function.fann-set-cascade-min-out-epochs.php       30-Sep-2022 11:06                3713
function.fann-set-cascade-num-candidate-groups.php 30-Sep-2022 11:06                3482
function.fann-set-cascade-output-change-fractio..> 30-Sep-2022 11:06                3546
function.fann-set-cascade-output-stagnation-epo..> 30-Sep-2022 11:06                3612
function.fann-set-cascade-weight-multiplier.php    30-Sep-2022 11:06                3381
function.fann-set-error-log.php                    30-Sep-2022 11:06                2861
function.fann-set-input-scaling-params.php         30-Sep-2022 11:06                4222
function.fann-set-learning-momentum.php            30-Sep-2022 11:06                3637
function.fann-set-learning-rate.php                30-Sep-2022 11:06                3563
function.fann-set-output-scaling-params.php        30-Sep-2022 11:06                4242
function.fann-set-quickprop-decay.php              30-Sep-2022 11:06                3309
function.fann-set-quickprop-mu.php                 30-Sep-2022 11:06                3164
function.fann-set-rprop-decrease-factor.php        30-Sep-2022 11:06                3366
function.fann-set-rprop-delta-max.php              30-Sep-2022 11:06                3493
function.fann-set-rprop-delta-min.php              30-Sep-2022 11:06                3284
function.fann-set-rprop-delta-zero.php             30-Sep-2022 11:06                3696
function.fann-set-rprop-increase-factor.php        30-Sep-2022 11:06                3392
function.fann-set-sarprop-step-error-shift.php     30-Sep-2022 11:06                3781
function.fann-set-sarprop-step-error-threshold-..> 30-Sep-2022 11:06                3975
function.fann-set-sarprop-temperature.php          30-Sep-2022 11:06                3692
function.fann-set-sarprop-weight-decay-shift.php   30-Sep-2022 11:06                3775
function.fann-set-scaling-params.php               30-Sep-2022 11:06                5166
function.fann-set-train-error-function.php         30-Sep-2022 11:06                3578
function.fann-set-train-stop-function.php          30-Sep-2022 11:06                3566
function.fann-set-training-algorithm.php           30-Sep-2022 11:06                3514
function.fann-set-weight-array.php                 30-Sep-2022 11:06                3009
function.fann-set-weight.php                       30-Sep-2022 11:06                3349
function.fann-shuffle-train-data.php               30-Sep-2022 11:06                2680
function.fann-subset-train-data.php                30-Sep-2022 11:06                3984
function.fann-test-data.php                        30-Sep-2022 11:06                4075
function.fann-test.php                             30-Sep-2022 11:06                4316
function.fann-train-epoch.php                      30-Sep-2022 11:06                4434
function.fann-train-on-data.php                    30-Sep-2022 11:06                6205
function.fann-train-on-file.php                    30-Sep-2022 11:06                6148
function.fann-train.php                            30-Sep-2022 11:06                4340
function.fastcgi-finish-request.php                30-Sep-2022 11:06                2424
function.fbird-add-user.php                        30-Sep-2022 11:06                2321
function.fbird-affected-rows.php                   30-Sep-2022 11:06                2335
function.fbird-backup.php                          30-Sep-2022 11:06                1732
function.fbird-blob-add.php                        30-Sep-2022 11:06                2679
function.fbird-blob-cancel.php                     30-Sep-2022 11:06                3499
function.fbird-blob-close.php                      30-Sep-2022 11:06                2710
function.fbird-blob-create.php                     30-Sep-2022 11:06                2710
function.fbird-blob-echo.php                       30-Sep-2022 11:06                2498
function.fbird-blob-get.php                        30-Sep-2022 11:06                2491
function.fbird-blob-import.php                     30-Sep-2022 11:06                2706
function.fbird-blob-info.php                       30-Sep-2022 11:06                1764
function.fbird-blob-open.php                       30-Sep-2022 11:06                2488
function.fbird-close.php                           30-Sep-2022 11:06                2258
function.fbird-commit-ret.php                      30-Sep-2022 11:06                1757
function.fbird-commit.php                          30-Sep-2022 11:06                1725
function.fbird-connect.php                         30-Sep-2022 11:06                2264
function.fbird-db-info.php                         30-Sep-2022 11:06                1738
function.fbird-delete-user.php                     30-Sep-2022 11:06                2332
function.fbird-drop-db.php                         30-Sep-2022 11:06                2280
function.fbird-errcode.php                         30-Sep-2022 11:06                2087
function.fbird-errmsg.php                          30-Sep-2022 11:06                2080
function.fbird-execute.php                         30-Sep-2022 11:06                2092
function.fbird-fetch-assoc.php                     30-Sep-2022 11:06                2348
function.fbird-fetch-object.php                    30-Sep-2022 11:06                2359
function.fbird-fetch-row.php                       30-Sep-2022 11:06                2336
function.fbird-field-info.php                      30-Sep-2022 11:06                2162
function.fbird-free-event-handler.php              30-Sep-2022 11:06                2266
function.fbird-free-query.php                      30-Sep-2022 11:06                1793
function.fbird-free-result.php                     30-Sep-2022 11:06                1778
function.fbird-gen-id.php                          30-Sep-2022 11:06                1735
function.fbird-maintain-db.php                     30-Sep-2022 11:06                1780
function.fbird-modify-user.php                     30-Sep-2022 11:06                2348
function.fbird-name-result.php                     30-Sep-2022 11:06                2331
function.fbird-num-fields.php                      30-Sep-2022 11:06                2151
function.fbird-num-params.php                      30-Sep-2022 11:06                2326
function.fbird-param-info.php                      30-Sep-2022 11:06                2331
function.fbird-pconnect.php                        30-Sep-2022 11:06                2281
function.fbird-prepare.php                         30-Sep-2022 11:06                1728
function.fbird-query.php                           30-Sep-2022 11:06                2629
function.fbird-restore.php                         30-Sep-2022 11:06                1735
function.fbird-rollback-ret.php                    30-Sep-2022 11:06                1787
function.fbird-rollback.php                        30-Sep-2022 11:06                1759
function.fbird-server-info.php                     30-Sep-2022 11:06                1790
function.fbird-service-attach.php                  30-Sep-2022 11:06                1829
function.fbird-service-detach.php                  30-Sep-2022 11:06                1841
function.fbird-set-event-handler.php               30-Sep-2022 11:06                2441
function.fbird-trans.php                           30-Sep-2022 11:06                1734
function.fbird-wait-event.php                      30-Sep-2022 11:06                2366
function.fclose.php                                30-Sep-2022 11:06                4280
function.fdatasync.php                             30-Sep-2022 11:06                5874
function.fdf-add-doc-javascript.php                30-Sep-2022 11:06                5252
function.fdf-add-template.php                      30-Sep-2022 11:06                2518
function.fdf-close.php                             30-Sep-2022 11:06                3014
function.fdf-create.php                            30-Sep-2022 11:06                3711
function.fdf-enum-values.php                       30-Sep-2022 11:06                2378
function.fdf-errno.php                             30-Sep-2022 11:06                2744
function.fdf-error.php                             30-Sep-2022 11:06                3175
function.fdf-get-ap.php                            30-Sep-2022 11:06                3843
function.fdf-get-attachment.php                    30-Sep-2022 11:06                5920
function.fdf-get-encoding.php                      30-Sep-2022 11:06                3302
function.fdf-get-file.php                          30-Sep-2022 11:06                3141
function.fdf-get-flags.php                         30-Sep-2022 11:06                2135
function.fdf-get-opt.php                           30-Sep-2022 11:06                2276
function.fdf-get-status.php                        30-Sep-2022 11:06                3154
function.fdf-get-value.php                         30-Sep-2022 11:06                4498
function.fdf-get-version.php                       30-Sep-2022 11:06                3516
function.fdf-header.php                            30-Sep-2022 11:06                2273
function.fdf-next-field-name.php                   30-Sep-2022 11:06                4190
function.fdf-open-string.php                       30-Sep-2022 11:06                4735
function.fdf-open.php                              30-Sep-2022 11:06                4498
function.fdf-remove-item.php                       30-Sep-2022 11:06                2140
function.fdf-save-string.php                       30-Sep-2022 11:06                5518
function.fdf-save.php                              30-Sep-2022 11:06                3886
function.fdf-set-ap.php                            30-Sep-2022 11:06                4054
function.fdf-set-encoding.php                      30-Sep-2022 11:06                3490
function.fdf-set-file.php                          30-Sep-2022 11:06                5132
function.fdf-set-flags.php                         30-Sep-2022 11:06                4039
function.fdf-set-javascript-action.php             30-Sep-2022 11:06                4241
function.fdf-set-on-import-javascript.php          30-Sep-2022 11:06                2959
function.fdf-set-opt.php                           30-Sep-2022 11:06                4266
function.fdf-set-status.php                        30-Sep-2022 11:06                3544
function.fdf-set-submit-form-action.php            30-Sep-2022 11:06                4483
function.fdf-set-target-frame.php                  30-Sep-2022 11:06                3516
function.fdf-set-value.php                         30-Sep-2022 11:06                5009
function.fdf-set-version.php                       30-Sep-2022 11:06                3757
function.fdiv.php                                  30-Sep-2022 11:06                6131
function.feof.php                                  30-Sep-2022 11:06                7873
function.fflush.php                                30-Sep-2022 11:06                5524
function.fgetc.php                                 30-Sep-2022 11:06                6604
function.fgetcsv.php                               30-Sep-2022 11:06               13191
function.fgets.php                                 30-Sep-2022 11:06                8622
function.fgetss.php                                30-Sep-2022 11:06                9621
function.file-exists.php                           30-Sep-2022 11:06                7110
function.file-get-contents.php                     30-Sep-2022 11:06               18299
function.file-put-contents.php                     30-Sep-2022 11:06               13222
function.file.php                                  30-Sep-2022 11:06               11640
function.fileatime.php                             30-Sep-2022 11:06                7019
function.filectime.php                             30-Sep-2022 11:06                7047
function.filegroup.php                             30-Sep-2022 11:06                5749
function.fileinode.php                             30-Sep-2022 11:06                5214
function.filemtime.php                             30-Sep-2022 11:06                6829
function.fileowner.php                             30-Sep-2022 11:06                5549
function.fileperms.php                             30-Sep-2022 11:06               18243
function.filesize.php                              30-Sep-2022 11:06                5620
function.filetype.php                              30-Sep-2022 11:06                6510
function.filter-has-var.php                        30-Sep-2022 11:06                2852
function.filter-id.php                             30-Sep-2022 11:06                2759
function.filter-input-array.php                    30-Sep-2022 11:06               13937
function.filter-input.php                          30-Sep-2022 11:06                7818
function.filter-list.php                           30-Sep-2022 11:06                3636
function.filter-var-array.php                      30-Sep-2022 11:06               13686
function.filter-var.php                            30-Sep-2022 11:06               13738
function.finfo-buffer.php                          30-Sep-2022 11:06                7647
function.finfo-close.php                           30-Sep-2022 11:06                3420
function.finfo-file.php                            30-Sep-2022 11:06                8473
function.finfo-open.php                            30-Sep-2022 11:06               10037
function.finfo-set-flags.php                       30-Sep-2022 11:06                4483
function.floatval.php                              30-Sep-2022 11:06                6170
function.flock.php                                 30-Sep-2022 11:06               12999
function.floor.php                                 30-Sep-2022 11:06                5092
function.flush.php                                 30-Sep-2022 11:06                4863
function.fmod.php                                  30-Sep-2022 11:06                4931
function.fnmatch.php                               30-Sep-2022 11:06                7471
function.fopen.php                                 30-Sep-2022 11:06               23517
function.forward-static-call-array.php             30-Sep-2022 11:06               10103
function.forward-static-call.php                   30-Sep-2022 11:06                9529
function.fpassthru.php                             30-Sep-2022 11:06                7403
function.fpm-get-status.php                        30-Sep-2022 11:06                2472
function.fprintf.php                               30-Sep-2022 11:06               19310
function.fputcsv.php                               30-Sep-2022 11:06               10047
function.fputs.php                                 30-Sep-2022 11:06                1617
function.fread.php                                 30-Sep-2022 11:06               15075
function.frenchtojd.php                            30-Sep-2022 11:06                3981
function.fscanf.php                                30-Sep-2022 11:06                9496
function.fseek.php                                 30-Sep-2022 11:06                7657
function.fsockopen.php                             30-Sep-2022 11:06               17512
function.fstat.php                                 30-Sep-2022 11:06                6020
function.fsync.php                                 30-Sep-2022 11:06                5636
function.ftell.php                                 30-Sep-2022 11:06                6142
function.ftok.php                                  30-Sep-2022 11:06                3637
function.ftp-alloc.php                             30-Sep-2022 11:06                8451
function.ftp-append.php                            30-Sep-2022 11:06                4209
function.ftp-cdup.php                              30-Sep-2022 11:06                6776
function.ftp-chdir.php                             30-Sep-2022 11:06                7721
function.ftp-chmod.php                             30-Sep-2022 11:06                7131
function.ftp-close.php                             30-Sep-2022 11:06                6051
function.ftp-connect.php                           30-Sep-2022 11:06                6581
function.ftp-delete.php                            30-Sep-2022 11:06                6286
function.ftp-exec.php                              30-Sep-2022 11:06                6831
function.ftp-fget.php                              30-Sep-2022 11:06               10014
function.ftp-fput.php                              30-Sep-2022 11:06                9340
function.ftp-get-option.php                        30-Sep-2022 11:06                5853
function.ftp-get.php                               30-Sep-2022 11:06                9272
function.ftp-login.php                             30-Sep-2022 11:06                6802
function.ftp-mdtm.php                              30-Sep-2022 11:06                7436
function.ftp-mkdir.php                             30-Sep-2022 11:06                7006
function.ftp-mlsd.php                              30-Sep-2022 11:06                9149
function.ftp-nb-continue.php                       30-Sep-2022 11:06                5528
function.ftp-nb-fget.php                           30-Sep-2022 11:06               10468
function.ftp-nb-fput.php                           30-Sep-2022 11:06               10185
function.ftp-nb-get.php                            30-Sep-2022 11:06               14540
function.ftp-nb-put.php                            30-Sep-2022 11:06               11918
function.ftp-nlist.php                             30-Sep-2022 11:06                6919
function.ftp-pasv.php                              30-Sep-2022 11:06                7375
function.ftp-put.php                               30-Sep-2022 11:06                8909
function.ftp-pwd.php                               30-Sep-2022 11:06                6105
function.ftp-quit.php                              30-Sep-2022 11:06                1636
function.ftp-raw.php                               30-Sep-2022 11:06                5542
function.ftp-rawlist.php                           30-Sep-2022 11:06                8124
function.ftp-rename.php                            30-Sep-2022 11:06                7141
function.ftp-rmdir.php                             30-Sep-2022 11:06                6690
function.ftp-set-option.php                        30-Sep-2022 11:06                7147
function.ftp-site.php                              30-Sep-2022 11:06                6884
function.ftp-size.php                              30-Sep-2022 11:06                6978
function.ftp-ssl-connect.php                       30-Sep-2022 11:06                9091
function.ftp-systype.php                           30-Sep-2022 11:06                5595
function.ftruncate.php                             30-Sep-2022 11:06                6350
function.func-get-arg.php                          30-Sep-2022 11:06               11743
function.func-get-args.php                         30-Sep-2022 11:06               12394
function.func-num-args.php                         30-Sep-2022 11:06                5923
function.function-exists.php                       30-Sep-2022 11:06                6203
function.fwrite.php                                30-Sep-2022 11:06               15721
function.gc-collect-cycles.php                     30-Sep-2022 11:06                2474
function.gc-disable.php                            30-Sep-2022 11:06                2549
function.gc-enable.php                             30-Sep-2022 11:06                2522
function.gc-enabled.php                            30-Sep-2022 11:06                3237
function.gc-mem-caches.php                         30-Sep-2022 11:06                2414
function.gc-status.php                             30-Sep-2022 11:06                5957
function.gd-info.php                               30-Sep-2022 11:06                8352
function.geoip-asnum-by-name.php                   30-Sep-2022 11:06                4110
function.geoip-continent-code-by-name.php          30-Sep-2022 11:06                5643
function.geoip-country-code-by-name.php            30-Sep-2022 11:06                5384
function.geoip-country-code3-by-name.php           30-Sep-2022 11:06                4943
function.geoip-country-name-by-name.php            30-Sep-2022 11:06                4908
function.geoip-database-info.php                   30-Sep-2022 11:06                4130
function.geoip-db-avail.php                        30-Sep-2022 11:06                4269
function.geoip-db-filename.php                     30-Sep-2022 11:06                4006
function.geoip-db-get-all-info.php                 30-Sep-2022 11:06                6777
function.geoip-domain-by-name.php                  30-Sep-2022 11:06                4338
function.geoip-id-by-name.php                      30-Sep-2022 11:06                5874
function.geoip-isp-by-name.php                     30-Sep-2022 11:06                4362
function.geoip-netspeedcell-by-name.php            30-Sep-2022 11:06                5085
function.geoip-org-by-name.php                     30-Sep-2022 11:06                4381
function.geoip-record-by-name.php                  30-Sep-2022 11:06                7542
function.geoip-region-by-name.php                  30-Sep-2022 11:06                4999
function.geoip-region-name-by-code.php             30-Sep-2022 11:06                7128
function.geoip-setup-custom-directory.php          30-Sep-2022 11:06                4140
function.geoip-time-zone-by-country-and-region.php 30-Sep-2022 11:06                7338
function.get-browser.php                           30-Sep-2022 11:06                8238
function.get-called-class.php                      30-Sep-2022 11:06                5110
function.get-cfg-var.php                           30-Sep-2022 11:06                3735
function.get-class-methods.php                     30-Sep-2022 11:06                7270
function.get-class-vars.php                        30-Sep-2022 11:06               10418
function.get-class.php                             30-Sep-2022 11:06               12965
function.get-current-user.php                      30-Sep-2022 11:06                4413
function.get-debug-type.php                        30-Sep-2022 11:06                9702
function.get-declared-classes.php                  30-Sep-2022 11:06                5218
function.get-declared-interfaces.php               30-Sep-2022 11:06                4273
function.get-declared-traits.php                   30-Sep-2022 11:06                2882
function.get-defined-constants.php                 30-Sep-2022 11:06                7412
function.get-defined-functions.php                 30-Sep-2022 11:06                6966
function.get-defined-vars.php                      30-Sep-2022 11:06                6428
function.get-extension-funcs.php                   30-Sep-2022 11:06                5474
function.get-headers.php                           30-Sep-2022 11:06                9005
function.get-html-translation-table.php            30-Sep-2022 11:06               13523
function.get-include-path.php                      30-Sep-2022 11:06                4359
function.get-included-files.php                    30-Sep-2022 11:06                6075
function.get-loaded-extensions.php                 30-Sep-2022 11:06                5435
function.get-magic-quotes-gpc.php                  30-Sep-2022 11:06                4145
function.get-magic-quotes-runtime.php              30-Sep-2022 11:06                4882
function.get-mangled-object-vars.php               30-Sep-2022 11:06                8401
function.get-meta-tags.php                         30-Sep-2022 11:06                8101
function.get-object-vars.php                       30-Sep-2022 11:06                6412
function.get-parent-class.php                      30-Sep-2022 11:06                7894
function.get-required-files.php                    30-Sep-2022 11:06                1813
function.get-resource-id.php                       30-Sep-2022 11:06                4602
function.get-resource-type.php                     30-Sep-2022 11:06                4763
function.get-resources.php                         30-Sep-2022 11:06                7613
function.getallheaders.php                         30-Sep-2022 11:06                4678
function.getcwd.php                                30-Sep-2022 11:06                5363
function.getdate.php                               30-Sep-2022 11:06                9645
function.getenv.php                                30-Sep-2022 11:06                7996
function.gethostbyaddr.php                         30-Sep-2022 11:06                4283
function.gethostbyname.php                         30-Sep-2022 11:06                4543
function.gethostbynamel.php                        30-Sep-2022 11:06                5079
function.gethostname.php                           30-Sep-2022 11:06                3909
function.getimagesize.php                          30-Sep-2022 11:06               17537
function.getimagesizefromstring.php                30-Sep-2022 11:06                5592
function.getlastmod.php                            30-Sep-2022 11:06                5351
function.getmxrr.php                               30-Sep-2022 11:06                5820
function.getmygid.php                              30-Sep-2022 11:06                3376
function.getmyinode.php                            30-Sep-2022 11:06                3430
function.getmypid.php                              30-Sep-2022 11:06                3820
function.getmyuid.php                              30-Sep-2022 11:06                3384
function.getopt.php                                30-Sep-2022 11:06               15481
function.getprotobyname.php                        30-Sep-2022 11:06                4694
function.getprotobynumber.php                      30-Sep-2022 11:06                3211
function.getrandmax.php                            30-Sep-2022 11:06                3004
function.getrusage.php                             30-Sep-2022 11:06               11875
function.getservbyname.php                         30-Sep-2022 11:06                6519
function.getservbyport.php                         30-Sep-2022 11:06                3669
function.gettext.php                               30-Sep-2022 11:06                6054
function.gettimeofday.php                          30-Sep-2022 11:06                4668
function.gettype.php                               30-Sep-2022 11:06                9507
function.glob.php                                  30-Sep-2022 11:06                9841
function.gmdate.php                                30-Sep-2022 11:06                7634
function.gmmktime.php                              30-Sep-2022 11:06               10743
function.gmp-abs.php                               30-Sep-2022 11:06                4375
function.gmp-add.php                               30-Sep-2022 11:06                4563
function.gmp-and.php                               30-Sep-2022 11:06                5044
function.gmp-binomial.php                          30-Sep-2022 11:06                3716
function.gmp-clrbit.php                            30-Sep-2022 11:06                5585
function.gmp-cmp.php                               30-Sep-2022 11:06                5443
function.gmp-com.php                               30-Sep-2022 11:06                3842
function.gmp-div-q.php                             30-Sep-2022 11:06                9797
function.gmp-div-qr.php                            30-Sep-2022 11:06                6439
function.gmp-div-r.php                             30-Sep-2022 11:06                5866
function.gmp-div.php                               30-Sep-2022 11:06                1654
function.gmp-divexact.php                          30-Sep-2022 11:06                5699
function.gmp-export.php                            30-Sep-2022 11:06                5260
function.gmp-fact.php                              30-Sep-2022 11:06                4830
function.gmp-gcd.php                               30-Sep-2022 11:06                4959
function.gmp-gcdext.php                            30-Sep-2022 11:06                9424
function.gmp-hamdist.php                           30-Sep-2022 11:06                6274
function.gmp-import.php                            30-Sep-2022 11:06                5722
function.gmp-init.php                              30-Sep-2022 11:06                5176
function.gmp-intval.php                            30-Sep-2022 11:06                5122
function.gmp-invert.php                            30-Sep-2022 11:06                5120
function.gmp-jacobi.php                            30-Sep-2022 11:06                5441
function.gmp-kronecker.php                         30-Sep-2022 11:06                3723
function.gmp-lcm.php                               30-Sep-2022 11:06                3538
function.gmp-legendre.php                          30-Sep-2022 11:06                5460
function.gmp-mod.php                               30-Sep-2022 11:06                4689
function.gmp-mul.php                               30-Sep-2022 11:06                4771
function.gmp-neg.php                               30-Sep-2022 11:06                4323
function.gmp-nextprime.php                         30-Sep-2022 11:06                5052
function.gmp-or.php                                30-Sep-2022 11:06                5270
function.gmp-perfect-power.php                     30-Sep-2022 11:06                3082
function.gmp-perfect-square.php                    30-Sep-2022 11:06                5431
function.gmp-popcount.php                          30-Sep-2022 11:06                4742
function.gmp-pow.php                               30-Sep-2022 11:06                5687
function.gmp-powm.php                              30-Sep-2022 11:06                5519
function.gmp-prob-prime.php                        30-Sep-2022 11:06                5632
function.gmp-random-bits.php                       30-Sep-2022 11:06                4566
function.gmp-random-range.php                      30-Sep-2022 11:06                5485
function.gmp-random-seed.php                       30-Sep-2022 11:06                6744
function.gmp-random.php                            30-Sep-2022 11:06                5449
function.gmp-root.php                              30-Sep-2022 11:06                3016
function.gmp-rootrem.php                           30-Sep-2022 11:06                3124
function.gmp-scan0.php                             30-Sep-2022 11:06                5443
function.gmp-scan1.php                             30-Sep-2022 11:06                5455
function.gmp-setbit.php                            30-Sep-2022 11:06               11959
function.gmp-sign.php                              30-Sep-2022 11:06                4998
function.gmp-sqrt.php                              30-Sep-2022 11:06                4920
function.gmp-sqrtrem.php                           30-Sep-2022 11:06                6332
function.gmp-strval.php                            30-Sep-2022 11:06                4477
function.gmp-sub.php                               30-Sep-2022 11:06                4863
function.gmp-testbit.php                           30-Sep-2022 11:06                5614
function.gmp-xor.php                               30-Sep-2022 11:06                5271
function.gmstrftime.php                            30-Sep-2022 11:06                9185
function.gnupg-adddecryptkey.php                   30-Sep-2022 11:06                5124
function.gnupg-addencryptkey.php                   30-Sep-2022 11:06                4750
function.gnupg-addsignkey.php                      30-Sep-2022 11:06                5162
function.gnupg-cleardecryptkeys.php                30-Sep-2022 11:06                4329
function.gnupg-clearencryptkeys.php                30-Sep-2022 11:06                4333
function.gnupg-clearsignkeys.php                   30-Sep-2022 11:06                4271
function.gnupg-decrypt.php                         30-Sep-2022 11:06                5922
function.gnupg-decryptverify.php                   30-Sep-2022 11:06                7038
function.gnupg-deletekey.php                       30-Sep-2022 11:06                4918
function.gnupg-encrypt.php                         30-Sep-2022 11:06                5866
function.gnupg-encryptsign.php                     30-Sep-2022 11:06                6788
function.gnupg-export.php                          30-Sep-2022 11:06                5029
function.gnupg-getengineinfo.php                   30-Sep-2022 11:06                5515
function.gnupg-geterror.php                        30-Sep-2022 11:06                4180
function.gnupg-geterrorinfo.php                    30-Sep-2022 11:06                5658
function.gnupg-getprotocol.php                     30-Sep-2022 11:06                4314
function.gnupg-gettrustlist.php                    30-Sep-2022 11:06                5004
function.gnupg-import.php                          30-Sep-2022 11:06                5273
function.gnupg-init.php                            30-Sep-2022 11:06                7260
function.gnupg-keyinfo.php                         30-Sep-2022 11:06                5205
function.gnupg-listsignatures.php                  30-Sep-2022 11:06                5233
function.gnupg-setarmor.php                        30-Sep-2022 11:06                5647
function.gnupg-seterrormode.php                    30-Sep-2022 11:06                5524
function.gnupg-setsignmode.php                     30-Sep-2022 11:06                5419
function.gnupg-sign.php                            30-Sep-2022 11:06                6064
function.gnupg-verify.php                          30-Sep-2022 11:06                8178
function.grapheme-extract.php                      30-Sep-2022 11:06                8742
function.grapheme-stripos.php                      30-Sep-2022 11:06                8242
function.grapheme-stristr.php                      30-Sep-2022 11:06                7798
function.grapheme-strlen.php                       30-Sep-2022 11:06                5561
function.grapheme-strpos.php                       30-Sep-2022 11:06                7849
function.grapheme-strripos.php                     30-Sep-2022 11:06                7696
function.grapheme-strrpos.php                      30-Sep-2022 11:06                7295
function.grapheme-strstr.php                       30-Sep-2022 11:06                7340
function.grapheme-substr.php                       30-Sep-2022 11:06                7890
function.gregoriantojd.php                         30-Sep-2022 11:06                8065
function.gzclose.php                               30-Sep-2022 11:06                4163
function.gzcompress.php                            30-Sep-2022 11:06                5903
function.gzdecode.php                              30-Sep-2022 11:06                3554
function.gzdeflate.php                             30-Sep-2022 11:06                5585
function.gzencode.php                              30-Sep-2022 11:06                6636
function.gzeof.php                                 30-Sep-2022 11:06                4025
function.gzfile.php                                30-Sep-2022 11:06                4719
function.gzgetc.php                                30-Sep-2022 11:06                4626
function.gzgets.php                                30-Sep-2022 11:06                5943
function.gzgetss.php                               30-Sep-2022 11:06                6093
function.gzinflate.php                             30-Sep-2022 11:06                5458
function.gzopen.php                                30-Sep-2022 11:06                5498
function.gzpassthru.php                            30-Sep-2022 11:06                4768
function.gzputs.php                                30-Sep-2022 11:06                1621
function.gzread.php                                30-Sep-2022 11:06                6646
function.gzrewind.php                              30-Sep-2022 11:06                3119
function.gzseek.php                                30-Sep-2022 11:06                6176
function.gztell.php                                30-Sep-2022 11:06                3380
function.gzuncompress.php                          30-Sep-2022 11:06                5299
function.gzwrite.php                               30-Sep-2022 11:06                6426
function.halt-compiler.php                         30-Sep-2022 11:06                5442
function.hash-algos.php                            30-Sep-2022 11:06                5787
function.hash-copy.php                             30-Sep-2022 11:06                5534
function.hash-equals.php                           30-Sep-2022 11:06                6478
function.hash-file.php                             30-Sep-2022 11:06                7355
function.hash-final.php                            30-Sep-2022 11:06                6273
function.hash-hkdf.php                             30-Sep-2022 11:06                8889
function.hash-hmac-algos.php                       30-Sep-2022 11:06                5291
function.hash-hmac-file.php                        30-Sep-2022 11:06                7421
function.hash-hmac.php                             30-Sep-2022 11:06                7170
function.hash-init.php                             30-Sep-2022 11:06                8556
function.hash-pbkdf2.php                           30-Sep-2022 11:06               12082
function.hash-update-file.php                      30-Sep-2022 11:06                5669
function.hash-update-stream.php                    30-Sep-2022 11:06                7235
function.hash-update.php                           30-Sep-2022 11:06                4378
function.hash.php                                  30-Sep-2022 11:06                7159
function.header-register-callback.php              30-Sep-2022 11:06                6923
function.header-remove.php                         30-Sep-2022 11:06                6699
function.header.php                                30-Sep-2022 11:06               19665
function.headers-list.php                          30-Sep-2022 11:06                6331
function.headers-sent.php                          30-Sep-2022 11:06                8385
function.hebrev.php                                30-Sep-2022 11:06                3252
function.hebrevc.php                               30-Sep-2022 11:06                3738
function.hex2bin.php                               30-Sep-2022 11:06                4922
function.hexdec.php                                30-Sep-2022 11:06                6520
function.highlight-file.php                        30-Sep-2022 11:06                5409
function.highlight-string.php                      30-Sep-2022 11:06                5697
function.hrtime.php                                30-Sep-2022 11:06                4720
function.html-entity-decode.php                    30-Sep-2022 11:06               14454
function.htmlentities.php                          30-Sep-2022 11:06               17406
function.htmlspecialchars-decode.php               30-Sep-2022 11:06                8886
function.htmlspecialchars.php                      30-Sep-2022 11:06               20756
function.http-build-query.php                      30-Sep-2022 11:06               20573
function.http-response-code.php                    30-Sep-2022 11:06                6964
function.hypot.php                                 30-Sep-2022 11:06                2830
function.ibase-add-user.php                        30-Sep-2022 11:06                4748
function.ibase-affected-rows.php                   30-Sep-2022 11:06                3406
function.ibase-backup.php                          30-Sep-2022 11:06               10133
function.ibase-blob-add.php                        30-Sep-2022 11:06                3995
function.ibase-blob-cancel.php                     30-Sep-2022 11:06                3616
function.ibase-blob-close.php                      30-Sep-2022 11:06                3925
function.ibase-blob-create.php                     30-Sep-2022 11:06                3975
function.ibase-blob-echo.php                       30-Sep-2022 11:06                3942
function.ibase-blob-get.php                        30-Sep-2022 11:06                6628
function.ibase-blob-import.php                     30-Sep-2022 11:06                8453
function.ibase-blob-info.php                       30-Sep-2022 11:06                3297
function.ibase-blob-open.php                       30-Sep-2022 11:06                4149
function.ibase-close.php                           30-Sep-2022 11:06                3657
function.ibase-commit-ret.php                      30-Sep-2022 11:06                3106
function.ibase-commit.php                          30-Sep-2022 11:06                2882
function.ibase-connect.php                         30-Sep-2022 11:06               10329
function.ibase-db-info.php                         30-Sep-2022 11:06                2423
function.ibase-delete-user.php                     30-Sep-2022 11:06                3388
function.ibase-drop-db.php                         30-Sep-2022 11:06                3524
function.ibase-errcode.php                         30-Sep-2022 11:06                2611
function.ibase-errmsg.php                          30-Sep-2022 11:06                2592
function.ibase-execute.php                         30-Sep-2022 11:06                7144
function.ibase-fetch-assoc.php                     30-Sep-2022 11:06                4753
function.ibase-fetch-object.php                    30-Sep-2022 11:06                6700
function.ibase-fetch-row.php                       30-Sep-2022 11:06                4373
function.ibase-field-info.php                      30-Sep-2022 11:06                7121
function.ibase-free-event-handler.php              30-Sep-2022 11:06                3393
function.ibase-free-query.php                      30-Sep-2022 11:06                2634
function.ibase-free-result.php                     30-Sep-2022 11:06                2732
function.ibase-gen-id.php                          30-Sep-2022 11:06                2673
function.ibase-maintain-db.php                     30-Sep-2022 11:06                2761
function.ibase-modify-user.php                     30-Sep-2022 11:06                4760
function.ibase-name-result.php                     30-Sep-2022 11:06                5764
function.ibase-num-fields.php                      30-Sep-2022 11:06                6664
function.ibase-num-params.php                      30-Sep-2022 11:06                3434
function.ibase-param-info.php                      30-Sep-2022 11:06                3604
function.ibase-pconnect.php                        30-Sep-2022 11:06                7660
function.ibase-prepare.php                         30-Sep-2022 11:06                4159
function.ibase-query.php                           30-Sep-2022 11:06                7202
function.ibase-restore.php                         30-Sep-2022 11:06               10168
function.ibase-rollback-ret.php                    30-Sep-2022 11:06                3143
function.ibase-rollback.php                        30-Sep-2022 11:06                2921
function.ibase-server-info.php                     30-Sep-2022 11:06               10837
function.ibase-service-attach.php                  30-Sep-2022 11:06               12632
function.ibase-service-detach.php                  30-Sep-2022 11:06                6951
function.ibase-set-event-handler.php               30-Sep-2022 11:06                7930
function.ibase-trans.php                           30-Sep-2022 11:06                5692
function.ibase-wait-event.php                      30-Sep-2022 11:06                4036
function.iconv-get-encoding.php                    30-Sep-2022 11:06                5652
function.iconv-mime-decode-headers.php             30-Sep-2022 11:06               10398
function.iconv-mime-decode.php                     30-Sep-2022 11:06                8168
function.iconv-mime-encode.php                     30-Sep-2022 11:06               11672
function.iconv-set-encoding.php                    30-Sep-2022 11:06                4894
function.iconv-strlen.php                          30-Sep-2022 11:06                4722
function.iconv-strpos.php                          30-Sep-2022 11:06                7006
function.iconv-strrpos.php                         30-Sep-2022 11:06                6293
function.iconv-substr.php                          30-Sep-2022 11:06                7904
function.iconv.php                                 30-Sep-2022 11:06                8960
function.idate.php                                 30-Sep-2022 11:06               11411
function.idn-to-ascii.php                          30-Sep-2022 11:06                6911
function.idn-to-utf8.php                           30-Sep-2022 11:06                6898
function.igbinary-serialize.php                    30-Sep-2022 11:06                9735
function.igbinary-unserialize.php                  30-Sep-2022 11:06                9118
function.ignore-user-abort.php                     30-Sep-2022 11:06                8206
function.image-type-to-extension.php               30-Sep-2022 11:06                5139
function.image-type-to-mime-type.php               30-Sep-2022 11:06                7791
function.image2wbmp.php                            30-Sep-2022 11:06                6323
function.imageaffine.php                           30-Sep-2022 11:06                4505
function.imageaffinematrixconcat.php               30-Sep-2022 11:06                6518
function.imageaffinematrixget.php                  30-Sep-2022 11:06                5977
function.imagealphablending.php                    30-Sep-2022 11:06                7483
function.imageantialias.php                        30-Sep-2022 11:06               11053
function.imagearc.php                              30-Sep-2022 11:06               13756
function.imageavif.php                             30-Sep-2022 11:06                5704
function.imagebmp.php                              30-Sep-2022 11:06                7758
function.imagechar.php                             30-Sep-2022 11:06               10116
function.imagecharup.php                           30-Sep-2022 11:06                9867
function.imagecolorallocate.php                    30-Sep-2022 11:06               10039
function.imagecolorallocatealpha.php               30-Sep-2022 11:06               18571
function.imagecolorat.php                          30-Sep-2022 11:06               10375
function.imagecolorclosest.php                     30-Sep-2022 11:06               12630
function.imagecolorclosestalpha.php                30-Sep-2022 11:06               12985
function.imagecolorclosesthwb.php                  30-Sep-2022 11:06                6475
function.imagecolordeallocate.php                  30-Sep-2022 11:06                5797
function.imagecolorexact.php                       30-Sep-2022 11:06                8552
function.imagecolorexactalpha.php                  30-Sep-2022 11:06                9356
function.imagecolormatch.php                       30-Sep-2022 11:06                8566
function.imagecolorresolve.php                     30-Sep-2022 11:06                7728
function.imagecolorresolvealpha.php                30-Sep-2022 11:06                8263
function.imagecolorset.php                         30-Sep-2022 11:06                8711
function.imagecolorsforindex.php                   30-Sep-2022 11:06                7496
function.imagecolorstotal.php                      30-Sep-2022 11:06                5956
function.imagecolortransparent.php                 30-Sep-2022 11:06                9182
function.imageconvolution.php                      30-Sep-2022 11:06               11925
function.imagecopy.php                             30-Sep-2022 11:06                9198
function.imagecopymerge.php                        30-Sep-2022 11:06                9252
function.imagecopymergegray.php                    30-Sep-2022 11:06                9795
function.imagecopyresampled.php                    30-Sep-2022 11:06               19184
function.imagecopyresized.php                      30-Sep-2022 11:06               14207
function.imagecreate.php                           30-Sep-2022 11:06                8412
function.imagecreatefromavif.php                   30-Sep-2022 11:06                2760
function.imagecreatefrombmp.php                    30-Sep-2022 11:06                5573
function.imagecreatefromgd.php                     30-Sep-2022 11:06                6228
function.imagecreatefromgd2.php                    30-Sep-2022 11:06                6491
function.imagecreatefromgd2part.php                30-Sep-2022 11:06                8980
function.imagecreatefromgif.php                    30-Sep-2022 11:06               10555
function.imagecreatefromjpeg.php                   30-Sep-2022 11:06               10098
function.imagecreatefrompng.php                    30-Sep-2022 11:06               10037
function.imagecreatefromstring.php                 30-Sep-2022 11:06                8255
function.imagecreatefromtga.php                    30-Sep-2022 11:06                3403
function.imagecreatefromwbmp.php                   30-Sep-2022 11:06                9991
function.imagecreatefromwebp.php                   30-Sep-2022 11:06                5730
function.imagecreatefromxbm.php                    30-Sep-2022 11:06                5550
function.imagecreatefromxpm.php                    30-Sep-2022 11:06                6385
function.imagecreatetruecolor.php                  30-Sep-2022 11:06                7169
function.imagecrop.php                             30-Sep-2022 11:06                7785
function.imagecropauto.php                         30-Sep-2022 11:06               10713
function.imagedashedline.php                       30-Sep-2022 11:06               13715
function.imagedestroy.php                          30-Sep-2022 11:06                5158
function.imageellipse.php                          30-Sep-2022 11:06               10081
function.imagefill.php                             30-Sep-2022 11:06                7538
function.imagefilledarc.php                        30-Sep-2022 11:06               18552
function.imagefilledellipse.php                    30-Sep-2022 11:06                9724
function.imagefilledpolygon.php                    30-Sep-2022 11:06               12778
function.imagefilledrectangle.php                  30-Sep-2022 11:06                8254
function.imagefilltoborder.php                     30-Sep-2022 11:06               11462
function.imagefilter.php                           30-Sep-2022 11:06               33856
function.imageflip.php                             30-Sep-2022 11:06                9517
function.imagefontheight.php                       30-Sep-2022 11:06                6649
function.imagefontwidth.php                        30-Sep-2022 11:06                6640
function.imageftbbox.php                           30-Sep-2022 11:06               14283
function.imagefttext.php                           30-Sep-2022 11:06               15754
function.imagegammacorrect.php                     30-Sep-2022 11:06                5936
function.imagegd.php                               30-Sep-2022 11:06               10813
function.imagegd2.php                              30-Sep-2022 11:06               11402
function.imagegetclip.php                          30-Sep-2022 11:06                6082
function.imagegetinterpolation.php                 30-Sep-2022 11:06                3681
function.imagegif.php                              30-Sep-2022 11:06               17501
function.imagegrabscreen.php                       30-Sep-2022 11:06                4697
function.imagegrabwindow.php                       30-Sep-2022 11:06                9673
function.imageinterlace.php                        30-Sep-2022 11:06                6737
function.imageistruecolor.php                      30-Sep-2022 11:06                7671
function.imagejpeg.php                             30-Sep-2022 11:06               15633
function.imagelayereffect.php                      30-Sep-2022 11:06               11621
function.imageline.php                             30-Sep-2022 11:06               16401
function.imageloadfont.php                         30-Sep-2022 11:06                9674
function.imageopenpolygon.php                      30-Sep-2022 11:06               10439
function.imagepalettecopy.php                      30-Sep-2022 11:06                7734
function.imagepalettetotruecolor.php               30-Sep-2022 11:06               10365
function.imagepng.php                              30-Sep-2022 11:06                8705
function.imagepolygon.php                          30-Sep-2022 11:06               10834
function.imagerectangle.php                        30-Sep-2022 11:06               10548
function.imageresolution.php                       30-Sep-2022 11:06                7335
function.imagerotate.php                           30-Sep-2022 11:06                9309
function.imagesavealpha.php                        30-Sep-2022 11:06                6829
function.imagescale.php                            30-Sep-2022 11:06                6254
function.imagesetbrush.php                         30-Sep-2022 11:06                9308
function.imagesetclip.php                          30-Sep-2022 11:06                4938
function.imagesetinterpolation.php                 30-Sep-2022 11:06               10318
function.imagesetpixel.php                         30-Sep-2022 11:06               11692
function.imagesetstyle.php                         30-Sep-2022 11:06               12484
function.imagesetthickness.php                     30-Sep-2022 11:06                8533
function.imagesettile.php                          30-Sep-2022 11:06                8379
function.imagestring.php                           30-Sep-2022 11:06               10265
function.imagestringup.php                         30-Sep-2022 11:06                9347
function.imagesx.php                               30-Sep-2022 11:06                5218
function.imagesy.php                               30-Sep-2022 11:06                5232
function.imagetruecolortopalette.php               30-Sep-2022 11:06                6749
function.imagettfbbox.php                          30-Sep-2022 11:06               20623
function.imagettftext.php                          30-Sep-2022 11:06               18889
function.imagetypes.php                            30-Sep-2022 11:06                4648
function.imagewbmp.php                             30-Sep-2022 11:06               15494
function.imagewebp.php                             30-Sep-2022 11:06                7249
function.imagexbm.php                              30-Sep-2022 11:06               11888
function.imap-8bit.php                             30-Sep-2022 11:06                3039
function.imap-alerts.php                           30-Sep-2022 11:06                3155
function.imap-append.php                           30-Sep-2022 11:06               10188
function.imap-base64.php                           30-Sep-2022 11:06                3416
function.imap-binary.php                           30-Sep-2022 11:06                3018
function.imap-body.php                             30-Sep-2022 11:06                5358
function.imap-bodystruct.php                       30-Sep-2022 11:06                4575
function.imap-check.php                            30-Sep-2022 11:06                5995
function.imap-clearflag-full.php                   30-Sep-2022 11:06                5523
function.imap-close.php                            30-Sep-2022 11:06                4222
function.imap-create.php                           30-Sep-2022 11:06                1725
function.imap-createmailbox.php                    30-Sep-2022 11:06               15844
function.imap-delete.php                           30-Sep-2022 11:06               10047
function.imap-deletemailbox.php                    30-Sep-2022 11:06                4858
function.imap-errors.php                           30-Sep-2022 11:06                3370
function.imap-expunge.php                          30-Sep-2022 11:06                3526
function.imap-fetch-overview.php                   30-Sep-2022 11:06               11682
function.imap-fetchbody.php                        30-Sep-2022 11:06                5998
function.imap-fetchheader.php                      30-Sep-2022 11:06                5497
function.imap-fetchmime.php                        30-Sep-2022 11:06                5986
function.imap-fetchstructure.php                   30-Sep-2022 11:06                9625
function.imap-fetchtext.php                        30-Sep-2022 11:06                1706
function.imap-gc.php                               30-Sep-2022 11:06                4912
function.imap-get-quota.php                        30-Sep-2022 11:06               13015
function.imap-get-quotaroot.php                    30-Sep-2022 11:06                9498
function.imap-getacl.php                           30-Sep-2022 11:06                5895
function.imap-getmailboxes.php                     30-Sep-2022 11:06               12473
function.imap-getsubscribed.php                    30-Sep-2022 11:06                7620
function.imap-header.php                           30-Sep-2022 11:06                1933
function.imap-headerinfo.php                       30-Sep-2022 11:06               12173
function.imap-headers.php                          30-Sep-2022 11:06                3440
function.imap-last-error.php                       30-Sep-2022 11:06                3091
function.imap-list.php                             30-Sep-2022 11:06                8971
function.imap-listmailbox.php                      30-Sep-2022 11:06                1712
function.imap-listscan.php                         30-Sep-2022 11:06                6829
function.imap-listsubscribed.php                   30-Sep-2022 11:06                1733
function.imap-lsub.php                             30-Sep-2022 11:06                5961
function.imap-mail-compose.php                     30-Sep-2022 11:06               15269
function.imap-mail-copy.php                        30-Sep-2022 11:06                6155
function.imap-mail-move.php                        30-Sep-2022 11:06                6561
function.imap-mail.php                             30-Sep-2022 11:06                6702
function.imap-mailboxmsginfo.php                   30-Sep-2022 11:06               10417
function.imap-mime-header-decode.php               30-Sep-2022 11:06                6415
function.imap-msgno.php                            30-Sep-2022 11:06                4050
function.imap-mutf7-to-utf8.php                    30-Sep-2022 11:06                3160
function.imap-num-msg.php                          30-Sep-2022 11:06                3949
function.imap-num-recent.php                       30-Sep-2022 11:06                3859
function.imap-open.php                             30-Sep-2022 11:06               22849
function.imap-ping.php                             30-Sep-2022 11:06                4959
function.imap-qprint.php                           30-Sep-2022 11:06                3054
function.imap-rename.php                           30-Sep-2022 11:06                1727
function.imap-renamemailbox.php                    30-Sep-2022 11:06                5573
function.imap-reopen.php                           30-Sep-2022 11:06                8606
function.imap-rfc822-parse-adrlist.php             30-Sep-2022 11:06                8284
function.imap-rfc822-parse-headers.php             30-Sep-2022 11:06                3603
function.imap-rfc822-write-address.php             30-Sep-2022 11:06                5296
function.imap-savebody.php                         30-Sep-2022 11:06                6126
function.imap-scan.php                             30-Sep-2022 11:06                1693
function.imap-scanmailbox.php                      30-Sep-2022 11:06                1724
function.imap-search.php                           30-Sep-2022 11:06               13754
function.imap-set-quota.php                        30-Sep-2022 11:06                6788
function.imap-setacl.php                           30-Sep-2022 11:06                5450
function.imap-setflag-full.php                     30-Sep-2022 11:06                7949
function.imap-sort.php                             30-Sep-2022 11:06                7709
function.imap-status.php                           30-Sep-2022 11:06               11114
function.imap-subscribe.php                        30-Sep-2022 11:06                4317
function.imap-thread.php                           30-Sep-2022 11:06                8078
function.imap-timeout.php                          30-Sep-2022 11:06                4324
function.imap-uid.php                              30-Sep-2022 11:06                4526
function.imap-undelete.php                         30-Sep-2022 11:06                4941
function.imap-unsubscribe.php                      30-Sep-2022 11:06                4398
function.imap-utf7-decode.php                      30-Sep-2022 11:06                3484
function.imap-utf7-encode.php                      30-Sep-2022 11:06                3197
function.imap-utf8-to-mutf7.php                    30-Sep-2022 11:06                3163
function.imap-utf8.php                             30-Sep-2022 11:06                4245
function.implode.php                               30-Sep-2022 11:06                7777
function.in-array.php                              30-Sep-2022 11:06               12073
function.include-once.php                          30-Sep-2022 11:06                2157
function.include.php                               30-Sep-2022 11:06               21766
function.inet-ntop.php                             30-Sep-2022 11:06                6430
function.inet-pton.php                             30-Sep-2022 11:06                4884
function.inflate-add.php                           30-Sep-2022 11:06                5395
function.inflate-get-read-len.php                  30-Sep-2022 11:06                3289
function.inflate-get-status.php                    30-Sep-2022 11:06                3177
function.inflate-init.php                          30-Sep-2022 11:06                6450
function.ini-alter.php                             30-Sep-2022 11:06                1672
function.ini-get-all.php                           30-Sep-2022 11:06                9794
function.ini-get.php                               30-Sep-2022 11:06               11036
function.ini-restore.php                           30-Sep-2022 11:06                6525
function.ini-set.php                               30-Sep-2022 11:06                6294
function.inotify-add-watch.php                     30-Sep-2022 11:06                3932
function.inotify-init.php                          30-Sep-2022 11:06                9330
function.inotify-queue-len.php                     30-Sep-2022 11:06                3738
function.inotify-read.php                          30-Sep-2022 11:06                4359
function.inotify-rm-watch.php                      30-Sep-2022 11:06                3424
function.intdiv.php                                30-Sep-2022 11:06                7363
function.interface-exists.php                      30-Sep-2022 11:06                5413
function.intl-error-name.php                       30-Sep-2022 11:06                5060
function.intl-get-error-code.php                   30-Sep-2022 11:06                4600
function.intl-get-error-message.php                30-Sep-2022 11:06                4599
function.intl-is-failure.php                       30-Sep-2022 11:06                5505
function.intval.php                                30-Sep-2022 11:06               14252
function.ip2long.php                               30-Sep-2022 11:06                9700
function.iptcembed.php                             30-Sep-2022 11:06               12754
function.iptcparse.php                             30-Sep-2022 11:06                4509
function.is-a.php                                  30-Sep-2022 11:06                6938
function.is-array.php                              30-Sep-2022 11:06                5761
function.is-bool.php                               30-Sep-2022 11:06                5726
function.is-callable.php                           30-Sep-2022 11:06               11278
function.is-countable.php                          30-Sep-2022 11:06                6318
function.is-dir.php                                30-Sep-2022 11:06                6586
function.is-double.php                             30-Sep-2022 11:06                1675
function.is-executable.php                         30-Sep-2022 11:06                6474
function.is-file.php                               30-Sep-2022 11:06                5903
function.is-finite.php                             30-Sep-2022 11:06                3159
function.is-float.php                              30-Sep-2022 11:06                6570
function.is-infinite.php                           30-Sep-2022 11:06                3348
function.is-int.php                                30-Sep-2022 11:06                6742
function.is-integer.php                            30-Sep-2022 11:06                1668
function.is-iterable.php                           30-Sep-2022 11:06                5799
function.is-link.php                               30-Sep-2022 11:06                5661
function.is-long.php                               30-Sep-2022 11:06                1649
function.is-nan.php                                30-Sep-2022 11:06                4505
function.is-null.php                               30-Sep-2022 11:06                5906
function.is-numeric.php                            30-Sep-2022 11:06               13103
function.is-object.php                             30-Sep-2022 11:06                7301
function.is-readable.php                           30-Sep-2022 11:06                6313
function.is-real.php                               30-Sep-2022 11:06                1905
function.is-resource.php                           30-Sep-2022 11:06                5042
function.is-scalar.php                             30-Sep-2022 11:06                7992
function.is-soap-fault.php                         30-Sep-2022 11:06                8659
function.is-string.php                             30-Sep-2022 11:06                6804
function.is-subclass-of.php                        30-Sep-2022 11:06               13454
function.is-tainted.php                            30-Sep-2022 11:06                2231
function.is-uploaded-file.php                      30-Sep-2022 11:06                6856
function.is-writable.php                           30-Sep-2022 11:06                6003
function.is-writeable.php                          30-Sep-2022 11:06                1696
function.isset.php                                 30-Sep-2022 11:06               17066
function.iterator-apply.php                        30-Sep-2022 11:06                6626
function.iterator-count.php                        30-Sep-2022 11:06                7899
function.iterator-to-array.php                     30-Sep-2022 11:06                6294
function.jddayofweek.php                           30-Sep-2022 11:06                3734
function.jdmonthname.php                           30-Sep-2022 11:06                4578
function.jdtofrench.php                            30-Sep-2022 11:06                3120
function.jdtogregorian.php                         30-Sep-2022 11:06                3157
function.jdtojewish.php                            30-Sep-2022 11:06                7252
function.jdtojulian.php                            30-Sep-2022 11:06                3127
function.jdtounix.php                              30-Sep-2022 11:06                4436
function.jewishtojd.php                            30-Sep-2022 11:06                4484
function.join.php                                  30-Sep-2022 11:06                1615
function.jpeg2wbmp.php                             30-Sep-2022 11:06                6397
function.json-decode.php                           30-Sep-2022 11:06               20853
function.json-encode.php                           30-Sep-2022 11:06               31206
function.json-last-error-msg.php                   30-Sep-2022 11:06                3014
function.json-last-error.php                       30-Sep-2022 11:06               14997
function.juliantojd.php                            30-Sep-2022 11:06                4600
function.key-exists.php                            30-Sep-2022 11:06                1692
function.key.php                                   30-Sep-2022 11:06                7593
function.krsort.php                                30-Sep-2022 11:06                7973
function.ksort.php                                 30-Sep-2022 11:06                9955
function.lcfirst.php                               30-Sep-2022 11:06                5769
function.lcg-value.php                             30-Sep-2022 11:06                3642
function.lchgrp.php                                30-Sep-2022 11:06                5840
function.lchown.php                                30-Sep-2022 11:06                5696
function.ldap-8859-to-t61.php                      30-Sep-2022 11:06                3217
function.ldap-add-ext.php                          30-Sep-2022 11:06                5549
function.ldap-add.php                              30-Sep-2022 11:06               11064
function.ldap-bind-ext.php                         30-Sep-2022 11:06                5564
function.ldap-bind.php                             30-Sep-2022 11:06               10228
function.ldap-close.php                            30-Sep-2022 11:06                1673
function.ldap-compare.php                          30-Sep-2022 11:06               11455
function.ldap-connect.php                          30-Sep-2022 11:06               10067
function.ldap-control-paged-result-response.php    30-Sep-2022 11:06                5593
function.ldap-control-paged-result.php             30-Sep-2022 11:06               15735
function.ldap-count-entries.php                    30-Sep-2022 11:06                5806
function.ldap-count-references.php                 30-Sep-2022 11:06                4680
function.ldap-delete-ext.php                       30-Sep-2022 11:06                5133
function.ldap-delete.php                           30-Sep-2022 11:06                5186
function.ldap-dn2ufn.php                           30-Sep-2022 11:06                2619
function.ldap-err2str.php                          30-Sep-2022 11:06                4698
function.ldap-errno.php                            30-Sep-2022 11:06                7974
function.ldap-error.php                            30-Sep-2022 11:06                4643
function.ldap-escape.php                           30-Sep-2022 11:06                6350
function.ldap-exop-passwd.php                      30-Sep-2022 11:06               10749
function.ldap-exop-refresh.php                     30-Sep-2022 11:06                4913
function.ldap-exop-whoami.php                      30-Sep-2022 11:06                3797
function.ldap-exop.php                             30-Sep-2022 11:06               12509
function.ldap-explode-dn.php                       30-Sep-2022 11:06                3516
function.ldap-first-attribute.php                  30-Sep-2022 11:06                6165
function.ldap-first-entry.php                      30-Sep-2022 11:06                5902
function.ldap-first-reference.php                  30-Sep-2022 11:06                2376
function.ldap-free-result.php                      30-Sep-2022 11:06                4036
function.ldap-get-attributes.php                   30-Sep-2022 11:06                8665
function.ldap-get-dn.php                           30-Sep-2022 11:06                4203
function.ldap-get-entries.php                      30-Sep-2022 11:06                6293
function.ldap-get-option.php                       30-Sep-2022 11:06               12842
function.ldap-get-values-len.php                   30-Sep-2022 11:06                5461
function.ldap-get-values.php                       30-Sep-2022 11:06                9100
function.ldap-list.php                             30-Sep-2022 11:06               15184
function.ldap-mod-add.php                          30-Sep-2022 11:06                6725
function.ldap-mod-del.php                          30-Sep-2022 11:06                6184
function.ldap-mod-replace.php                      30-Sep-2022 11:06                6634
function.ldap-mod_add-ext.php                      30-Sep-2022 11:06                5538
function.ldap-mod_del-ext.php                      30-Sep-2022 11:06                5546
function.ldap-mod_replace-ext.php                  30-Sep-2022 11:06                5615
function.ldap-modify-batch.php                     30-Sep-2022 11:06               20773
function.ldap-modify.php                           30-Sep-2022 11:06                2099
function.ldap-next-attribute.php                   30-Sep-2022 11:06                5569
function.ldap-next-entry.php                       30-Sep-2022 11:06                5925
function.ldap-next-reference.php                   30-Sep-2022 11:06                2350
function.ldap-parse-exop.php                       30-Sep-2022 11:06                5613
function.ldap-parse-reference.php                  30-Sep-2022 11:06                2361
function.ldap-parse-result.php                     30-Sep-2022 11:06                9455
function.ldap-read.php                             30-Sep-2022 11:06               12306
function.ldap-rename-ext.php                       30-Sep-2022 11:06                5767
function.ldap-rename.php                           30-Sep-2022 11:06                6952
function.ldap-sasl-bind.php                        30-Sep-2022 11:06                5928
function.ldap-search.php                           30-Sep-2022 11:06               15525
function.ldap-set-option.php                       30-Sep-2022 11:06               16101
function.ldap-set-rebind-proc.php                  30-Sep-2022 11:06                3191
function.ldap-sort.php                             30-Sep-2022 11:06                7345
function.ldap-start-tls.php                        30-Sep-2022 11:06                1982
function.ldap-t61-to-8859.php                      30-Sep-2022 11:06                2040
function.ldap-unbind.php                           30-Sep-2022 11:06                3744
function.levenshtein.php                           30-Sep-2022 11:06               13460
function.libxml-clear-errors.php                   30-Sep-2022 11:06                2852
function.libxml-disable-entity-loader.php          30-Sep-2022 11:06                4646
function.libxml-get-errors.php                     30-Sep-2022 11:06               11992
function.libxml-get-last-error.php                 30-Sep-2022 11:06                3124
function.libxml-set-external-entity-loader.php     30-Sep-2022 11:06               10012
function.libxml-set-streams-context.php            30-Sep-2022 11:06                5168
function.libxml-use-internal-errors.php            30-Sep-2022 11:06                6545
function.link.php                                  30-Sep-2022 11:06                6119
function.linkinfo.php                              30-Sep-2022 11:06                4536
function.list.php                                  30-Sep-2022 11:06               17967
function.localeconv.php                            30-Sep-2022 11:06                9579
function.localtime.php                             30-Sep-2022 11:06                8986
function.log.php                                   30-Sep-2022 11:06                3683
function.log10.php                                 30-Sep-2022 11:06                2657
function.log1p.php                                 30-Sep-2022 11:06                3453
function.long2ip.php                               30-Sep-2022 11:06                4193
function.lstat.php                                 30-Sep-2022 11:06                6494
function.ltrim.php                                 30-Sep-2022 11:06                9742
function.lzf-compress.php                          30-Sep-2022 11:06                2799
function.lzf-decompress.php                        30-Sep-2022 11:06                2887
function.lzf-optimized-for.php                     30-Sep-2022 11:06                2173
function.mail.php                                  30-Sep-2022 11:06               28260
function.mailparse-determine-best-xfer-encoding..> 30-Sep-2022 11:06                4194
function.mailparse-msg-create.php                  30-Sep-2022 11:06                3344
function.mailparse-msg-extract-part-file.php       30-Sep-2022 11:06                5040
function.mailparse-msg-extract-part.php            30-Sep-2022 11:06                4024
function.mailparse-msg-extract-whole-part-file.php 30-Sep-2022 11:06                4004
function.mailparse-msg-free.php                    30-Sep-2022 11:06                3456
function.mailparse-msg-get-part-data.php           30-Sep-2022 11:06                2469
function.mailparse-msg-get-part.php                30-Sep-2022 11:06                2690
function.mailparse-msg-get-structure.php           30-Sep-2022 11:06                2489
function.mailparse-msg-parse-file.php              30-Sep-2022 11:06                4107
function.mailparse-msg-parse.php                   30-Sep-2022 11:06                3290
function.mailparse-rfc822-parse-addresses.php      30-Sep-2022 11:06                5485
function.mailparse-stream-encode.php               30-Sep-2022 11:06                5695
function.mailparse-uudecode-all.php                30-Sep-2022 11:06                6917
function.max.php                                   30-Sep-2022 11:06               13156
function.mb-check-encoding.php                     30-Sep-2022 11:06                4802
function.mb-chr.php                                30-Sep-2022 11:06                6902
function.mb-convert-case.php                       30-Sep-2022 11:06               11287
function.mb-convert-encoding.php                   30-Sep-2022 11:06               10723
function.mb-convert-kana.php                       30-Sep-2022 11:06                9164
function.mb-convert-variables.php                  30-Sep-2022 11:06                6382
function.mb-decode-mimeheader.php                  30-Sep-2022 11:06                3001
function.mb-decode-numericentity.php               30-Sep-2022 11:06               36192
function.mb-detect-encoding.php                    30-Sep-2022 11:06               15470
function.mb-detect-order.php                       30-Sep-2022 11:06                8667
function.mb-encode-mimeheader.php                  30-Sep-2022 11:06                9439
function.mb-encode-numericentity.php               30-Sep-2022 11:06               13168
function.mb-encoding-aliases.php                   30-Sep-2022 11:06                5674
function.mb-ereg-match.php                         30-Sep-2022 11:06                5190
function.mb-ereg-replace-callback.php              30-Sep-2022 11:06               12920
function.mb-ereg-replace.php                       30-Sep-2022 11:06                6684
function.mb-ereg-search-getpos.php                 30-Sep-2022 11:06                3861
function.mb-ereg-search-getregs.php                30-Sep-2022 11:06                4204
function.mb-ereg-search-init.php                   30-Sep-2022 11:06                5718
function.mb-ereg-search-pos.php                    30-Sep-2022 11:06                5587
function.mb-ereg-search-regs.php                   30-Sep-2022 11:06                5339
function.mb-ereg-search-setpos.php                 30-Sep-2022 11:06                4394
function.mb-ereg-search.php                        30-Sep-2022 11:06                5252
function.mb-ereg.php                               30-Sep-2022 11:06                6087
function.mb-eregi-replace.php                      30-Sep-2022 11:06                6568
function.mb-eregi.php                              30-Sep-2022 11:06                6131
function.mb-get-info.php                           30-Sep-2022 11:06                5895
function.mb-http-input.php                         30-Sep-2022 11:06                4679
function.mb-http-output.php                        30-Sep-2022 11:06                4723
function.mb-internal-encoding.php                  30-Sep-2022 11:06                6766
function.mb-language.php                           30-Sep-2022 11:06                6134
function.mb-list-encodings.php                     30-Sep-2022 11:06                5032
function.mb-ord.php                                30-Sep-2022 11:06                6555
function.mb-output-handler.php                     30-Sep-2022 11:06                5050
function.mb-parse-str.php                          30-Sep-2022 11:06                4337
function.mb-preferred-mime-name.php                30-Sep-2022 11:06                4277
function.mb-regex-encoding.php                     30-Sep-2022 11:06                4277
function.mb-regex-set-options.php                  30-Sep-2022 11:06                6929
function.mb-scrub.php                              30-Sep-2022 11:06                3219
function.mb-send-mail.php                          30-Sep-2022 11:06                9236
function.mb-split.php                              30-Sep-2022 11:06                4399
function.mb-str-split.php                          30-Sep-2022 11:06                5024
function.mb-strcut.php                             30-Sep-2022 11:06                7150
function.mb-strimwidth.php                         30-Sep-2022 11:06                7094
function.mb-stripos.php                            30-Sep-2022 11:06                6152
function.mb-stristr.php                            30-Sep-2022 11:06                6279
function.mb-strlen.php                             30-Sep-2022 11:06                4751
function.mb-strpos.php                             30-Sep-2022 11:06                5943
function.mb-strrchr.php                            30-Sep-2022 11:06                6081
function.mb-strrichr.php                           30-Sep-2022 11:06                6115
function.mb-strripos.php                           30-Sep-2022 11:06                6099
function.mb-strrpos.php                            30-Sep-2022 11:06                6238
function.mb-strstr.php                             30-Sep-2022 11:06                6084
function.mb-strtolower.php                         30-Sep-2022 11:06                7139
function.mb-strtoupper.php                         30-Sep-2022 11:06                7165
function.mb-strwidth.php                           30-Sep-2022 11:06                8916
function.mb-substitute-character.php               30-Sep-2022 11:06                6762
function.mb-substr-count.php                       30-Sep-2022 11:06                5713
function.mb-substr.php                             30-Sep-2022 11:06                6142
function.mcrypt-create-iv.php                      30-Sep-2022 11:06                6593
function.mcrypt-decrypt.php                        30-Sep-2022 11:06                5582
function.mcrypt-enc-get-algorithms-name.php        30-Sep-2022 11:06                5348
function.mcrypt-enc-get-block-size.php             30-Sep-2022 11:06                2959
function.mcrypt-enc-get-iv-size.php                30-Sep-2022 11:06                3084
function.mcrypt-enc-get-key-size.php               30-Sep-2022 11:06                2963
function.mcrypt-enc-get-modes-name.php             30-Sep-2022 11:06                5260
function.mcrypt-enc-get-supported-key-sizes.php    30-Sep-2022 11:06                5029
function.mcrypt-enc-is-block-algorithm-mode.php    30-Sep-2022 11:06                3326
function.mcrypt-enc-is-block-algorithm.php         30-Sep-2022 11:06                3150
function.mcrypt-enc-is-block-mode.php              30-Sep-2022 11:06                3154
function.mcrypt-enc-self-test.php                  30-Sep-2022 11:06                3019
function.mcrypt-encrypt.php                        30-Sep-2022 11:06               15907
function.mcrypt-generic-deinit.php                 30-Sep-2022 11:06                3929
function.mcrypt-generic-init.php                   30-Sep-2022 11:06                5037
function.mcrypt-generic.php                        30-Sep-2022 11:06                5811
function.mcrypt-get-block-size.php                 30-Sep-2022 11:06                6467
function.mcrypt-get-cipher-name.php                30-Sep-2022 11:06                4843
function.mcrypt-get-iv-size.php                    30-Sep-2022 11:06                6493
function.mcrypt-get-key-size.php                   30-Sep-2022 11:06                6630
function.mcrypt-list-algorithms.php                30-Sep-2022 11:06                4745
function.mcrypt-list-modes.php                     30-Sep-2022 11:06                4757
function.mcrypt-module-close.php                   30-Sep-2022 11:06                3350
function.mcrypt-module-get-algo-block-size.php     30-Sep-2022 11:06                3423
function.mcrypt-module-get-algo-key-size.php       30-Sep-2022 11:06                3490
function.mcrypt-module-get-supported-key-sizes.php 30-Sep-2022 11:06                4575
function.mcrypt-module-is-block-algorithm-mode.php 30-Sep-2022 11:06                4003
function.mcrypt-module-is-block-algorithm.php      30-Sep-2022 11:06                3750
function.mcrypt-module-is-block-mode.php           30-Sep-2022 11:06                4049
function.mcrypt-module-open.php                    30-Sep-2022 11:06               14933
function.mcrypt-module-self-test.php               30-Sep-2022 11:06                4891
function.md5-file.php                              30-Sep-2022 11:06                5065
function.md5.php                                   30-Sep-2022 11:06                6027
function.mdecrypt-generic.php                      30-Sep-2022 11:06               11913
function.memcache-debug.php                        30-Sep-2022 11:06                3208
function.memory-get-peak-usage.php                 30-Sep-2022 11:06                3479
function.memory-get-usage.php                      30-Sep-2022 11:06                5503
function.memory-reset-peak-usage.php               30-Sep-2022 11:06                5003
function.metaphone.php                             30-Sep-2022 11:06                8301
function.method-exists.php                         30-Sep-2022 11:06                6488
function.mhash-count.php                           30-Sep-2022 11:06                4859
function.mhash-get-block-size.php                  30-Sep-2022 11:06                4501
function.mhash-get-hash-name.php                   30-Sep-2022 11:06                4445
function.mhash-keygen-s2k.php                      30-Sep-2022 11:06                5377
function.mhash.php                                 30-Sep-2022 11:06                4726
function.microtime.php                             30-Sep-2022 11:06                8234
function.mime-content-type.php                     30-Sep-2022 11:06                4854
function.min.php                                   30-Sep-2022 11:06               13760
function.mkdir.php                                 30-Sep-2022 11:06                8843
function.mktime.php                                30-Sep-2022 11:06               19075
function.money-format.php                          30-Sep-2022 11:06               19642
function.mongodb.bson-fromjson.php                 30-Sep-2022 11:06                5871
function.mongodb.bson-fromphp.php                  30-Sep-2022 11:06                5853
function.mongodb.bson-tocanonicalextendedjson.php  30-Sep-2022 11:06               16253
function.mongodb.bson-tojson.php                   30-Sep-2022 11:06               17742
function.mongodb.bson-tophp.php                    30-Sep-2022 11:06                8759
function.mongodb.bson-torelaxedextendedjson.php    30-Sep-2022 11:06               15952
function.mongodb.driver.monitoring.addsubscribe..> 30-Sep-2022 11:06                5136
function.mongodb.driver.monitoring.removesubscr..> 30-Sep-2022 11:06                4992
function.move-uploaded-file.php                    30-Sep-2022 11:06                8802
function.mqseries-back.php                         30-Sep-2022 11:06                6482
function.mqseries-begin.php                        30-Sep-2022 11:06                7955
function.mqseries-close.php                        30-Sep-2022 11:06                6556
function.mqseries-cmit.php                         30-Sep-2022 11:06                6428
function.mqseries-conn.php                         30-Sep-2022 11:06                5944
function.mqseries-connx.php                        30-Sep-2022 11:06               14378
function.mqseries-disc.php                         30-Sep-2022 11:06                5672
function.mqseries-get.php                          30-Sep-2022 11:06               13158
function.mqseries-inq.php                          30-Sep-2022 11:06                9197
function.mqseries-open.php                         30-Sep-2022 11:06                7668
function.mqseries-put.php                          30-Sep-2022 11:06               14135
function.mqseries-put1.php                         30-Sep-2022 11:06                5927
function.mqseries-set.php                          30-Sep-2022 11:06                5664
function.mqseries-strerror.php                     30-Sep-2022 11:06                4332
function.msg-get-queue.php                         30-Sep-2022 11:06                5774
function.msg-queue-exists.php                      30-Sep-2022 11:06                3361
function.msg-receive.php                           30-Sep-2022 11:06               11141
function.msg-remove-queue.php                      30-Sep-2022 11:06                4619
function.msg-send.php                              30-Sep-2022 11:06                8388
function.msg-set-queue.php                         30-Sep-2022 11:06                5263
function.msg-stat-queue.php                        30-Sep-2022 11:06                6975
function.mt-getrandmax.php                         30-Sep-2022 11:06                5576
function.mt-rand.php                               30-Sep-2022 11:06               10382
function.mt-srand.php                              30-Sep-2022 11:06                8102
function.mysql-affected-rows.php                   30-Sep-2022 11:06               12882
function.mysql-client-encoding.php                 30-Sep-2022 11:06                6303
function.mysql-close.php                           30-Sep-2022 11:06                7420
function.mysql-connect.php                         30-Sep-2022 11:06               17607
function.mysql-create-db.php                       30-Sep-2022 11:06                8660
function.mysql-data-seek.php                       30-Sep-2022 11:06               12526
function.mysql-db-name.php                         30-Sep-2022 11:06                7860
function.mysql-db-query.php                        30-Sep-2022 11:06               10396
function.mysql-drop-db.php                         30-Sep-2022 11:06                7962
function.mysql-errno.php                           30-Sep-2022 11:06                8497
function.mysql-error.php                           30-Sep-2022 11:06                8426
function.mysql-escape-string.php                   30-Sep-2022 11:06                7060
function.mysql-fetch-array.php                     30-Sep-2022 11:06               15926
function.mysql-fetch-assoc.php                     30-Sep-2022 11:06               12520
function.mysql-fetch-field.php                     30-Sep-2022 11:06               13932
function.mysql-fetch-lengths.php                   30-Sep-2022 11:06                7744
function.mysql-fetch-object.php                    30-Sep-2022 11:06               11940
function.mysql-fetch-row.php                       30-Sep-2022 11:06                7819
function.mysql-field-flags.php                     30-Sep-2022 11:06                8670
function.mysql-field-len.php                       30-Sep-2022 11:06                7086
function.mysql-field-name.php                      30-Sep-2022 11:06                9354
function.mysql-field-seek.php                      30-Sep-2022 11:06                4917
function.mysql-field-table.php                     30-Sep-2022 11:06                7850
function.mysql-field-type.php                      30-Sep-2022 11:06               12093
function.mysql-free-result.php                     30-Sep-2022 11:06                7980
function.mysql-get-client-info.php                 30-Sep-2022 11:06                5079
function.mysql-get-host-info.php                   30-Sep-2022 11:06                6912
function.mysql-get-proto-info.php                  30-Sep-2022 11:06                6668
function.mysql-get-server-info.php                 30-Sep-2022 11:06                7019
function.mysql-info.php                            30-Sep-2022 11:06                6303
function.mysql-insert-id.php                       30-Sep-2022 11:06                8603
function.mysql-list-dbs.php                        30-Sep-2022 11:06                8988
function.mysql-list-fields.php                     30-Sep-2022 11:06                9022
function.mysql-list-processes.php                  30-Sep-2022 11:06                7638
function.mysql-list-tables.php                     30-Sep-2022 11:06                9880
function.mysql-num-fields.php                      30-Sep-2022 11:06                6709
function.mysql-num-rows.php                        30-Sep-2022 11:06                8295
function.mysql-pconnect.php                        30-Sep-2022 11:06                8125
function.mysql-ping.php                            30-Sep-2022 11:06                8552
function.mysql-query.php                           30-Sep-2022 11:06               15028
function.mysql-real-escape-string.php              30-Sep-2022 11:06               17179
function.mysql-result.php                          30-Sep-2022 11:06               10022
function.mysql-select-db.php                       30-Sep-2022 11:06                7810
function.mysql-set-charset.php                     30-Sep-2022 11:06                5825
function.mysql-stat.php                            30-Sep-2022 11:06                9347
function.mysql-tablename.php                       30-Sep-2022 11:06                8034
function.mysql-thread-id.php                       30-Sep-2022 11:06                6680
function.mysql-unbuffered-query.php                30-Sep-2022 11:06                7206
function.mysql-xdevapi-expression.php              30-Sep-2022 11:06                4815
function.mysql-xdevapi-getsession.php              30-Sep-2022 11:06               13220
function.mysqli-connect.php                        30-Sep-2022 11:06                2325
function.mysqli-escape-string.php                  30-Sep-2022 11:06                1917
function.mysqli-execute.php                        30-Sep-2022 11:06                2492
function.mysqli-get-client-stats.php               30-Sep-2022 11:06                8277
function.mysqli-get-links-stats.php                30-Sep-2022 11:06                3155
function.mysqli-report.php                         30-Sep-2022 11:06                1719
function.mysqli-set-opt.php                        30-Sep-2022 11:06                1806
function.natcasesort.php                           30-Sep-2022 11:06                7382
function.natsort.php                               30-Sep-2022 11:06               10661
function.net-get-interfaces.php                    30-Sep-2022 11:06                4533
function.next.php                                  30-Sep-2022 11:06                9280
function.ngettext.php                              30-Sep-2022 11:06                5734
function.nl-langinfo.php                           30-Sep-2022 11:06               16006
function.nl2br.php                                 30-Sep-2022 11:06                6931
function.number-format.php                         30-Sep-2022 11:06                8609
function.oauth-get-sbs.php                         30-Sep-2022 11:06                2910
function.oauth-urlencode.php                       30-Sep-2022 11:06                2495
function.ob-clean.php                              30-Sep-2022 11:06                3592
function.ob-end-clean.php                          30-Sep-2022 11:06                5421
function.ob-end-flush.php                          30-Sep-2022 11:06                6340
function.ob-flush.php                              30-Sep-2022 11:06                3782
function.ob-get-clean.php                          30-Sep-2022 11:06                5342
function.ob-get-contents.php                       30-Sep-2022 11:06                4774
function.ob-get-flush.php                          30-Sep-2022 11:06                5730
function.ob-get-length.php                         30-Sep-2022 11:06                4672
function.ob-get-level.php                          30-Sep-2022 11:06                3007
function.ob-get-status.php                         30-Sep-2022 11:06                6761
function.ob-gzhandler.php                          30-Sep-2022 11:06                5748
function.ob-iconv-handler.php                      30-Sep-2022 11:06                5157
function.ob-implicit-flush.php                     30-Sep-2022 11:06                4252
function.ob-list-handlers.php                      30-Sep-2022 11:06                5896
function.ob-start.php                              30-Sep-2022 11:06               17102
function.ob-tidyhandler.php                        30-Sep-2022 11:06                4239
function.oci-bind-array-by-name.php                30-Sep-2022 11:06               13947
function.oci-bind-by-name.php                      30-Sep-2022 11:06               84227
function.oci-cancel.php                            30-Sep-2022 11:06                2514
function.oci-client-version.php                    30-Sep-2022 11:06                4016
function.oci-close.php                             30-Sep-2022 11:06               21000
function.oci-commit.php                            30-Sep-2022 11:06               11464
function.oci-connect.php                           30-Sep-2022 11:06               38773
function.oci-define-by-name.php                    30-Sep-2022 11:06               25637
function.oci-error.php                             30-Sep-2022 11:06               12096
function.oci-execute.php                           30-Sep-2022 11:06               21998
function.oci-fetch-all.php                         30-Sep-2022 11:06               27841
function.oci-fetch-array.php                       30-Sep-2022 11:06               73141
function.oci-fetch-assoc.php                       30-Sep-2022 11:06                9067
function.oci-fetch-object.php                      30-Sep-2022 11:06               20300
function.oci-fetch-row.php                         30-Sep-2022 11:06                9016
function.oci-fetch.php                             30-Sep-2022 11:06               14440
function.oci-field-is-null.php                     30-Sep-2022 11:06                8508
function.oci-field-name.php                        30-Sep-2022 11:06               11032
function.oci-field-precision.php                   30-Sep-2022 11:06                9682
function.oci-field-scale.php                       30-Sep-2022 11:06                9644
function.oci-field-size.php                        30-Sep-2022 11:06               11746
function.oci-field-type-raw.php                    30-Sep-2022 11:06                8799
function.oci-field-type.php                        30-Sep-2022 11:06               12044
function.oci-free-descriptor.php                   30-Sep-2022 11:06                3401
function.oci-free-statement.php                    30-Sep-2022 11:06                2815
function.oci-get-implicit-resultset.php            30-Sep-2022 11:06               32410
function.oci-internal-debug.php                    30-Sep-2022 11:06                3607
function.oci-lob-copy.php                          30-Sep-2022 11:06                4318
function.oci-lob-is-equal.php                      30-Sep-2022 11:06                3127
function.oci-new-collection.php                    30-Sep-2022 11:06                5221
function.oci-new-connect.php                       30-Sep-2022 11:06               16912
function.oci-new-cursor.php                        30-Sep-2022 11:06                8572
function.oci-new-descriptor.php                    30-Sep-2022 11:06               21322
function.oci-num-fields.php                        30-Sep-2022 11:06                7742
function.oci-num-rows.php                          30-Sep-2022 11:06                8510
function.oci-parse.php                             30-Sep-2022 11:06               13222
function.oci-password-change.php                   30-Sep-2022 11:06               14289
function.oci-pconnect.php                          30-Sep-2022 11:06               14886
function.oci-register-taf-callback.php             30-Sep-2022 11:06                5325
function.oci-result.php                            30-Sep-2022 11:06                9476
function.oci-rollback.php                          30-Sep-2022 11:06               15048
function.oci-server-version.php                    30-Sep-2022 11:06                5239
function.oci-set-action.php                        30-Sep-2022 11:06                8449
function.oci-set-call-timout.php                   30-Sep-2022 11:06                5759
function.oci-set-client-identifier.php             30-Sep-2022 11:06                8173
function.oci-set-client-info.php                   30-Sep-2022 11:06                8386
function.oci-set-db-operation.php                  30-Sep-2022 11:06                7762
function.oci-set-edition.php                       30-Sep-2022 11:06                9812
function.oci-set-module-name.php                   30-Sep-2022 11:06                8505
function.oci-set-prefetch-lob.php                  30-Sep-2022 11:06                8917
function.oci-set-prefetch.php                      30-Sep-2022 11:06               22897
function.oci-statement-type.php                    30-Sep-2022 11:06                7082
function.oci-unregister-taf-callback.php           30-Sep-2022 11:06                3440
function.ocibindbyname.php                         30-Sep-2022 11:06                1997
function.ocicancel.php                             30-Sep-2022 11:06                1939
function.ocicloselob.php                           30-Sep-2022 11:06                1939
function.ocicollappend.php                         30-Sep-2022 11:06                2003
function.ocicollassign.php                         30-Sep-2022 11:06                2008
function.ocicollassignelem.php                     30-Sep-2022 11:06                2053
function.ocicollgetelem.php                        30-Sep-2022 11:06                2020
function.ocicollmax.php                            30-Sep-2022 11:06                1972
function.ocicollsize.php                           30-Sep-2022 11:06                1975
function.ocicolltrim.php                           30-Sep-2022 11:06                1985
function.ocicolumnisnull.php                       30-Sep-2022 11:06                2009
function.ocicolumnname.php                         30-Sep-2022 11:06                2001
function.ocicolumnprecision.php                    30-Sep-2022 11:06                2044
function.ocicolumnscale.php                        30-Sep-2022 11:06                2008
function.ocicolumnsize.php                         30-Sep-2022 11:06                1989
function.ocicolumntype.php                         30-Sep-2022 11:06                1993
function.ocicolumntyperaw.php                      30-Sep-2022 11:06                2016
function.ocicommit.php                             30-Sep-2022 11:06                1953
function.ocidefinebyname.php                       30-Sep-2022 11:06                1999
function.ocierror.php                              30-Sep-2022 11:06                1930
function.ociexecute.php                            30-Sep-2022 11:06                1934
function.ocifetch.php                              30-Sep-2022 11:06                1924
function.ocifetchinto.php                          30-Sep-2022 11:06                2691
function.ocifetchstatement.php                     30-Sep-2022 11:06                2017
function.ocifreecollection.php                     30-Sep-2022 11:06                2035
function.ocifreecursor.php                         30-Sep-2022 11:06                2007
function.ocifreedesc.php                           30-Sep-2022 11:06                1951
function.ocifreestatement.php                      30-Sep-2022 11:06                2026
function.ociinternaldebug.php                      30-Sep-2022 11:06                2040
function.ociloadlob.php                            30-Sep-2022 11:06                1936
function.ocilogoff.php                             30-Sep-2022 11:06                1923
function.ocilogon.php                              30-Sep-2022 11:06                1938
function.ocinewcollection.php                      30-Sep-2022 11:06                2024
function.ocinewcursor.php                          30-Sep-2022 11:06                1992
function.ocinewdescriptor.php                      30-Sep-2022 11:06                2014
function.ocinlogon.php                             30-Sep-2022 11:06                1963
function.ocinumcols.php                            30-Sep-2022 11:06                1948
function.ociparse.php                              30-Sep-2022 11:06                1918
function.ociplogon.php                             30-Sep-2022 11:06                1933
function.ociresult.php                             30-Sep-2022 11:06                1931
function.ocirollback.php                           30-Sep-2022 11:06                1953
function.ocirowcount.php                           30-Sep-2022 11:06                1955
function.ocisavelob.php                            30-Sep-2022 11:06                1936
function.ocisavelobfile.php                        30-Sep-2022 11:06                1974
function.ociserverversion.php                      30-Sep-2022 11:06                2028
function.ocisetprefetch.php                        30-Sep-2022 11:06                2014
function.ocistatementtype.php                      30-Sep-2022 11:06                2034
function.ociwritelobtofile.php                     30-Sep-2022 11:06                2015
function.ociwritetemporarylob.php                  30-Sep-2022 11:06                2038
function.octdec.php                                30-Sep-2022 11:06                5869
function.odbc-autocommit.php                       30-Sep-2022 11:06                4276
function.odbc-binmode.php                          30-Sep-2022 11:06                6619
function.odbc-close-all.php                        30-Sep-2022 11:06                2608
function.odbc-close.php                            30-Sep-2022 11:06                2852
function.odbc-columnprivileges.php                 30-Sep-2022 11:06                8649
function.odbc-columns.php                          30-Sep-2022 11:06               11223
function.odbc-commit.php                           30-Sep-2022 11:06                2540
function.odbc-connect.php                          30-Sep-2022 11:06                8933
function.odbc-cursor.php                           30-Sep-2022 11:06                2561
function.odbc-data-source.php                      30-Sep-2022 11:06                5685
function.odbc-do.php                               30-Sep-2022 11:06                1655
function.odbc-error.php                            30-Sep-2022 11:06                3952
function.odbc-errormsg.php                         30-Sep-2022 11:06                4005
function.odbc-exec.php                             30-Sep-2022 11:06                3909
function.odbc-execute.php                          30-Sep-2022 11:06                7167
function.odbc-fetch-array.php                      30-Sep-2022 11:06                4112
function.odbc-fetch-into.php                       30-Sep-2022 11:06                4928
function.odbc-fetch-object.php                     30-Sep-2022 11:06                4154
function.odbc-fetch-row.php                        30-Sep-2022 11:06                4669
function.odbc-field-len.php                        30-Sep-2022 11:06                3287
function.odbc-field-name.php                       30-Sep-2022 11:06                2860
function.odbc-field-num.php                        30-Sep-2022 11:06                2852
function.odbc-field-precision.php                  30-Sep-2022 11:06                2198
function.odbc-field-scale.php                      30-Sep-2022 11:06                2835
function.odbc-field-type.php                       30-Sep-2022 11:06                2858
function.odbc-foreignkeys.php                      30-Sep-2022 11:06                8613
function.odbc-free-result.php                      30-Sep-2022 11:06                3356
function.odbc-gettypeinfo.php                      30-Sep-2022 11:06                4333
function.odbc-longreadlen.php                      30-Sep-2022 11:06                3820
function.odbc-next-result.php                      30-Sep-2022 11:06                9043
function.odbc-num-fields.php                       30-Sep-2022 11:06                2549
function.odbc-num-rows.php                         30-Sep-2022 11:06                3282
function.odbc-pconnect.php                         30-Sep-2022 11:06                4541
function.odbc-prepare.php                          30-Sep-2022 11:06                6501
function.odbc-primarykeys.php                      30-Sep-2022 11:06                7758
function.odbc-procedurecolumns.php                 30-Sep-2022 11:06               11418
function.odbc-procedures.php                       30-Sep-2022 11:06                9322
function.odbc-result-all.php                       30-Sep-2022 11:06                4097
function.odbc-result.php                           30-Sep-2022 11:06                5327
function.odbc-rollback.php                         30-Sep-2022 11:06                2551
function.odbc-setoption.php                        30-Sep-2022 11:06                7360
function.odbc-specialcolumns.php                   30-Sep-2022 11:06                7061
function.odbc-statistics.php                       30-Sep-2022 11:06                9543
function.odbc-tableprivileges.php                  30-Sep-2022 11:06                8139
function.odbc-tables.php                           30-Sep-2022 11:06               12158
function.opcache-compile-file.php                  30-Sep-2022 11:06                3609
function.opcache-get-configuration.php             30-Sep-2022 11:06                3227
function.opcache-get-status.php                    30-Sep-2022 11:06                3696
function.opcache-invalidate.php                    30-Sep-2022 11:06                3981
function.opcache-is-script-cached.php              30-Sep-2022 11:06                3223
function.opcache-reset.php                         30-Sep-2022 11:06                2937
function.openal-buffer-create.php                  30-Sep-2022 11:06                2776
function.openal-buffer-data.php                    30-Sep-2022 11:06                4405
function.openal-buffer-destroy.php                 30-Sep-2022 11:06                2993
function.openal-buffer-get.php                     30-Sep-2022 11:06                3545
function.openal-buffer-loadwav.php                 30-Sep-2022 11:06                3510
function.openal-context-create.php                 30-Sep-2022 11:06                3232
function.openal-context-current.php                30-Sep-2022 11:06                3048
function.openal-context-destroy.php                30-Sep-2022 11:06                3034
function.openal-context-process.php                30-Sep-2022 11:06                3452
function.openal-context-suspend.php                30-Sep-2022 11:06                3446
function.openal-device-close.php                   30-Sep-2022 11:06                3000
function.openal-device-open.php                    30-Sep-2022 11:06                3229
function.openal-listener-get.php                   30-Sep-2022 11:06                3160
function.openal-listener-set.php                   30-Sep-2022 11:06                3459
function.openal-source-create.php                  30-Sep-2022 11:06                2983
function.openal-source-destroy.php                 30-Sep-2022 11:06                3001
function.openal-source-get.php                     30-Sep-2022 11:06                4654
function.openal-source-pause.php                   30-Sep-2022 11:06                3332
function.openal-source-play.php                    30-Sep-2022 11:06                3331
function.openal-source-rewind.php                  30-Sep-2022 11:06                3341
function.openal-source-set.php                     30-Sep-2022 11:06                5184
function.openal-source-stop.php                    30-Sep-2022 11:06                3313
function.openal-stream.php                         30-Sep-2022 11:06                3912
function.opendir.php                               30-Sep-2022 11:06                8200
function.openlog.php                               30-Sep-2022 11:06                8894
function.openssl-cipher-iv-length.php              30-Sep-2022 11:06                4300
function.openssl-cipher-key-length.php             30-Sep-2022 11:06                4191
function.openssl-cms-decrypt.php                   30-Sep-2022 11:06                4584
function.openssl-cms-encrypt.php                   30-Sep-2022 11:06                5579
function.openssl-cms-read.php                      30-Sep-2022 11:06                2992
function.openssl-cms-sign.php                      30-Sep-2022 11:06                7256
function.openssl-cms-verify.php                    30-Sep-2022 11:06                6114
function.openssl-csr-export-to-file.php            30-Sep-2022 11:06                8484
function.openssl-csr-export.php                    30-Sep-2022 11:06                8293
function.openssl-csr-get-public-key.php            30-Sep-2022 11:06                9042
function.openssl-csr-get-subject.php               30-Sep-2022 11:06                9801
function.openssl-csr-new.php                       30-Sep-2022 11:06               22732
function.openssl-csr-sign.php                      30-Sep-2022 11:06               13523
function.openssl-decrypt.php                       30-Sep-2022 11:06                7125
function.openssl-dh-compute-key.php                30-Sep-2022 11:06               16568
function.openssl-digest.php                        30-Sep-2022 11:06                4206
function.openssl-encrypt.php                       30-Sep-2022 11:06               18608
function.openssl-error-string.php                  30-Sep-2022 11:06                3875
function.openssl-free-key.php                      30-Sep-2022 11:06                3846
function.openssl-get-cert-locations.php            30-Sep-2022 11:06                3997
function.openssl-get-cipher-methods.php            30-Sep-2022 11:06               14321
function.openssl-get-curve-names.php               30-Sep-2022 11:06                7030
function.openssl-get-md-methods.php                30-Sep-2022 11:06                6873
function.openssl-get-privatekey.php                30-Sep-2022 11:06                1880
function.openssl-get-publickey.php                 30-Sep-2022 11:06                1851
function.openssl-open.php                          30-Sep-2022 11:06               10338
function.openssl-pbkdf2.php                        30-Sep-2022 11:06                7258
function.openssl-pkcs12-export-to-file.php         30-Sep-2022 11:06                6998
function.openssl-pkcs12-export.php                 30-Sep-2022 11:06                6964
function.openssl-pkcs12-read.php                   30-Sep-2022 11:06                5517
function.openssl-pkcs7-decrypt.php                 30-Sep-2022 11:06                7700
function.openssl-pkcs7-encrypt.php                 30-Sep-2022 11:06               10911
function.openssl-pkcs7-read.php                    30-Sep-2022 11:06                6941
function.openssl-pkcs7-sign.php                    30-Sep-2022 11:06               12256
function.openssl-pkcs7-verify.php                  30-Sep-2022 11:06                7767
function.openssl-pkey-derive.php                   30-Sep-2022 11:06                7886
function.openssl-pkey-export-to-file.php           30-Sep-2022 11:06                6173
function.openssl-pkey-export.php                   30-Sep-2022 11:06                6058
function.openssl-pkey-free.php                     30-Sep-2022 11:06                4122
function.openssl-pkey-get-details.php              30-Sep-2022 11:06                9403
function.openssl-pkey-get-private.php              30-Sep-2022 11:06                5958
function.openssl-pkey-get-public.php               30-Sep-2022 11:06                5566
function.openssl-pkey-new.php                      30-Sep-2022 11:06                7122
function.openssl-private-decrypt.php               30-Sep-2022 11:06                6365
function.openssl-private-encrypt.php               30-Sep-2022 11:06                6256
function.openssl-public-decrypt.php                30-Sep-2022 11:06                6262
function.openssl-public-encrypt.php                30-Sep-2022 11:06                6515
function.openssl-random-pseudo-bytes.php           30-Sep-2022 11:06                9262
function.openssl-seal.php                          30-Sep-2022 11:06               11789
function.openssl-sign.php                          30-Sep-2022 11:06               12798
function.openssl-spki-export-challenge.php         30-Sep-2022 11:06                7628
function.openssl-spki-export.php                   30-Sep-2022 11:06                8256
function.openssl-spki-new.php                      30-Sep-2022 11:06                9027
function.openssl-spki-verify.php                   30-Sep-2022 11:06                7920
function.openssl-verify.php                        30-Sep-2022 11:06               13675
function.openssl-x509-check-private-key.php        30-Sep-2022 11:06                5682
function.openssl-x509-checkpurpose.php             30-Sep-2022 11:06                7497
function.openssl-x509-export-to-file.php           30-Sep-2022 11:06                4725
function.openssl-x509-export.php                   30-Sep-2022 11:06                4641
function.openssl-x509-fingerprint.php              30-Sep-2022 11:06                4927
function.openssl-x509-free.php                     30-Sep-2022 11:06                4092
function.openssl-x509-parse.php                    30-Sep-2022 11:06                4637
function.openssl-x509-read.php                     30-Sep-2022 11:06                4516
function.openssl-x509-verify.php                   30-Sep-2022 11:06               12903
function.ord.php                                   30-Sep-2022 11:06                7538
function.output-add-rewrite-var.php                30-Sep-2022 11:06                8326
function.output-reset-rewrite-vars.php             30-Sep-2022 11:06                6486
function.pack.php                                  30-Sep-2022 11:06               13633
function.parse-ini-file.php                        30-Sep-2022 11:06               20489
function.parse-ini-string.php                      30-Sep-2022 11:06                6667
function.parse-str.php                             30-Sep-2022 11:06               10446
function.parse-url.php                             30-Sep-2022 11:06               15986
function.passthru.php                              30-Sep-2022 11:06                5935
function.password-algos.php                        30-Sep-2022 11:06                3255
function.password-get-info.php                     30-Sep-2022 11:06                3455
function.password-hash.php                         30-Sep-2022 11:06               23057
function.password-needs-rehash.php                 30-Sep-2022 11:06                8173
function.password-verify.php                       30-Sep-2022 11:06                6304
function.pathinfo.php                              30-Sep-2022 11:06               11961
function.pclose.php                                30-Sep-2022 11:06                4888
function.pcntl-alarm.php                           30-Sep-2022 11:06                2919
function.pcntl-async-signals.php                   30-Sep-2022 11:06                3897
function.pcntl-errno.php                           30-Sep-2022 11:06                1743
function.pcntl-exec.php                            30-Sep-2022 11:06                3623
function.pcntl-fork.php                            30-Sep-2022 11:06                5320
function.pcntl-get-last-error.php                  30-Sep-2022 11:06                2730
function.pcntl-getpriority.php                     30-Sep-2022 11:06                5278
function.pcntl-rfork.php                           30-Sep-2022 11:06                7596
function.pcntl-setpriority.php                     30-Sep-2022 11:06                5153
function.pcntl-signal-dispatch.php                 30-Sep-2022 11:06                5690
function.pcntl-signal-get-handler.php              30-Sep-2022 11:06                6695
function.pcntl-signal.php                          30-Sep-2022 11:06               12075
function.pcntl-sigprocmask.php                     30-Sep-2022 11:06                5702
function.pcntl-sigtimedwait.php                    30-Sep-2022 11:06                4848
function.pcntl-sigwaitinfo.php                     30-Sep-2022 11:06                7269
function.pcntl-strerror.php                        30-Sep-2022 11:06                2876
function.pcntl-unshare.php                         30-Sep-2022 11:06                4245
function.pcntl-wait.php                            30-Sep-2022 11:06                8188
function.pcntl-waitpid.php                         30-Sep-2022 11:06                9533
function.pcntl-wexitstatus.php                     30-Sep-2022 11:06                3674
function.pcntl-wifexited.php                       30-Sep-2022 11:06                3400
function.pcntl-wifsignaled.php                     30-Sep-2022 11:06                3443
function.pcntl-wifstopped.php                      30-Sep-2022 11:06                3419
function.pcntl-wstopsig.php                        30-Sep-2022 11:06                3682
function.pcntl-wtermsig.php                        30-Sep-2022 11:06                3925
function.pfsockopen.php                            30-Sep-2022 11:06                5278
function.pg-affected-rows.php                      30-Sep-2022 11:06                7156
function.pg-cancel-query.php                       30-Sep-2022 11:06                7972
function.pg-client-encoding.php                    30-Sep-2022 11:06                6973
function.pg-close.php                              30-Sep-2022 11:06                6618
function.pg-connect-poll.php                       30-Sep-2022 11:06                3700
function.pg-connect.php                            30-Sep-2022 11:06               11937
function.pg-connection-busy.php                    30-Sep-2022 11:06                5994
function.pg-connection-reset.php                   30-Sep-2022 11:06                6037
function.pg-connection-status.php                  30-Sep-2022 11:06                5713
function.pg-consume-input.php                      30-Sep-2022 11:06                3466
function.pg-convert.php                            30-Sep-2022 11:06                8842
function.pg-copy-from.php                          30-Sep-2022 11:06                8131
function.pg-copy-to.php                            30-Sep-2022 11:06                7483
function.pg-dbname.php                             30-Sep-2022 11:06                5224
function.pg-delete.php                             30-Sep-2022 11:06                9520
function.pg-end-copy.php                           30-Sep-2022 11:06                7527
function.pg-escape-bytea.php                       30-Sep-2022 11:06                8207
function.pg-escape-identifier.php                  30-Sep-2022 11:06                7892
function.pg-escape-literal.php                     30-Sep-2022 11:06                8397
function.pg-escape-string.php                      30-Sep-2022 11:06                7874
function.pg-execute.php                            30-Sep-2022 11:06               10910
function.pg-fetch-all-columns.php                  30-Sep-2022 11:06                7268
function.pg-fetch-all.php                          30-Sep-2022 11:06                9164
function.pg-fetch-array.php                        30-Sep-2022 11:06               13070
function.pg-fetch-assoc.php                        30-Sep-2022 11:06                9444
function.pg-fetch-object.php                       30-Sep-2022 11:06               11228
function.pg-fetch-result.php                       30-Sep-2022 11:06                8927
function.pg-fetch-row.php                          30-Sep-2022 11:06                9635
function.pg-field-is-null.php                      30-Sep-2022 11:06                8761
function.pg-field-name.php                         30-Sep-2022 11:06                9631
function.pg-field-num.php                          30-Sep-2022 11:06                6874
function.pg-field-prtlen.php                       30-Sep-2022 11:06               11042
function.pg-field-size.php                         30-Sep-2022 11:06                9875
function.pg-field-table.php                        30-Sep-2022 11:06                8729
function.pg-field-type-oid.php                     30-Sep-2022 11:06                7760
function.pg-field-type.php                         30-Sep-2022 11:06                7473
function.pg-flush.php                              30-Sep-2022 11:06                3484
function.pg-free-result.php                        30-Sep-2022 11:06                7660
function.pg-get-notify.php                         30-Sep-2022 11:06                7449
function.pg-get-pid.php                            30-Sep-2022 11:06                5266
function.pg-get-result.php                         30-Sep-2022 11:06                9151
function.pg-host.php                               30-Sep-2022 11:06                6395
function.pg-insert.php                             30-Sep-2022 11:06                9959
function.pg-last-error.php                         30-Sep-2022 11:06                7568
function.pg-last-notice.php                        30-Sep-2022 11:06                8124
function.pg-last-oid.php                           30-Sep-2022 11:06                7834
function.pg-lo-close.php                           30-Sep-2022 11:06                7410
function.pg-lo-create.php                          30-Sep-2022 11:06                8922
function.pg-lo-export.php                          30-Sep-2022 11:06                8351
function.pg-lo-import.php                          30-Sep-2022 11:06                7617
function.pg-lo-open.php                            30-Sep-2022 11:06                9321
function.pg-lo-read-all.php                        30-Sep-2022 11:06                6648
function.pg-lo-read.php                            30-Sep-2022 11:06                7160
function.pg-lo-seek.php                            30-Sep-2022 11:06                8083
function.pg-lo-tell.php                            30-Sep-2022 11:06                7372
function.pg-lo-truncate.php                        30-Sep-2022 11:06                6723
function.pg-lo-unlink.php                          30-Sep-2022 11:06                7256
function.pg-lo-write.php                           30-Sep-2022 11:06                8376
function.pg-meta-data.php                          30-Sep-2022 11:06                7539
function.pg-num-fields.php                         30-Sep-2022 11:06                6176
function.pg-num-rows.php                           30-Sep-2022 11:06                6152
function.pg-options.php                            30-Sep-2022 11:06                5638
function.pg-parameter-status.php                   30-Sep-2022 11:06                8625
function.pg-pconnect.php                           30-Sep-2022 11:06               10489
function.pg-ping.php                               30-Sep-2022 11:06                6108
function.pg-port.php                               30-Sep-2022 11:06                5920
function.pg-prepare.php                            30-Sep-2022 11:06               10999
function.pg-put-line.php                           30-Sep-2022 11:06                8927
function.pg-query-params.php                       30-Sep-2022 11:06               11295
function.pg-query.php                              30-Sep-2022 11:06               13037
function.pg-result-error-field.php                 30-Sep-2022 11:06                9021
function.pg-result-error.php                       30-Sep-2022 11:06                8380
function.pg-result-seek.php                        30-Sep-2022 11:06                7603
function.pg-result-status.php                      30-Sep-2022 11:06                8162
function.pg-select.php                             30-Sep-2022 11:06               10267
function.pg-send-execute.php                       30-Sep-2022 11:06               11069
function.pg-send-prepare.php                       30-Sep-2022 11:06               11533
function.pg-send-query-params.php                  30-Sep-2022 11:06                8340
function.pg-send-query.php                         30-Sep-2022 11:06               10421
function.pg-set-client-encoding.php                30-Sep-2022 11:06                9294
function.pg-set-error-verbosity.php                30-Sep-2022 11:06                8762
function.pg-socket.php                             30-Sep-2022 11:06                3655
function.pg-trace.php                              30-Sep-2022 11:06                8504
function.pg-transaction-status.php                 30-Sep-2022 11:06                6724
function.pg-tty.php                                30-Sep-2022 11:06                6101
function.pg-unescape-bytea.php                     30-Sep-2022 11:06                6742
function.pg-untrace.php                            30-Sep-2022 11:06                6569
function.pg-update.php                             30-Sep-2022 11:06               10473
function.pg-version.php                            30-Sep-2022 11:06                6688
function.php-ini-loaded-file.php                   30-Sep-2022 11:06                4667
function.php-ini-scanned-files.php                 30-Sep-2022 11:06                6722
function.php-sapi-name.php                         30-Sep-2022 11:06                6025
function.php-strip-whitespace.php                  30-Sep-2022 11:06                4693
function.php-uname.php                             30-Sep-2022 11:06                9418
function.phpcredits.php                            30-Sep-2022 11:06                7960
function.phpdbg-break-file.php                     30-Sep-2022 11:06                3655
function.phpdbg-break-function.php                 30-Sep-2022 11:06                3444
function.phpdbg-break-method.php                   30-Sep-2022 11:06                3722
function.phpdbg-break-next.php                     30-Sep-2022 11:06                3143
function.phpdbg-clear.php                          30-Sep-2022 11:06                3424
function.phpdbg-color.php                          30-Sep-2022 11:06                3545
function.phpdbg-end-oplog.php                      30-Sep-2022 11:06                2456
function.phpdbg-exec.php                           30-Sep-2022 11:06                2779
function.phpdbg-get-executable.php                 30-Sep-2022 11:06                2455
function.phpdbg-prompt.php                         30-Sep-2022 11:06                2742
function.phpdbg-start-oplog.php                    30-Sep-2022 11:06                2258
function.phpinfo.php                               30-Sep-2022 11:06                9635
function.phpversion.php                            30-Sep-2022 11:06               11301
function.pi.php                                    30-Sep-2022 11:06                3043
function.png2wbmp.php                              30-Sep-2022 11:06                6387
function.popen.php                                 30-Sep-2022 11:06                8726
function.pos.php                                   30-Sep-2022 11:06                1588
function.posix-access.php                          30-Sep-2022 11:06                6393
function.posix-ctermid.php                         30-Sep-2022 11:06                4468
function.posix-errno.php                           30-Sep-2022 11:06                1759
function.posix-get-last-error.php                  30-Sep-2022 11:06                4366
function.posix-getcwd.php                          30-Sep-2022 11:06                4343
function.posix-getegid.php                         30-Sep-2022 11:06                5399
function.posix-geteuid.php                         30-Sep-2022 11:06                5376
function.posix-getgid.php                          30-Sep-2022 11:06                4776
function.posix-getgrgid.php                        30-Sep-2022 11:06                6612
function.posix-getgrnam.php                        30-Sep-2022 11:06                6427
function.posix-getgroups.php                       30-Sep-2022 11:06                4120
function.posix-getlogin.php                        30-Sep-2022 11:06                3596
function.posix-getpgid.php                         30-Sep-2022 11:06                4644
function.posix-getpgrp.php                         30-Sep-2022 11:06                2512
function.posix-getpid.php                          30-Sep-2022 11:06                3261
function.posix-getppid.php                         30-Sep-2022 11:06                2908
function.posix-getpwnam.php                        30-Sep-2022 11:06                6929
function.posix-getpwuid.php                        30-Sep-2022 11:06                6899
function.posix-getrlimit.php                       30-Sep-2022 11:06                7381
function.posix-getsid.php                          30-Sep-2022 11:06                4574
function.posix-getuid.php                          30-Sep-2022 11:06                3343
function.posix-initgroups.php                      30-Sep-2022 11:06                3116
function.posix-isatty.php                          30-Sep-2022 11:06                3689
function.posix-kill.php                            30-Sep-2022 11:06                3194
function.posix-mkfifo.php                          30-Sep-2022 11:06                3462
function.posix-mknod.php                           30-Sep-2022 11:06                7239
function.posix-setegid.php                         30-Sep-2022 11:06                5180
function.posix-seteuid.php                         30-Sep-2022 11:06                3442
function.posix-setgid.php                          30-Sep-2022 11:06                5416
function.posix-setpgid.php                         30-Sep-2022 11:06                3203
function.posix-setrlimit.php                       30-Sep-2022 11:06                4248
function.posix-setsid.php                          30-Sep-2022 11:06                2505
function.posix-setuid.php                          30-Sep-2022 11:06                5489
function.posix-strerror.php                        30-Sep-2022 11:06                4836
function.posix-times.php                           30-Sep-2022 11:06                4773
function.posix-ttyname.php                         30-Sep-2022 11:06                3275
function.posix-uname.php                           30-Sep-2022 11:06                4897
function.pow.php                                   30-Sep-2022 11:06                6859
function.preg-filter.php                           30-Sep-2022 11:06                9603
function.preg-grep.php                             30-Sep-2022 11:06                5988
function.preg-last-error-msg.php                   30-Sep-2022 11:06                4061
function.preg-last-error.php                       30-Sep-2022 11:06                4798
function.preg-match-all.php                        30-Sep-2022 11:06               26821
function.preg-match.php                            30-Sep-2022 11:06               24805
function.preg-quote.php                            30-Sep-2022 11:06                9070
function.preg-replace-callback-array.php           30-Sep-2022 11:06               10340
function.preg-replace-callback.php                 30-Sep-2022 11:06               18156
function.preg-replace.php                          30-Sep-2022 11:06               25155
function.preg-split.php                            30-Sep-2022 11:06               13150
function.prev.php                                  30-Sep-2022 11:06                8862
function.print-r.php                               30-Sep-2022 11:06                9164
function.print.php                                 30-Sep-2022 11:06               14566
function.printf.php                                30-Sep-2022 11:06               25491
function.proc-close.php                            30-Sep-2022 11:06                3635
function.proc-get-status.php                       30-Sep-2022 11:06                5998
function.proc-nice.php                             30-Sep-2022 11:06                7705
function.proc-open.php                             30-Sep-2022 11:06               23642
function.proc-terminate.php                        30-Sep-2022 11:06                4837
function.property-exists.php                       30-Sep-2022 11:06                8583
function.ps-add-bookmark.php                       30-Sep-2022 11:06                4896
function.ps-add-launchlink.php                     30-Sep-2022 11:06                5411
function.ps-add-locallink.php                      30-Sep-2022 11:06                6141
function.ps-add-note.php                           30-Sep-2022 11:06                6770
function.ps-add-pdflink.php                        30-Sep-2022 11:06                6458
function.ps-add-weblink.php                        30-Sep-2022 11:06                5497
function.ps-arc.php                                30-Sep-2022 11:06                4846
function.ps-arcn.php                               30-Sep-2022 11:06                4852
function.ps-begin-page.php                         30-Sep-2022 11:06                6702
function.ps-begin-pattern.php                      30-Sep-2022 11:06               13295
function.ps-begin-template.php                     30-Sep-2022 11:06               11370
function.ps-circle.php                             30-Sep-2022 11:06                4488
function.ps-clip.php                               30-Sep-2022 11:06                2914
function.ps-close-image.php                        30-Sep-2022 11:06                3774
function.ps-close.php                              30-Sep-2022 11:06                3567
function.ps-closepath-stroke.php                   30-Sep-2022 11:06                2987
function.ps-closepath.php                          30-Sep-2022 11:06                3163
function.ps-continue-text.php                      30-Sep-2022 11:06                3934
function.ps-curveto.php                            30-Sep-2022 11:06                4667
function.ps-delete.php                             30-Sep-2022 11:06                3431
function.ps-end-page.php                           30-Sep-2022 11:06                3157
function.ps-end-pattern.php                        30-Sep-2022 11:06                3088
function.ps-end-template.php                       30-Sep-2022 11:06                3095
function.ps-fill-stroke.php                        30-Sep-2022 11:06                3208
function.ps-fill.php                               30-Sep-2022 11:06                3141
function.ps-findfont.php                           30-Sep-2022 11:06                6837
function.ps-get-buffer.php                         30-Sep-2022 11:06                3150
function.ps-get-parameter.php                      30-Sep-2022 11:06                7579
function.ps-get-value.php                          30-Sep-2022 11:06                9318
function.ps-hyphenate.php                          30-Sep-2022 11:06                7182
function.ps-include-file.php                       30-Sep-2022 11:06                2944
function.ps-lineto.php                             30-Sep-2022 11:06                8185
function.ps-makespotcolor.php                      30-Sep-2022 11:06               10273
function.ps-moveto.php                             30-Sep-2022 11:06                3617
function.ps-new.php                                30-Sep-2022 11:06                2928
function.ps-open-file.php                          30-Sep-2022 11:06                3510
function.ps-open-image-file.php                    30-Sep-2022 11:06                4675
function.ps-open-image.php                         30-Sep-2022 11:06                6490
function.ps-open-memory-image.php                  30-Sep-2022 11:06                2713
function.ps-place-image.php                        30-Sep-2022 11:06                4925
function.ps-rect.php                               30-Sep-2022 11:06                4660
function.ps-restore.php                            30-Sep-2022 11:06                3270
function.ps-rotate.php                             30-Sep-2022 11:06               12355
function.ps-save.php                               30-Sep-2022 11:06                3017
function.ps-scale.php                              30-Sep-2022 11:06                3541
function.ps-set-border-color.php                   30-Sep-2022 11:06                4605
function.ps-set-border-dash.php                    30-Sep-2022 11:06                4247
function.ps-set-border-style.php                   30-Sep-2022 11:06                4309
function.ps-set-info.php                           30-Sep-2022 11:06                5782
function.ps-set-parameter.php                      30-Sep-2022 11:06                3717
function.ps-set-text-pos.php                       30-Sep-2022 11:06                9347
function.ps-set-value.php                          30-Sep-2022 11:06                4552
function.ps-setcolor.php                           30-Sep-2022 11:06                5492
function.ps-setdash.php                            30-Sep-2022 11:06                3413
function.ps-setflat.php                            30-Sep-2022 11:06                2933
function.ps-setfont.php                            30-Sep-2022 11:06                3846
function.ps-setgray.php                            30-Sep-2022 11:06                3140
function.ps-setlinecap.php                         30-Sep-2022 11:06                3696
function.ps-setlinejoin.php                        30-Sep-2022 11:06                3714
function.ps-setlinewidth.php                       30-Sep-2022 11:06                3578
function.ps-setmiterlimit.php                      30-Sep-2022 11:06                3998
function.ps-setoverprintmode.php                   30-Sep-2022 11:06                2970
function.ps-setpolydash.php                        30-Sep-2022 11:06                7750
function.ps-shading-pattern.php                    30-Sep-2022 11:06                4055
function.ps-shading.php                            30-Sep-2022 11:06                6532
function.ps-shfill.php                             30-Sep-2022 11:06                3804
function.ps-show-boxed.php                         30-Sep-2022 11:06               12092
function.ps-show-xy.php                            30-Sep-2022 11:06                3973
function.ps-show-xy2.php                           30-Sep-2022 11:06                2753
function.ps-show.php                               30-Sep-2022 11:06                5626
function.ps-show2.php                              30-Sep-2022 11:06                3064
function.ps-string-geometry.php                    30-Sep-2022 11:06                4665
function.ps-stringwidth.php                        30-Sep-2022 11:06                4127
function.ps-stroke.php                             30-Sep-2022 11:06                3353
function.ps-symbol-name.php                        30-Sep-2022 11:06                3724
function.ps-symbol-width.php                       30-Sep-2022 11:06                4216
function.ps-symbol.php                             30-Sep-2022 11:06                3550
function.ps-translate.php                          30-Sep-2022 11:06               14390
function.pspell-add-to-personal.php                30-Sep-2022 11:06                6359
function.pspell-add-to-session.php                 30-Sep-2022 11:06                3934
function.pspell-check.php                          30-Sep-2022 11:06                4998
function.pspell-clear-session.php                  30-Sep-2022 11:06                5815
function.pspell-config-create.php                  30-Sep-2022 11:06                8081
function.pspell-config-data-dir.php                30-Sep-2022 11:06                3218
function.pspell-config-dict-dir.php                30-Sep-2022 11:06                3194
function.pspell-config-ignore.php                  30-Sep-2022 11:06                5691
function.pspell-config-mode.php                    30-Sep-2022 11:06                6313
function.pspell-config-personal.php                30-Sep-2022 11:06                6529
function.pspell-config-repl.php                    30-Sep-2022 11:06                6847
function.pspell-config-runtogether.php             30-Sep-2022 11:06                6303
function.pspell-config-save-repl.php               30-Sep-2022 11:06                5119
function.pspell-new-config.php                     30-Sep-2022 11:06                6442
function.pspell-new-personal.php                   30-Sep-2022 11:06               10776
function.pspell-new.php                            30-Sep-2022 11:06                9187
function.pspell-save-wordlist.php                  30-Sep-2022 11:06                5990
function.pspell-store-replacement.php              30-Sep-2022 11:06                7636
function.pspell-suggest.php                        30-Sep-2022 11:06                5667
function.putenv.php                                30-Sep-2022 11:06                3903
function.quoted-printable-decode.php               30-Sep-2022 11:06                5141
function.quoted-printable-encode.php               30-Sep-2022 11:06                5094
function.quotemeta.php                             30-Sep-2022 11:06                5933
function.rad2deg.php                               30-Sep-2022 11:06                3509
function.radius-acct-open.php                      30-Sep-2022 11:06                3175
function.radius-add-server.php                     30-Sep-2022 11:06                7405
function.radius-auth-open.php                      30-Sep-2022 11:06                3183
function.radius-close.php                          30-Sep-2022 11:06                2453
function.radius-config.php                         30-Sep-2022 11:06                3827
function.radius-create-request.php                 30-Sep-2022 11:06                5012
function.radius-cvt-addr.php                       30-Sep-2022 11:06                6745
function.radius-cvt-int.php                        30-Sep-2022 11:06                5982
function.radius-cvt-string.php                     30-Sep-2022 11:06                6039
function.radius-demangle-mppe-key.php              30-Sep-2022 11:06                2994
function.radius-demangle.php                       30-Sep-2022 11:06                2725
function.radius-get-attr.php                       30-Sep-2022 11:06                6776
function.radius-get-tagged-attr-data.php           30-Sep-2022 11:06                6761
function.radius-get-tagged-attr-tag.php            30-Sep-2022 11:06                6816
function.radius-get-vendor-attr.php                30-Sep-2022 11:06                8837
function.radius-put-addr.php                       30-Sep-2022 11:06                4969
function.radius-put-attr.php                       30-Sep-2022 11:06                8397
function.radius-put-int.php                        30-Sep-2022 11:06                7066
function.radius-put-string.php                     30-Sep-2022 11:06                7454
function.radius-put-vendor-addr.php                30-Sep-2022 11:06                4980
function.radius-put-vendor-attr.php                30-Sep-2022 11:06                7237
function.radius-put-vendor-int.php                 30-Sep-2022 11:06                5657
function.radius-put-vendor-string.php              30-Sep-2022 11:06                6048
function.radius-request-authenticator.php          30-Sep-2022 11:06                2991
function.radius-salt-encrypt-attr.php              30-Sep-2022 11:06                3989
function.radius-send-request.php                   30-Sep-2022 11:06                3611
function.radius-server-secret.php                  30-Sep-2022 11:06                2509
function.radius-strerror.php                       30-Sep-2022 11:06                2460
function.rand.php                                  30-Sep-2022 11:06               10047
function.random-bytes.php                          30-Sep-2022 11:06                7785
function.random-int.php                            30-Sep-2022 11:06                7893
function.range.php                                 30-Sep-2022 11:06                8217
function.rar-wrapper-cache-stats.php               30-Sep-2022 11:06                2289
function.rawurldecode.php                          30-Sep-2022 11:06                4644
function.rawurlencode.php                          30-Sep-2022 11:06                6384
function.read-exif-data.php                        30-Sep-2022 11:06                2498
function.readdir.php                               30-Sep-2022 11:06               11192
function.readfile.php                              30-Sep-2022 11:06               10073
function.readgzfile.php                            30-Sep-2022 11:06                4294
function.readline-add-history.php                  30-Sep-2022 11:06                2591
function.readline-callback-handler-install.php     30-Sep-2022 11:06               10324
function.readline-callback-handler-remove.php      30-Sep-2022 11:06                3960
function.readline-callback-read-char.php           30-Sep-2022 11:06                3954
function.readline-clear-history.php                30-Sep-2022 11:06                2359
function.readline-completion-function.php          30-Sep-2022 11:06                3003
function.readline-info.php                         30-Sep-2022 11:06                4617
function.readline-list-history.php                 30-Sep-2022 11:06                2312
function.readline-on-new-line.php                  30-Sep-2022 11:06                2713
function.readline-read-history.php                 30-Sep-2022 11:06                3216
function.readline-redisplay.php                    30-Sep-2022 11:06                2244
function.readline-write-history.php                30-Sep-2022 11:06                3193
function.readline.php                              30-Sep-2022 11:06                5197
function.readlink.php                              30-Sep-2022 11:06                4452
function.realpath-cache-get.php                    30-Sep-2022 11:06                4134
function.realpath-cache-size.php                   30-Sep-2022 11:06                3621
function.realpath.php                              30-Sep-2022 11:06                8671
function.recode-file.php                           30-Sep-2022 11:06                5586
function.recode-string.php                         30-Sep-2022 11:06                5056
function.recode.php                                30-Sep-2022 11:06                1694
function.register-shutdown-function.php            30-Sep-2022 11:06                8523
function.register-tick-function.php                30-Sep-2022 11:06                5449
function.rename.php                                30-Sep-2022 11:06                5730
function.require-once.php                          30-Sep-2022 11:06                1851
function.require.php                               30-Sep-2022 11:06                1849
function.reset.php                                 30-Sep-2022 11:06                9327
function.restore-error-handler.php                 30-Sep-2022 11:06                5972
function.restore-exception-handler.php             30-Sep-2022 11:06                6790
function.restore-include-path.php                  30-Sep-2022 11:06                5389
function.return.php                                30-Sep-2022 11:06                4238
function.rewind.php                                30-Sep-2022 11:06                6261
function.rewinddir.php                             30-Sep-2022 11:06                3561
function.rmdir.php                                 30-Sep-2022 11:06                4915
function.round.php                                 30-Sep-2022 11:06               24215
function.rpmaddtag.php                             30-Sep-2022 11:06                3136
function.rpmdbinfo.php                             30-Sep-2022 11:06                4718
function.rpmdbsearch.php                           30-Sep-2022 11:06                5503
function.rpminfo.php                               30-Sep-2022 11:06                4902
function.rpmvercmp.php                             30-Sep-2022 11:06                2546
function.rrd-create.php                            30-Sep-2022 11:06                2658
function.rrd-error.php                             30-Sep-2022 11:06                2009
function.rrd-fetch.php                             30-Sep-2022 11:06                2738
function.rrd-first.php                             30-Sep-2022 11:06                2680
function.rrd-graph.php                             30-Sep-2022 11:06                2932
function.rrd-info.php                              30-Sep-2022 11:06                2319
function.rrd-last.php                              30-Sep-2022 11:06                2305
function.rrd-lastupdate.php                        30-Sep-2022 11:06                2449
function.rrd-restore.php                           30-Sep-2022 11:06                2987
function.rrd-tune.php                              30-Sep-2022 11:06                2725
function.rrd-update.php                            30-Sep-2022 11:06                2798
function.rrd-version.php                           30-Sep-2022 11:06                2103
function.rrd-xport.php                             30-Sep-2022 11:06                2495
function.rrdc-disconnect.php                       30-Sep-2022 11:06                2500
function.rsort.php                                 30-Sep-2022 11:06                8271
function.rtrim.php                                 30-Sep-2022 11:06                9772
function.runkit7-constant-add.php                  30-Sep-2022 11:06                4231
function.runkit7-constant-redefine.php             30-Sep-2022 11:06                4097
function.runkit7-constant-remove.php               30-Sep-2022 11:06                3446
function.runkit7-function-add.php                  30-Sep-2022 11:06                8877
function.runkit7-function-copy.php                 30-Sep-2022 11:06                5293
function.runkit7-function-redefine.php             30-Sep-2022 11:06                9269
function.runkit7-function-remove.php               30-Sep-2022 11:06                3939
function.runkit7-function-rename.php               30-Sep-2022 11:06                4160
function.runkit7-import.php                        30-Sep-2022 11:06                3553
function.runkit7-method-add.php                    30-Sep-2022 11:06               10740
function.runkit7-method-copy.php                   30-Sep-2022 11:06                7063
function.runkit7-method-redefine.php               30-Sep-2022 11:06               11206
function.runkit7-method-remove.php                 30-Sep-2022 11:06                6506
function.runkit7-method-rename.php                 30-Sep-2022 11:06                6557
function.runkit7-object-id.php                     30-Sep-2022 11:06                3621
function.runkit7-superglobals.php                  30-Sep-2022 11:06                2553
function.runkit7-zval-inspect.php                  30-Sep-2022 11:06                5064
function.sapi-windows-cp-conv.php                  30-Sep-2022 11:06                4288
function.sapi-windows-cp-get.php                   30-Sep-2022 11:06                3320
function.sapi-windows-cp-is-utf8.php               30-Sep-2022 11:06                2659
function.sapi-windows-cp-set.php                   30-Sep-2022 11:06                2848
function.sapi-windows-generate-ctrl-event.php      30-Sep-2022 11:06                7700
function.sapi-windows-set-ctrl-handler.php         30-Sep-2022 11:06                7428
function.sapi-windows-vt100-support.php            30-Sep-2022 11:06                9967
function.scandir.php                               30-Sep-2022 11:06                8645
function.scoutapm-get-calls.php                    30-Sep-2022 11:06                4366
function.scoutapm-list-instrumented-functions.php  30-Sep-2022 11:06                3702
function.seaslog-get-author.php                    30-Sep-2022 11:06                3021
function.seaslog-get-version.php                   30-Sep-2022 11:06                3018
function.sem-acquire.php                           30-Sep-2022 11:06                4957
function.sem-get.php                               30-Sep-2022 11:06                6893
function.sem-release.php                           30-Sep-2022 11:06                4203
function.sem-remove.php                            30-Sep-2022 11:06                4254
function.serialize.php                             30-Sep-2022 11:06               11416
function.session-abort.php                         30-Sep-2022 11:06                4051
function.session-cache-expire.php                  30-Sep-2022 11:06                7678
function.session-cache-limiter.php                 30-Sep-2022 11:06                9121
function.session-commit.php                        30-Sep-2022 11:06                1801
function.session-create-id.php                     30-Sep-2022 11:06               11495
function.session-decode.php                        30-Sep-2022 11:06                3700
function.session-destroy.php                       30-Sep-2022 11:06                9939
function.session-encode.php                        30-Sep-2022 11:06                3910
function.session-gc.php                            30-Sep-2022 11:06                8796
function.session-get-cookie-params.php             30-Sep-2022 11:06                5596
function.session-id.php                            30-Sep-2022 11:06                5971
function.session-module-name.php                   30-Sep-2022 11:06                4180
function.session-name.php                          30-Sep-2022 11:06                7687
function.session-regenerate-id.php                 30-Sep-2022 11:06               19443
function.session-register-shutdown.php             30-Sep-2022 11:06                2698
function.session-reset.php                         30-Sep-2022 11:06                4148
function.session-save-path.php                     30-Sep-2022 11:06                4589
function.session-set-cookie-params.php             30-Sep-2022 11:06                9737
function.session-set-save-handler.php              30-Sep-2022 11:06               23114
function.session-start.php                         30-Sep-2022 11:06               15379
function.session-status.php                        30-Sep-2022 11:06                3137
function.session-unset.php                         30-Sep-2022 11:06                4363
function.session-write-close.php                   30-Sep-2022 11:06                3953
function.set-error-handler.php                     30-Sep-2022 11:06               28810
function.set-exception-handler.php                 30-Sep-2022 11:06                6968
function.set-file-buffer.php                       30-Sep-2022 11:06                1748
function.set-include-path.php                      30-Sep-2022 11:06                6218
function.set-time-limit.php                        30-Sep-2022 11:06                4502
function.setcookie.php                             30-Sep-2022 11:06               26935
function.setlocale.php                             30-Sep-2022 11:06               15293
function.setrawcookie.php                          30-Sep-2022 11:06                5530
function.settype.php                               30-Sep-2022 11:06                6404
function.sha1-file.php                             30-Sep-2022 11:06                5649
function.sha1.php                                  30-Sep-2022 11:06                5883
function.shell-exec.php                            30-Sep-2022 11:06                5591
function.shm-attach.php                            30-Sep-2022 11:06                6053
function.shm-detach.php                            30-Sep-2022 11:06                4544
function.shm-get-var.php                           30-Sep-2022 11:06                4416
function.shm-has-var.php                           30-Sep-2022 11:06                4135
function.shm-put-var.php                           30-Sep-2022 11:06                5346
function.shm-remove-var.php                        30-Sep-2022 11:06                4114
function.shm-remove.php                            30-Sep-2022 11:06                3911
function.shmop-close.php                           30-Sep-2022 11:06                5015
function.shmop-delete.php                          30-Sep-2022 11:06                4137
function.shmop-open.php                            30-Sep-2022 11:06                8861
function.shmop-read.php                            30-Sep-2022 11:06                5397
function.shmop-size.php                            30-Sep-2022 11:06                4299
function.shmop-write.php                           30-Sep-2022 11:06                5719
function.show-source.php                           30-Sep-2022 11:06                1719
function.shuffle.php                               30-Sep-2022 11:06                5690
function.similar-text.php                          30-Sep-2022 11:06                7471
function.simplexml-import-dom.php                  30-Sep-2022 11:06                6556
function.simplexml-load-file.php                   30-Sep-2022 11:06               10061
function.simplexml-load-string.php                 30-Sep-2022 11:06                9721
function.sin.php                                   30-Sep-2022 11:06                4679
function.sinh.php                                  30-Sep-2022 11:06                3147
function.sizeof.php                                30-Sep-2022 11:06                1608
function.sleep.php                                 30-Sep-2022 11:06                7356
function.snmp-get-quick-print.php                  30-Sep-2022 11:06                3594
function.snmp-get-valueretrieval.php               30-Sep-2022 11:06                4387
function.snmp-read-mib.php                         30-Sep-2022 11:06                4695
function.snmp-set-enum-print.php                   30-Sep-2022 11:06                4594
function.snmp-set-oid-numeric-print.php            30-Sep-2022 11:06                2306
function.snmp-set-oid-output-format.php            30-Sep-2022 11:06                6668
function.snmp-set-quick-print.php                  30-Sep-2022 11:06                6632
function.snmp-set-valueretrieval.php               30-Sep-2022 11:06                9150
function.snmp2-get.php                             30-Sep-2022 11:06                5464
function.snmp2-getnext.php                         30-Sep-2022 11:06                5847
function.snmp2-real-walk.php                       30-Sep-2022 11:06                6118
function.snmp2-set.php                             30-Sep-2022 11:06               10556
function.snmp2-walk.php                            30-Sep-2022 11:06                6625
function.snmp3-get.php                             30-Sep-2022 11:06                8306
function.snmp3-getnext.php                         30-Sep-2022 11:06                8649
function.snmp3-real-walk.php                       30-Sep-2022 11:06                9161
function.snmp3-set.php                             30-Sep-2022 11:06               13113
function.snmp3-walk.php                            30-Sep-2022 11:06                9582
function.snmpget.php                               30-Sep-2022 11:06                5555
function.snmpgetnext.php                           30-Sep-2022 11:06                5724
function.snmprealwalk.php                          30-Sep-2022 11:06                5992
function.snmpset.php                               30-Sep-2022 11:06               10725
function.snmpwalk.php                              30-Sep-2022 11:06                6771
function.snmpwalkoid.php                           30-Sep-2022 11:06                7720
function.socket-accept.php                         30-Sep-2022 11:06                7085
function.socket-addrinfo-bind.php                  30-Sep-2022 11:06                5267
function.socket-addrinfo-connect.php               30-Sep-2022 11:06                5041
function.socket-addrinfo-explain.php               30-Sep-2022 11:06                4365
function.socket-addrinfo-lookup.php                30-Sep-2022 11:06                5545
function.socket-bind.php                           30-Sep-2022 11:06               11333
function.socket-clear-error.php                    30-Sep-2022 11:06                4728
function.socket-close.php                          30-Sep-2022 11:06                4654
function.socket-cmsg-space.php                     30-Sep-2022 11:06                3494
function.socket-connect.php                        30-Sep-2022 11:06                7390
function.socket-create-listen.php                  30-Sep-2022 11:06                7336
function.socket-create-pair.php                    30-Sep-2022 11:06               21098
function.socket-create.php                         30-Sep-2022 11:06               12889
function.socket-export-stream.php                  30-Sep-2022 11:06                3326
function.socket-get-option.php                     30-Sep-2022 11:06               28740
function.socket-get-status.php                     30-Sep-2022 11:06                1793
function.socket-getopt.php                         30-Sep-2022 11:06                1773
function.socket-getpeername.php                    30-Sep-2022 11:06                8002
function.socket-getsockname.php                    30-Sep-2022 11:06                7376
function.socket-import-stream.php                  30-Sep-2022 11:06                4998
function.socket-last-error.php                     30-Sep-2022 11:06                7399
function.socket-listen.php                         30-Sep-2022 11:06                7587
function.socket-read.php                           30-Sep-2022 11:06                8000
function.socket-recv.php                           30-Sep-2022 11:06               16903
function.socket-recvfrom.php                       30-Sep-2022 11:06               13407
function.socket-recvmsg.php                        30-Sep-2022 11:06                4193
function.socket-select.php                         30-Sep-2022 11:06               16462
function.socket-send.php                           30-Sep-2022 11:06                6509
function.socket-sendmsg.php                        30-Sep-2022 11:06                4286
function.socket-sendto.php                         30-Sep-2022 11:06                9757
function.socket-set-block.php                      30-Sep-2022 11:06                6038
function.socket-set-blocking.php                   30-Sep-2022 11:06                1811
function.socket-set-nonblock.php                   30-Sep-2022 11:06                6454
function.socket-set-option.php                     30-Sep-2022 11:06               11694
function.socket-set-timeout.php                    30-Sep-2022 11:06                1780
function.socket-setopt.php                         30-Sep-2022 11:06                1767
function.socket-shutdown.php                       30-Sep-2022 11:06                4849
function.socket-strerror.php                       30-Sep-2022 11:06                7442
function.socket-write.php                          30-Sep-2022 11:06                7389
function.socket-wsaprotocol-info-export.php        30-Sep-2022 11:06                4835
function.socket-wsaprotocol-info-import.php        30-Sep-2022 11:06                4255
function.socket-wsaprotocol-info-release.php       30-Sep-2022 11:06                3422
function.sodium-add.php                            30-Sep-2022 11:06                3025
function.sodium-base642bin.php                     30-Sep-2022 11:06                4207
function.sodium-bin2base64.php                     30-Sep-2022 11:06                3853
function.sodium-bin2hex.php                        30-Sep-2022 11:06                2544
function.sodium-compare.php                        30-Sep-2022 11:06                3017
function.sodium-crypto-aead-aes256gcm-decrypt.php  30-Sep-2022 11:06                4262
function.sodium-crypto-aead-aes256gcm-encrypt.php  30-Sep-2022 11:06                4032
function.sodium-crypto-aead-aes256gcm-is-availa..> 30-Sep-2022 11:06                2643
function.sodium-crypto-aead-aes256gcm-keygen.php   30-Sep-2022 11:06                2735
function.sodium-crypto-aead-chacha20poly1305-de..> 30-Sep-2022 11:06                4178
function.sodium-crypto-aead-chacha20poly1305-en..> 30-Sep-2022 11:06                3923
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:06                4408
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:06                4089
function.sodium-crypto-aead-chacha20poly1305-ie..> 30-Sep-2022 11:06                2929
function.sodium-crypto-aead-chacha20poly1305-ke..> 30-Sep-2022 11:06                2864
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:06                4586
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:06                4307
function.sodium-crypto-aead-xchacha20poly1305-i..> 30-Sep-2022 11:06                2905
function.sodium-crypto-auth-keygen.php             30-Sep-2022 11:06                2556
function.sodium-crypto-auth-verify.php             30-Sep-2022 11:06                3535
function.sodium-crypto-auth.php                    30-Sep-2022 11:06                3144
function.sodium-crypto-box-keypair-from-secretk..> 30-Sep-2022 11:06                3223
function.sodium-crypto-box-keypair.php             30-Sep-2022 11:06                2837
function.sodium-crypto-box-open.php                30-Sep-2022 11:06                3669
function.sodium-crypto-box-publickey-from-secre..> 30-Sep-2022 11:06                3110
function.sodium-crypto-box-publickey.php           30-Sep-2022 11:06                2823
function.sodium-crypto-box-seal-open.php           30-Sep-2022 11:06                5931
function.sodium-crypto-box-seal.php                30-Sep-2022 11:06                7094
function.sodium-crypto-box-secretkey.php           30-Sep-2022 11:06                2790
function.sodium-crypto-box-seed-keypair.php        30-Sep-2022 11:06                2849
function.sodium-crypto-box.php                     30-Sep-2022 11:06                3957
function.sodium-crypto-core-ristretto255-add.php   30-Sep-2022 11:06                5990
function.sodium-crypto-core-ristretto255-from-h..> 30-Sep-2022 11:06                5421
function.sodium-crypto-core-ristretto255-is-val..> 30-Sep-2022 11:06                5468
function.sodium-crypto-core-ristretto255-random..> 30-Sep-2022 11:06                5613
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:06                6258
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:06                3485
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:06                5371
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:06                3688
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:06                5355
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:06                5773
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:06                3429
function.sodium-crypto-core-ristretto255-scalar..> 30-Sep-2022 11:06                6249
function.sodium-crypto-core-ristretto255-sub.php   30-Sep-2022 11:06                6027
function.sodium-crypto-generichash-final.php       30-Sep-2022 11:06                6737
function.sodium-crypto-generichash-init.php        30-Sep-2022 11:06                6686
function.sodium-crypto-generichash-keygen.php      30-Sep-2022 11:06                2366
function.sodium-crypto-generichash-update.php      30-Sep-2022 11:06                6517
function.sodium-crypto-generichash.php             30-Sep-2022 11:06                3419
function.sodium-crypto-kdf-derive-from-key.php     30-Sep-2022 11:06                3652
function.sodium-crypto-kdf-keygen.php              30-Sep-2022 11:06                2468
function.sodium-crypto-kx-client-session-keys.php  30-Sep-2022 11:06                3178
function.sodium-crypto-kx-keypair.php              30-Sep-2022 11:06                4981
function.sodium-crypto-kx-publickey.php            30-Sep-2022 11:06                2642
function.sodium-crypto-kx-secretkey.php            30-Sep-2022 11:06                2653
function.sodium-crypto-kx-seed-keypair.php         30-Sep-2022 11:06                2605
function.sodium-crypto-kx-server-session-keys.php  30-Sep-2022 11:06                3244
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:06                3155
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:06                3305
function.sodium-crypto-pwhash-scryptsalsa208sha..> 30-Sep-2022 11:06                5560
function.sodium-crypto-pwhash-str-needs-rehash.php 30-Sep-2022 11:06                3662
function.sodium-crypto-pwhash-str-verify.php       30-Sep-2022 11:06                4569
function.sodium-crypto-pwhash-str.php              30-Sep-2022 11:06                7968
function.sodium-crypto-pwhash.php                  30-Sep-2022 11:06                9431
function.sodium-crypto-scalarmult-base.php         30-Sep-2022 11:06                2020
function.sodium-crypto-scalarmult-ristretto255-..> 30-Sep-2022 11:06                3398
function.sodium-crypto-scalarmult-ristretto255.php 30-Sep-2022 11:06                3691
function.sodium-crypto-scalarmult.php              30-Sep-2022 11:06                2865
function.sodium-crypto-secretbox-keygen.php        30-Sep-2022 11:06                6322
function.sodium-crypto-secretbox-open.php          30-Sep-2022 11:06                8617
function.sodium-crypto-secretbox.php               30-Sep-2022 11:06                8524
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:06               11651
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:06               10803
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:06                2632
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:06                5500
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:06                5599
function.sodium-crypto-secretstream-xchacha20po..> 30-Sep-2022 11:06                2875
function.sodium-crypto-shorthash-keygen.php        30-Sep-2022 11:06                2630
function.sodium-crypto-shorthash.php               30-Sep-2022 11:06                2977
function.sodium-crypto-sign-detached.php           30-Sep-2022 11:06                2970
function.sodium-crypto-sign-ed25519-pk-to-curve..> 30-Sep-2022 11:06                2810
function.sodium-crypto-sign-ed25519-sk-to-curve..> 30-Sep-2022 11:06                2866
function.sodium-crypto-sign-keypair-from-secret..> 30-Sep-2022 11:06                3049
function.sodium-crypto-sign-keypair.php            30-Sep-2022 11:06                2354
function.sodium-crypto-sign-open.php               30-Sep-2022 11:06                3091
function.sodium-crypto-sign-publickey-from-secr..> 30-Sep-2022 11:06                2668
function.sodium-crypto-sign-publickey.php          30-Sep-2022 11:06                2678
function.sodium-crypto-sign-secretkey.php          30-Sep-2022 11:06                2654
function.sodium-crypto-sign-seed-keypair.php       30-Sep-2022 11:06                2887
function.sodium-crypto-sign-verify-detached.php    30-Sep-2022 11:06                3312
function.sodium-crypto-sign.php                    30-Sep-2022 11:06                3048
function.sodium-crypto-stream-keygen.php           30-Sep-2022 11:06                2537
function.sodium-crypto-stream-xchacha20-keygen.php 30-Sep-2022 11:06                2695
function.sodium-crypto-stream-xchacha20-xor-ic.php 30-Sep-2022 11:06                9478
function.sodium-crypto-stream-xchacha20-xor.php    30-Sep-2022 11:06                4451
function.sodium-crypto-stream-xchacha20.php        30-Sep-2022 11:06                3450
function.sodium-crypto-stream-xor.php              30-Sep-2022 11:06                3234
function.sodium-crypto-stream.php                  30-Sep-2022 11:06                3169
function.sodium-hex2bin.php                        30-Sep-2022 11:06                3096
function.sodium-increment.php                      30-Sep-2022 11:06                2415
function.sodium-memcmp.php                         30-Sep-2022 11:06                3204
function.sodium-memzero.php                        30-Sep-2022 11:06                2410
function.sodium-pad.php                            30-Sep-2022 11:06                2547
function.sodium-unpad.php                          30-Sep-2022 11:06                2502
function.solr-get-version.php                      30-Sep-2022 11:06                3836
function.sort.php                                  30-Sep-2022 11:06               11648
function.soundex.php                               30-Sep-2022 11:06                7577
function.spl-autoload-call.php                     30-Sep-2022 11:06                2544
function.spl-autoload-extensions.php               30-Sep-2022 11:06                4828
function.spl-autoload-functions.php                30-Sep-2022 11:06                2474
function.spl-autoload-register.php                 30-Sep-2022 11:06               10648
function.spl-autoload-unregister.php               30-Sep-2022 11:06                2926
function.spl-autoload.php                          30-Sep-2022 11:06                4293
function.spl-classes.php                           30-Sep-2022 11:06                3658
function.spl-object-hash.php                       30-Sep-2022 11:06                4507
function.spl-object-id.php                         30-Sep-2022 11:06                4035
function.sprintf.php                               30-Sep-2022 11:06               26337
function.sqlsrv-begin-transaction.php              30-Sep-2022 11:06               12081
function.sqlsrv-cancel.php                         30-Sep-2022 11:06               10754
function.sqlsrv-client-info.php                    30-Sep-2022 11:06                6909
function.sqlsrv-close.php                          30-Sep-2022 11:06                5568
function.sqlsrv-commit.php                         30-Sep-2022 11:06               11913
function.sqlsrv-configure.php                      30-Sep-2022 11:06                4480
function.sqlsrv-connect.php                        30-Sep-2022 11:06               12737
function.sqlsrv-errors.php                         30-Sep-2022 11:06               10672
function.sqlsrv-execute.php                        30-Sep-2022 11:06               10872
function.sqlsrv-fetch-array.php                    30-Sep-2022 11:06               15239
function.sqlsrv-fetch-object.php                   30-Sep-2022 11:06               12464
function.sqlsrv-fetch.php                          30-Sep-2022 11:06               11187
function.sqlsrv-field-metadata.php                 30-Sep-2022 11:06                9001
function.sqlsrv-free-stmt.php                      30-Sep-2022 11:06                7779
function.sqlsrv-get-config.php                     30-Sep-2022 11:06                3261
function.sqlsrv-get-field.php                      30-Sep-2022 11:06               10705
function.sqlsrv-has-rows.php                       30-Sep-2022 11:06                6466
function.sqlsrv-next-result.php                    30-Sep-2022 11:06                9629
function.sqlsrv-num-fields.php                     30-Sep-2022 11:06                8586
function.sqlsrv-num-rows.php                       30-Sep-2022 11:06                8101
function.sqlsrv-prepare.php                        30-Sep-2022 11:06               14959
function.sqlsrv-query.php                          30-Sep-2022 11:06               11697
function.sqlsrv-rollback.php                       30-Sep-2022 11:06               11383
function.sqlsrv-rows-affected.php                  30-Sep-2022 11:06                8218
function.sqlsrv-send-stream-data.php               30-Sep-2022 11:06                8971
function.sqlsrv-server-info.php                    30-Sep-2022 11:06                6343
function.sqrt.php                                  30-Sep-2022 11:06                4398
function.srand.php                                 30-Sep-2022 11:06                6724
function.sscanf.php                                30-Sep-2022 11:06               12122
function.ssdeep-fuzzy-compare.php                  30-Sep-2022 11:06                3033
function.ssdeep-fuzzy-hash-filename.php            30-Sep-2022 11:06                2808
function.ssdeep-fuzzy-hash.php                     30-Sep-2022 11:06                2656
function.ssh2-auth-agent.php                       30-Sep-2022 11:06                4573
function.ssh2-auth-hostbased-file.php              30-Sep-2022 11:06                7754
function.ssh2-auth-none.php                        30-Sep-2022 11:06                4813
function.ssh2-auth-password.php                    30-Sep-2022 11:06                4780
function.ssh2-auth-pubkey-file.php                 30-Sep-2022 11:06                7177
function.ssh2-connect.php                          30-Sep-2022 11:06               15838
function.ssh2-disconnect.php                       30-Sep-2022 11:06                2890
function.ssh2-exec.php                             30-Sep-2022 11:06                7071
function.ssh2-fetch-stream.php                     30-Sep-2022 11:06                5391
function.ssh2-fingerprint.php                      30-Sep-2022 11:06                5303
function.ssh2-forward-accept.php                   30-Sep-2022 11:06                2881
function.ssh2-forward-listen.php                   30-Sep-2022 11:06                4175
function.ssh2-methods-negotiated.php               30-Sep-2022 11:06                8140
function.ssh2-poll.php                             30-Sep-2022 11:06                3385
function.ssh2-publickey-add.php                    30-Sep-2022 11:06                8136
function.ssh2-publickey-init.php                   30-Sep-2022 11:06                4541
function.ssh2-publickey-list.php                   30-Sep-2022 11:06                8977
function.ssh2-publickey-remove.php                 30-Sep-2022 11:06                4503
function.ssh2-scp-recv.php                         30-Sep-2022 11:06                5217
function.ssh2-scp-send.php                         30-Sep-2022 11:06                5779
function.ssh2-send-eof.php                         30-Sep-2022 11:06                3243
function.ssh2-sftp-chmod.php                       30-Sep-2022 11:06                5791
function.ssh2-sftp-lstat.php                       30-Sep-2022 11:06                7320
function.ssh2-sftp-mkdir.php                       30-Sep-2022 11:06                6475
function.ssh2-sftp-readlink.php                    30-Sep-2022 11:06                5276
function.ssh2-sftp-realpath.php                    30-Sep-2022 11:06                5526
function.ssh2-sftp-rename.php                      30-Sep-2022 11:06                5320
function.ssh2-sftp-rmdir.php                       30-Sep-2022 11:06                5393
function.ssh2-sftp-stat.php                        30-Sep-2022 11:06                7218
function.ssh2-sftp-symlink.php                     30-Sep-2022 11:06                5526
function.ssh2-sftp-unlink.php                      30-Sep-2022 11:06                4833
function.ssh2-sftp.php                             30-Sep-2022 11:06                5382
function.ssh2-shell.php                            30-Sep-2022 11:06                7526
function.ssh2-tunnel.php                           30-Sep-2022 11:06                5188
function.stat.php                                  30-Sep-2022 11:06               17406
function.stats-absolute-deviation.php              30-Sep-2022 11:06                2649
function.stats-cdf-beta.php                        30-Sep-2022 11:06                4902
function.stats-cdf-binomial.php                    30-Sep-2022 11:06                4887
function.stats-cdf-cauchy.php                      30-Sep-2022 11:06                4922
function.stats-cdf-chisquare.php                   30-Sep-2022 11:06                4295
function.stats-cdf-exponential.php                 30-Sep-2022 11:06                4326
function.stats-cdf-f.php                           30-Sep-2022 11:06                4827
function.stats-cdf-gamma.php                       30-Sep-2022 11:06                4886
function.stats-cdf-laplace.php                     30-Sep-2022 11:06                4907
function.stats-cdf-logistic.php                    30-Sep-2022 11:06                4942
function.stats-cdf-negative-binomial.php           30-Sep-2022 11:06                5030
function.stats-cdf-noncentral-chisquare.php        30-Sep-2022 11:06                5132
function.stats-cdf-noncentral-f.php                30-Sep-2022 11:06                5652
function.stats-cdf-noncentral-t.php                30-Sep-2022 11:06                4992
function.stats-cdf-normal.php                      30-Sep-2022 11:06                4924
function.stats-cdf-poisson.php                     30-Sep-2022 11:06                4260
function.stats-cdf-t.php                           30-Sep-2022 11:06                4188
function.stats-cdf-uniform.php                     30-Sep-2022 11:06                4887
function.stats-cdf-weibull.php                     30-Sep-2022 11:06                4924
function.stats-covariance.php                      30-Sep-2022 11:06                2791
function.stats-dens-beta.php                       30-Sep-2022 11:06                3223
function.stats-dens-cauchy.php                     30-Sep-2022 11:06                3281
function.stats-dens-chisquare.php                  30-Sep-2022 11:06                3005
function.stats-dens-exponential.php                30-Sep-2022 11:06                2995
function.stats-dens-f.php                          30-Sep-2022 11:06                3221
function.stats-dens-gamma.php                      30-Sep-2022 11:06                3274
function.stats-dens-laplace.php                    30-Sep-2022 11:06                3308
function.stats-dens-logistic.php                   30-Sep-2022 11:06                3320
function.stats-dens-normal.php                     30-Sep-2022 11:06                3291
function.stats-dens-pmf-binomial.php               30-Sep-2022 11:06                3345
function.stats-dens-pmf-hypergeometric.php         30-Sep-2022 11:06                3943
function.stats-dens-pmf-negative-binomial.php      30-Sep-2022 11:06                3474
function.stats-dens-pmf-poisson.php                30-Sep-2022 11:06                2996
function.stats-dens-t.php                          30-Sep-2022 11:06                2909
function.stats-dens-uniform.php                    30-Sep-2022 11:06                3256
function.stats-dens-weibull.php                    30-Sep-2022 11:06                3288
function.stats-harmonic-mean.php                   30-Sep-2022 11:06                2635
function.stats-kurtosis.php                        30-Sep-2022 11:06                2552
function.stats-rand-gen-beta.php                   30-Sep-2022 11:06                2856
function.stats-rand-gen-chisquare.php              30-Sep-2022 11:06                2583
function.stats-rand-gen-exponential.php            30-Sep-2022 11:06                2581
function.stats-rand-gen-f.php                      30-Sep-2022 11:06                2910
function.stats-rand-gen-funiform.php               30-Sep-2022 11:06                2837
function.stats-rand-gen-gamma.php                  30-Sep-2022 11:06                2923
function.stats-rand-gen-ibinomial-negative.php     30-Sep-2022 11:06                3003
function.stats-rand-gen-ibinomial.php              30-Sep-2022 11:06                2927
function.stats-rand-gen-int.php                    30-Sep-2022 11:06                2209
function.stats-rand-gen-ipoisson.php               30-Sep-2022 11:06                2556
function.stats-rand-gen-iuniform.php               30-Sep-2022 11:06                2904
function.stats-rand-gen-noncentral-chisquare.php   30-Sep-2022 11:06                3045
function.stats-rand-gen-noncentral-f.php           30-Sep-2022 11:06                3344
function.stats-rand-gen-noncentral-t.php           30-Sep-2022 11:06                2958
function.stats-rand-gen-normal.php                 30-Sep-2022 11:06                2871
function.stats-rand-gen-t.php                      30-Sep-2022 11:06                2475
function.stats-rand-get-seeds.php                  30-Sep-2022 11:06                2252
function.stats-rand-phrase-to-seeds.php            30-Sep-2022 11:06                2562
function.stats-rand-ranf.php                       30-Sep-2022 11:06                2253
function.stats-rand-setall.php                     30-Sep-2022 11:06                2812
function.stats-skew.php                            30-Sep-2022 11:06                2518
function.stats-standard-deviation.php              30-Sep-2022 11:06                3414
function.stats-stat-binomial-coef.php              30-Sep-2022 11:06                2816
function.stats-stat-correlation.php                30-Sep-2022 11:06                2971
function.stats-stat-factorial.php                  30-Sep-2022 11:06                2443
function.stats-stat-independent-t.php              30-Sep-2022 11:06                3103
function.stats-stat-innerproduct.php               30-Sep-2022 11:06                2913
function.stats-stat-paired-t.php                   30-Sep-2022 11:06                2850
function.stats-stat-percentile.php                 30-Sep-2022 11:06                2768
function.stats-stat-powersum.php                   30-Sep-2022 11:06                2760
function.stats-variance.php                        30-Sep-2022 11:06                2972
function.stomp-connect-error.php                   30-Sep-2022 11:06                3629
function.stomp-version.php                         30-Sep-2022 11:06                3052
function.str-contains.php                          30-Sep-2022 11:06                8634
function.str-ends-with.php                         30-Sep-2022 11:06                8509
function.str-getcsv.php                            30-Sep-2022 11:06                7761
function.str-ireplace.php                          30-Sep-2022 11:06                8641
function.str-pad.php                               30-Sep-2022 11:06                8025
function.str-repeat.php                            30-Sep-2022 11:06                4696
function.str-replace.php                           30-Sep-2022 11:06               17944
function.str-rot13.php                             30-Sep-2022 11:06                3640
function.str-shuffle.php                           30-Sep-2022 11:06                5591
function.str-split.php                             30-Sep-2022 11:06                8438
function.str-starts-with.php                       30-Sep-2022 11:06                8539
function.str-word-count.php                        30-Sep-2022 11:06                9286
function.strcasecmp.php                            30-Sep-2022 11:06                6227
function.strchr.php                                30-Sep-2022 11:06                1629
function.strcmp.php                                30-Sep-2022 11:06                5723
function.strcoll.php                               30-Sep-2022 11:06                5333
function.strcspn.php                               30-Sep-2022 11:06               11541
function.stream-bucket-append.php                  30-Sep-2022 11:06                2128
function.stream-bucket-make-writeable.php          30-Sep-2022 11:06                4078
function.stream-bucket-new.php                     30-Sep-2022 11:06                2123
function.stream-bucket-prepend.php                 30-Sep-2022 11:06                6626
function.stream-context-create.php                 30-Sep-2022 11:06                7551
function.stream-context-get-default.php            30-Sep-2022 11:06                9187
function.stream-context-get-options.php            30-Sep-2022 11:06                4479
function.stream-context-get-params.php             30-Sep-2022 11:06                5331
function.stream-context-set-default.php            30-Sep-2022 11:06                6471
function.stream-context-set-option.php             30-Sep-2022 11:06                5062
function.stream-context-set-params.php             30-Sep-2022 11:06                4423
function.stream-copy-to-stream.php                 30-Sep-2022 11:06                7390
function.stream-filter-append.php                  30-Sep-2022 11:06               10894
function.stream-filter-prepend.php                 30-Sep-2022 11:06                7657
function.stream-filter-register.php                30-Sep-2022 11:06               19861
function.stream-filter-remove.php                  30-Sep-2022 11:06                6603
function.stream-get-contents.php                   30-Sep-2022 11:06                8335
function.stream-get-filters.php                    30-Sep-2022 11:06                4013
function.stream-get-line.php                       30-Sep-2022 11:06                4807
function.stream-get-meta-data.php                  30-Sep-2022 11:06               14963
function.stream-get-transports.php                 30-Sep-2022 11:06                3999
function.stream-get-wrappers.php                   30-Sep-2022 11:06                4899
function.stream-is-local.php                       30-Sep-2022 11:06                3920
function.stream-isatty.php                         30-Sep-2022 11:06                3812
function.stream-notification-callback.php          30-Sep-2022 11:06               25294
function.stream-register-wrapper.php               30-Sep-2022 11:06                1895
function.stream-resolve-include-path.php           30-Sep-2022 11:06                4111
function.stream-select.php                         30-Sep-2022 11:06               15910
function.stream-set-blocking.php                   30-Sep-2022 11:06                4466
function.stream-set-chunk-size.php                 30-Sep-2022 11:06                3186
function.stream-set-read-buffer.php                30-Sep-2022 11:06                3565
function.stream-set-timeout.php                    30-Sep-2022 11:06                8168
function.stream-set-write-buffer.php               30-Sep-2022 11:06                5854
function.stream-socket-accept.php                  30-Sep-2022 11:06                7342
function.stream-socket-client.php                  30-Sep-2022 11:06               17325
function.stream-socket-enable-crypto.php           30-Sep-2022 11:06               11234
function.stream-socket-get-name.php                30-Sep-2022 11:06                3554
function.stream-socket-pair.php                    30-Sep-2022 11:06                9109
function.stream-socket-recvfrom.php                30-Sep-2022 11:06               10759
function.stream-socket-sendto.php                  30-Sep-2022 11:06                7328
function.stream-socket-server.php                  30-Sep-2022 11:06               15247
function.stream-socket-shutdown.php                30-Sep-2022 11:06                6247
function.stream-supports-lock.php                  30-Sep-2022 11:06                3041
function.stream-wrapper-register.php               30-Sep-2022 11:06                9162
function.stream-wrapper-restore.php                30-Sep-2022 11:06                2711
function.stream-wrapper-unregister.php             30-Sep-2022 11:06                2912
function.strftime.php                              30-Sep-2022 11:06               64691
function.strip-tags.php                            30-Sep-2022 11:06                9555
function.stripcslashes.php                         30-Sep-2022 11:06                4058
function.stripos.php                               30-Sep-2022 11:06               12245
function.stripslashes.php                          30-Sep-2022 11:06                7987
function.stristr.php                               30-Sep-2022 11:06               10304
function.strlen.php                                30-Sep-2022 11:06                5434
function.strnatcasecmp.php                         30-Sep-2022 11:06                7252
function.strnatcmp.php                             30-Sep-2022 11:06                8592
function.strncasecmp.php                           30-Sep-2022 11:06                6665
function.strncmp.php                               30-Sep-2022 11:06                6574
function.strpbrk.php                               30-Sep-2022 11:06                5468
function.strpos.php                                30-Sep-2022 11:06               15053
function.strptime.php                              30-Sep-2022 11:06               11755
function.strrchr.php                               30-Sep-2022 11:06                7451
function.strrev.php                                30-Sep-2022 11:06                3132
function.strripos.php                              30-Sep-2022 11:06               10714
function.strrpos.php                               30-Sep-2022 11:06               13812
function.strspn.php                                30-Sep-2022 11:06               10984
function.strstr.php                                30-Sep-2022 11:06                8727
function.strtok.php                                30-Sep-2022 11:06               13375
function.strtolower.php                            30-Sep-2022 11:06                5205
function.strtotime.php                             30-Sep-2022 11:06               13515
function.strtoupper.php                            30-Sep-2022 11:06                5190
function.strtr.php                                 30-Sep-2022 11:06               11751
function.strval.php                                30-Sep-2022 11:06                6542
function.substr-compare.php                        30-Sep-2022 11:06               10803
function.substr-count.php                          30-Sep-2022 11:06                9980
function.substr-replace.php                        30-Sep-2022 11:06               16861
function.substr.php                                30-Sep-2022 11:06               23869
function.svn-add.php                               30-Sep-2022 11:06                6040
function.svn-auth-get-parameter.php                30-Sep-2022 11:06                3867
function.svn-auth-set-parameter.php                30-Sep-2022 11:06                5375
function.svn-blame.php                             30-Sep-2022 11:06                4812
function.svn-cat.php                               30-Sep-2022 11:06                4708
function.svn-checkout.php                          30-Sep-2022 11:06                7267
function.svn-cleanup.php                           30-Sep-2022 11:06                5141
function.svn-client-version.php                    30-Sep-2022 11:06                3473
function.svn-commit.php                            30-Sep-2022 11:06                7865
function.svn-delete.php                            30-Sep-2022 11:06                4459
function.svn-diff.php                              30-Sep-2022 11:06               13456
function.svn-export.php                            30-Sep-2022 11:06                4953
function.svn-fs-abort-txn.php                      30-Sep-2022 11:06                3056
function.svn-fs-apply-text.php                     30-Sep-2022 11:06                2649
function.svn-fs-begin-txn2.php                     30-Sep-2022 11:06                2594
function.svn-fs-change-node-prop.php               30-Sep-2022 11:06                3005
function.svn-fs-check-path.php                     30-Sep-2022 11:06                2700
function.svn-fs-contents-changed.php               30-Sep-2022 11:06                3006
function.svn-fs-copy.php                           30-Sep-2022 11:06                3877
function.svn-fs-delete.php                         30-Sep-2022 11:06                3278
function.svn-fs-dir-entries.php                    30-Sep-2022 11:06                2713
function.svn-fs-file-contents.php                  30-Sep-2022 11:06                2730
function.svn-fs-file-length.php                    30-Sep-2022 11:06                2659
function.svn-fs-is-dir.php                         30-Sep-2022 11:06                3309
function.svn-fs-is-file.php                        30-Sep-2022 11:06                3297
function.svn-fs-make-dir.php                       30-Sep-2022 11:06                3302
function.svn-fs-make-file.php                      30-Sep-2022 11:06                3319
function.svn-fs-node-created-rev.php               30-Sep-2022 11:06                2702
function.svn-fs-node-prop.php                      30-Sep-2022 11:06                2738
function.svn-fs-props-changed.php                  30-Sep-2022 11:06                2993
function.svn-fs-revision-prop.php                  30-Sep-2022 11:06                2753
function.svn-fs-revision-root.php                  30-Sep-2022 11:06                2677
function.svn-fs-txn-root.php                       30-Sep-2022 11:06                2500
function.svn-fs-youngest-rev.php                   30-Sep-2022 11:06                2548
function.svn-import.php                            30-Sep-2022 11:06                5878
function.svn-log.php                               30-Sep-2022 11:06                8775
function.svn-ls.php                                30-Sep-2022 11:06                7044
function.svn-mkdir.php                             30-Sep-2022 11:06                3031
function.svn-repos-create.php                      30-Sep-2022 11:06                2808
function.svn-repos-fs-begin-txn-for-commit.php     30-Sep-2022 11:06                3062
function.svn-repos-fs-commit-txn.php               30-Sep-2022 11:06                2603
function.svn-repos-fs.php                          30-Sep-2022 11:06                2497
function.svn-repos-hotcopy.php                     30-Sep-2022 11:06                2756
function.svn-repos-open.php                        30-Sep-2022 11:06                2473
function.svn-repos-recover.php                     30-Sep-2022 11:06                2522
function.svn-revert.php                            30-Sep-2022 11:06                3321
function.svn-status.php                            30-Sep-2022 11:06               14665
function.svn-update.php                            30-Sep-2022 11:06                5996
function.swoole-async-dns-lookup.php               30-Sep-2022 11:06                3579
function.swoole-async-read.php                     30-Sep-2022 11:06                4165
function.swoole-async-readfile.php                 30-Sep-2022 11:06                3600
function.swoole-async-set.php                      30-Sep-2022 11:06                2334
function.swoole-async-write.php                    30-Sep-2022 11:06                3440
function.swoole-async-writefile.php                30-Sep-2022 11:06                3468
function.swoole-clear-error.php                    30-Sep-2022 11:06                2252
function.swoole-client-select.php                  30-Sep-2022 11:06                3212
function.swoole-cpu-num.php                        30-Sep-2022 11:06                2061
function.swoole-errno.php                          30-Sep-2022 11:06                2038
function.swoole-error-log.php                      30-Sep-2022 11:06                3001
function.swoole-event-add.php                      30-Sep-2022 11:06                3335
function.swoole-event-defer.php                    30-Sep-2022 11:06                2489
function.swoole-event-del.php                      30-Sep-2022 11:06                2397
function.swoole-event-exit.php                     30-Sep-2022 11:06                2137
function.swoole-event-set.php                      30-Sep-2022 11:06                3322
function.swoole-event-wait.php                     30-Sep-2022 11:06                2108
function.swoole-event-write.php                    30-Sep-2022 11:06                2613
function.swoole-get-local-ip.php                   30-Sep-2022 11:06                2132
function.swoole-last-error.php                     30-Sep-2022 11:06                2087
function.swoole-load-module.php                    30-Sep-2022 11:06                2284
function.swoole-select.php                         30-Sep-2022 11:06                3179
function.swoole-set-process-name.php               30-Sep-2022 11:06                2487
function.swoole-strerror.php                       30-Sep-2022 11:06                2408
function.swoole-timer-after.php                    30-Sep-2022 11:06                2941
function.swoole-timer-exists.php                   30-Sep-2022 11:06                2304
function.swoole-timer-tick.php                     30-Sep-2022 11:06                2814
function.swoole-version.php                        30-Sep-2022 11:06                2064
function.symlink.php                               30-Sep-2022 11:06                5382
function.sys-get-temp-dir.php                      30-Sep-2022 11:06                4196
function.sys-getloadavg.php                        30-Sep-2022 11:06                4248
function.syslog.php                                30-Sep-2022 11:06                9440
function.system.php                                30-Sep-2022 11:06                8004
function.taint.php                                 30-Sep-2022 11:06                2490
function.tan.php                                   30-Sep-2022 11:06                4268
function.tanh.php                                  30-Sep-2022 11:06                3156
function.tcpwrap-check.php                         30-Sep-2022 11:06                5381
function.tempnam.php                               30-Sep-2022 11:06                7139
function.textdomain.php                            30-Sep-2022 11:06                3120
function.tidy-access-count.php                     30-Sep-2022 11:06                6542
function.tidy-config-count.php                     30-Sep-2022 11:06                4358
function.tidy-error-count.php                      30-Sep-2022 11:06                5340
function.tidy-get-output.php                       30-Sep-2022 11:06                4237
function.tidy-warning-count.php                    30-Sep-2022 11:06                4921
function.time-nanosleep.php                        30-Sep-2022 11:06                9104
function.time-sleep-until.php                      30-Sep-2022 11:06                5909
function.time.php                                  30-Sep-2022 11:06                4688
function.timezone-abbreviations-list.php           30-Sep-2022 11:06                1898
function.timezone-identifiers-list.php             30-Sep-2022 11:06                1914
function.timezone-location-get.php                 30-Sep-2022 11:06                1870
function.timezone-name-from-abbr.php               30-Sep-2022 11:06                6136
function.timezone-name-get.php                     30-Sep-2022 11:06                1814
function.timezone-offset-get.php                   30-Sep-2022 11:06                1812
function.timezone-open.php                         30-Sep-2022 11:06                1800
function.timezone-transitions-get.php              30-Sep-2022 11:06                1873
function.timezone-version-get.php                  30-Sep-2022 11:06                4356
function.tmpfile.php                               30-Sep-2022 11:06                5498
function.token-get-all.php                         30-Sep-2022 11:06               12287
function.token-name.php                            30-Sep-2022 11:06                4231
function.touch.php                                 30-Sep-2022 11:06                8182
function.trader-acos.php                           30-Sep-2022 11:06                2349
function.trader-ad.php                             30-Sep-2022 11:06                3100
function.trader-add.php                            30-Sep-2022 11:06                2625
function.trader-adosc.php                          30-Sep-2022 11:06                3852
function.trader-adx.php                            30-Sep-2022 11:06                3186
function.trader-adxr.php                           30-Sep-2022 11:06                3197
function.trader-apo.php                            30-Sep-2022 11:06                3386
function.trader-aroon.php                          30-Sep-2022 11:06                2808
function.trader-aroonosc.php                       30-Sep-2022 11:06                2845
function.trader-asin.php                           30-Sep-2022 11:06                2363
function.trader-atan.php                           30-Sep-2022 11:06                2356
function.trader-atr.php                            30-Sep-2022 11:06                3176
function.trader-avgprice.php                       30-Sep-2022 11:06                3157
function.trader-bbands.php                         30-Sep-2022 11:06                4091
function.trader-beta.php                           30-Sep-2022 11:06                2776
function.trader-bop.php                            30-Sep-2022 11:06                3106
function.trader-cci.php                            30-Sep-2022 11:06                3181
function.trader-cdl2crows.php                      30-Sep-2022 11:06                3179
function.trader-cdl3blackcrows.php                 30-Sep-2022 11:06                3241
function.trader-cdl3inside.php                     30-Sep-2022 11:06                3222
function.trader-cdl3linestrike.php                 30-Sep-2022 11:06                3245
function.trader-cdl3outside.php                    30-Sep-2022 11:06                3237
function.trader-cdl3starsinsouth.php               30-Sep-2022 11:06                3286
function.trader-cdl3whitesoldiers.php              30-Sep-2022 11:06                3310
function.trader-cdlabandonedbaby.php               30-Sep-2022 11:06                3644
function.trader-cdladvanceblock.php                30-Sep-2022 11:06                3263
function.trader-cdlbelthold.php                    30-Sep-2022 11:06                3219
function.trader-cdlbreakaway.php                   30-Sep-2022 11:06                3233
function.trader-cdlclosingmarubozu.php             30-Sep-2022 11:06                3304
function.trader-cdlconcealbabyswall.php            30-Sep-2022 11:06                3327
function.trader-cdlcounterattack.php               30-Sep-2022 11:06                3291
function.trader-cdldarkcloudcover.php              30-Sep-2022 11:06                3638
function.trader-cdldoji.php                        30-Sep-2022 11:06                3176
function.trader-cdldojistar.php                    30-Sep-2022 11:06                3211
function.trader-cdldragonflydoji.php               30-Sep-2022 11:06                3266
function.trader-cdlengulfing.php                   30-Sep-2022 11:06                3251
function.trader-cdleveningdojistar.php             30-Sep-2022 11:06                3655
function.trader-cdleveningstar.php                 30-Sep-2022 11:06                3632
function.trader-cdlgapsidesidewhite.php            30-Sep-2022 11:06                3334
function.trader-cdlgravestonedoji.php              30-Sep-2022 11:06                3287
function.trader-cdlhammer.php                      30-Sep-2022 11:06                3202
function.trader-cdlhangingman.php                  30-Sep-2022 11:06                3223
function.trader-cdlharami.php                      30-Sep-2022 11:06                3204
function.trader-cdlharamicross.php                 30-Sep-2022 11:06                3246
function.trader-cdlhighwave.php                    30-Sep-2022 11:06                3220
function.trader-cdlhikkake.php                     30-Sep-2022 11:06                3209
function.trader-cdlhikkakemod.php                  30-Sep-2022 11:06                3250
function.trader-cdlhomingpigeon.php                30-Sep-2022 11:06                3271
function.trader-cdlidentical3crows.php             30-Sep-2022 11:06                3295
function.trader-cdlinneck.php                      30-Sep-2022 11:06                3221
function.trader-cdlinvertedhammer.php              30-Sep-2022 11:06                3269
function.trader-cdlkicking.php                     30-Sep-2022 11:06                3223
function.trader-cdlkickingbylength.php             30-Sep-2022 11:06                3329
function.trader-cdlladderbottom.php                30-Sep-2022 11:06                3279
function.trader-cdllongleggeddoji.php              30-Sep-2022 11:06                3284
function.trader-cdllongline.php                    30-Sep-2022 11:06                3228
function.trader-cdlmarubozu.php                    30-Sep-2022 11:06                3214
function.trader-cdlmatchinglow.php                 30-Sep-2022 11:06                3240
function.trader-cdlmathold.php                     30-Sep-2022 11:06                3578
function.trader-cdlmorningdojistar.php             30-Sep-2022 11:06                3651
function.trader-cdlmorningstar.php                 30-Sep-2022 11:06                3612
function.trader-cdlonneck.php                      30-Sep-2022 11:06                3201
function.trader-cdlpiercing.php                    30-Sep-2022 11:06                3218
function.trader-cdlrickshawman.php                 30-Sep-2022 11:06                3258
function.trader-cdlrisefall3methods.php            30-Sep-2022 11:06                3328
function.trader-cdlseparatinglines.php             30-Sep-2022 11:06                3310
function.trader-cdlshootingstar.php                30-Sep-2022 11:06                3269
function.trader-cdlshortline.php                   30-Sep-2022 11:06                3241
function.trader-cdlspinningtop.php                 30-Sep-2022 11:06                3256
function.trader-cdlstalledpattern.php              30-Sep-2022 11:06                3291
function.trader-cdlsticksandwich.php               30-Sep-2022 11:06                3272
function.trader-cdltakuri.php                      30-Sep-2022 11:06                3243
function.trader-cdltasukigap.php                   30-Sep-2022 11:06                3218
function.trader-cdlthrusting.php                   30-Sep-2022 11:06                3227
function.trader-cdltristar.php                     30-Sep-2022 11:06                3215
function.trader-cdlunique3river.php                30-Sep-2022 11:06                3266
function.trader-cdlupsidegap2crows.php             30-Sep-2022 11:06                3314
function.trader-cdlxsidegap3methods.php            30-Sep-2022 11:06                3313
function.trader-ceil.php                           30-Sep-2022 11:06                2380
function.trader-cmo.php                            30-Sep-2022 11:06                2543
function.trader-correl.php                         30-Sep-2022 11:06                2828
function.trader-cos.php                            30-Sep-2022 11:06                2346
function.trader-cosh.php                           30-Sep-2022 11:06                2362
function.trader-dema.php                           30-Sep-2022 11:06                2554
function.trader-div.php                            30-Sep-2022 11:06                2641
function.trader-dx.php                             30-Sep-2022 11:06                3162
function.trader-ema.php                            30-Sep-2022 11:06                2537
function.trader-errno.php                          30-Sep-2022 11:06                2131
function.trader-exp.php                            30-Sep-2022 11:06                2390
function.trader-floor.php                          30-Sep-2022 11:06                2372
function.trader-get-compat.php                     30-Sep-2022 11:06                2321
function.trader-get-unstable-period.php            30-Sep-2022 11:06                2594
function.trader-ht-dcperiod.php                    30-Sep-2022 11:06                2360
function.trader-ht-dcphase.php                     30-Sep-2022 11:06                2331
function.trader-ht-phasor.php                      30-Sep-2022 11:06                2312
function.trader-ht-sine.php                        30-Sep-2022 11:06                2291
function.trader-ht-trendline.php                   30-Sep-2022 11:06                2352
function.trader-ht-trendmode.php                   30-Sep-2022 11:06                2342
function.trader-kama.php                           30-Sep-2022 11:06                2592
function.trader-linearreg-angle.php                30-Sep-2022 11:06                2686
function.trader-linearreg-intercept.php            30-Sep-2022 11:06                2744
function.trader-linearreg-slope.php                30-Sep-2022 11:06                2696
function.trader-linearreg.php                      30-Sep-2022 11:06                2608
function.trader-ln.php                             30-Sep-2022 11:06                2348
function.trader-log10.php                          30-Sep-2022 11:06                2352
function.trader-ma.php                             30-Sep-2022 11:06                2904
function.trader-macd.php                           30-Sep-2022 11:06                3371
function.trader-macdext.php                        30-Sep-2022 11:06                4702
function.trader-macdfix.php                        30-Sep-2022 11:06                2638
function.trader-mama.php                           30-Sep-2022 11:06                2925
function.trader-mavp.php                           30-Sep-2022 11:06                3724
function.trader-max.php                            30-Sep-2022 11:06                2558
function.trader-maxindex.php                       30-Sep-2022 11:06                2615
function.trader-medprice.php                       30-Sep-2022 11:06                2529
function.trader-mfi.php                            30-Sep-2022 11:06                3471
function.trader-midpoint.php                       30-Sep-2022 11:06                2589
function.trader-midprice.php                       30-Sep-2022 11:06                2859
function.trader-min.php                            30-Sep-2022 11:06                2565
function.trader-minindex.php                       30-Sep-2022 11:06                2610
function.trader-minmax.php                         30-Sep-2022 11:06                2614
function.trader-minmaxindex.php                    30-Sep-2022 11:06                2665
function.trader-minus-di.php                       30-Sep-2022 11:06                3249
function.trader-minus-dm.php                       30-Sep-2022 11:06                2859
function.trader-mom.php                            30-Sep-2022 11:06                2529
function.trader-mult.php                           30-Sep-2022 11:06                2641
function.trader-natr.php                           30-Sep-2022 11:06                3187
function.trader-obv.php                            30-Sep-2022 11:06                2482
function.trader-plus-di.php                        30-Sep-2022 11:06                3220
function.trader-plus-dm.php                        30-Sep-2022 11:06                2846
function.trader-ppo.php                            30-Sep-2022 11:06                3390
function.trader-roc.php                            30-Sep-2022 11:06                2553
function.trader-rocp.php                           30-Sep-2022 11:06                2581
function.trader-rocr.php                           30-Sep-2022 11:06                2566
function.trader-rocr100.php                        30-Sep-2022 11:06                2606
function.trader-rsi.php                            30-Sep-2022 11:06                2534
function.trader-sar.php                            30-Sep-2022 11:06                3436
function.trader-sarext.php                         30-Sep-2022 11:06                6524
function.trader-set-compat.php                     30-Sep-2022 11:06                2543
function.trader-set-unstable-period.php            30-Sep-2022 11:06                3077
function.trader-sin.php                            30-Sep-2022 11:06                2370
function.trader-sinh.php                           30-Sep-2022 11:06                2358
function.trader-sma.php                            30-Sep-2022 11:06                2534
function.trader-sqrt.php                           30-Sep-2022 11:06                2351
function.trader-stddev.php                         30-Sep-2022 11:06                2824
function.trader-stoch.php                          30-Sep-2022 11:06                4838
function.trader-stochf.php                         30-Sep-2022 11:06                4053
function.trader-stochrsi.php                       30-Sep-2022 11:06                3849
function.trader-sub.php                            30-Sep-2022 11:06                2646
function.trader-sum.php                            30-Sep-2022 11:06                2516
function.trader-t3.php                             30-Sep-2022 11:06                2841
function.trader-tan.php                            30-Sep-2022 11:06                2339
function.trader-tanh.php                           30-Sep-2022 11:06                2363
function.trader-tema.php                           30-Sep-2022 11:06                2560
function.trader-trange.php                         30-Sep-2022 11:06                2763
function.trader-trima.php                          30-Sep-2022 11:06                2562
function.trader-trix.php                           30-Sep-2022 11:06                2572
function.trader-tsf.php                            30-Sep-2022 11:06                2541
function.trader-typprice.php                       30-Sep-2022 11:06                2786
function.trader-ultosc.php                         30-Sep-2022 11:06                3936
function.trader-var.php                            30-Sep-2022 11:06                2794
function.trader-wclprice.php                       30-Sep-2022 11:06                2791
function.trader-willr.php                          30-Sep-2022 11:06                3193
function.trader-wma.php                            30-Sep-2022 11:06                2550
function.trait-exists.php                          30-Sep-2022 11:06                2742
function.trigger-error.php                         30-Sep-2022 11:06                6494
function.trim.php                                  30-Sep-2022 11:06               14087
function.uasort.php                                30-Sep-2022 11:06                9900
function.ucfirst.php                               30-Sep-2022 11:06                5796
function.ucwords.php                               30-Sep-2022 11:06               10004
function.ui-draw-text-font-fontfamilies.php        30-Sep-2022 11:06                2303
function.ui-quit.php                               30-Sep-2022 11:06                2008
function.ui-run.php                                30-Sep-2022 11:06                2327
function.uksort.php                                30-Sep-2022 11:06                9218
function.umask.php                                 30-Sep-2022 11:06                5632
function.uniqid.php                                30-Sep-2022 11:06                7701
function.unixtojd.php                              30-Sep-2022 11:06                3808
function.unlink.php                                30-Sep-2022 11:06                5803
function.unpack.php                                30-Sep-2022 11:06               10677
function.unregister-tick-function.php              30-Sep-2022 11:06                3149
function.unserialize.php                           30-Sep-2022 11:06               16721
function.unset.php                                 30-Sep-2022 11:06               15609
function.untaint.php                               30-Sep-2022 11:06                2346
function.uopz-add-function.php                     30-Sep-2022 11:06                6602
function.uopz-allow-exit.php                       30-Sep-2022 11:06                4579
function.uopz-backup.php                           30-Sep-2022 11:06                4392
function.uopz-compose.php                          30-Sep-2022 11:06                6889
function.uopz-copy.php                             30-Sep-2022 11:06                5104
function.uopz-del-function.php                     30-Sep-2022 11:06                6146
function.uopz-delete.php                           30-Sep-2022 11:06                5890
function.uopz-extend.php                           30-Sep-2022 11:06                4779
function.uopz-flags.php                            30-Sep-2022 11:06               10737
function.uopz-function.php                         30-Sep-2022 11:06                7100
function.uopz-get-exit-status.php                  30-Sep-2022 11:06                4202
function.uopz-get-hook.php                         30-Sep-2022 11:06                5186
function.uopz-get-mock.php                         30-Sep-2022 11:06                5138
function.uopz-get-property.php                     30-Sep-2022 11:06                6119
function.uopz-get-return.php                       30-Sep-2022 11:06                4343
function.uopz-get-static.php                       30-Sep-2022 11:06                4815
function.uopz-implement.php                        30-Sep-2022 11:06                4804
function.uopz-overload.php                         30-Sep-2022 11:06                3877
function.uopz-redefine.php                         30-Sep-2022 11:06                4845
function.uopz-rename.php                           30-Sep-2022 11:06                6583
function.uopz-restore.php                          30-Sep-2022 11:06                4751
function.uopz-set-hook.php                         30-Sep-2022 11:06                5369
function.uopz-set-mock.php                         30-Sep-2022 11:06               12623
function.uopz-set-property.php                     30-Sep-2022 11:06                7588
function.uopz-set-return.php                       30-Sep-2022 11:06                9420
function.uopz-set-static.php                       30-Sep-2022 11:06                5463
function.uopz-undefine.php                         30-Sep-2022 11:06                4307
function.uopz-unset-hook.php                       30-Sep-2022 11:06                5263
function.uopz-unset-mock.php                       30-Sep-2022 11:06                5486
function.uopz-unset-return.php                     30-Sep-2022 11:06                4639
function.urldecode.php                             30-Sep-2022 11:06                6492
function.urlencode.php                             30-Sep-2022 11:06                8394
function.use-soap-error-handler.php                30-Sep-2022 11:06                3772
function.user-error.php                            30-Sep-2022 11:06                1689
function.usleep.php                                30-Sep-2022 11:06                6031
function.usort.php                                 30-Sep-2022 11:06               28144
function.utf8-decode.php                           30-Sep-2022 11:06                9315
function.utf8-encode.php                           30-Sep-2022 11:06                7719
function.var-dump.php                              30-Sep-2022 11:06                7194
function.var-export.php                            30-Sep-2022 11:06               17545
function.var-representation.php                    30-Sep-2022 11:06               14425
function.variant-abs.php                           30-Sep-2022 11:06                4167
function.variant-add.php                           30-Sep-2022 11:06                5531
function.variant-and.php                           30-Sep-2022 11:06                6235
function.variant-cast.php                          30-Sep-2022 11:06                3476
function.variant-cat.php                           30-Sep-2022 11:06                4755
function.variant-cmp.php                           30-Sep-2022 11:06                7178
function.variant-date-from-timestamp.php           30-Sep-2022 11:06                3546
function.variant-date-to-timestamp.php             30-Sep-2022 11:06                3611
function.variant-div.php                           30-Sep-2022 11:06                6327
function.variant-eqv.php                           30-Sep-2022 11:06                4354
function.variant-fix.php                           30-Sep-2022 11:06                5554
function.variant-get-type.php                      30-Sep-2022 11:06                3409
function.variant-idiv.php                          30-Sep-2022 11:06                5750
function.variant-imp.php                           30-Sep-2022 11:06                5774
function.variant-int.php                           30-Sep-2022 11:06                5046
function.variant-mod.php                           30-Sep-2022 11:06                4826
function.variant-mul.php                           30-Sep-2022 11:06                5835
function.variant-neg.php                           30-Sep-2022 11:06                3814
function.variant-not.php                           30-Sep-2022 11:06                3978
function.variant-or.php                            30-Sep-2022 11:06                6410
function.variant-pow.php                           30-Sep-2022 11:06                4648
function.variant-round.php                         30-Sep-2022 11:06                4343
function.variant-set-type.php                      30-Sep-2022 11:06                3607
function.variant-set.php                           30-Sep-2022 11:06                2908
function.variant-sub.php                           30-Sep-2022 11:06                5493
function.variant-xor.php                           30-Sep-2022 11:06                5762
function.version-compare.php                       30-Sep-2022 11:06               11681
function.vfprintf.php                              30-Sep-2022 11:06               16651
function.virtual.php                               30-Sep-2022 11:06                5383
function.vprintf.php                               30-Sep-2022 11:06               16042
function.vsprintf.php                              30-Sep-2022 11:06               16469
function.wddx-add-vars.php                         30-Sep-2022 11:06                3762
function.wddx-deserialize.php                      30-Sep-2022 11:06                3750
function.wddx-packet-end.php                       30-Sep-2022 11:06                2783
function.wddx-packet-start.php                     30-Sep-2022 11:06                2912
function.wddx-serialize-value.php                  30-Sep-2022 11:06                3177
function.wddx-serialize-vars.php                   30-Sep-2022 11:06                6049
function.win32-continue-service.php                30-Sep-2022 11:06                6419
function.win32-create-service.php                  30-Sep-2022 11:06               32937
function.win32-delete-service.php                  30-Sep-2022 11:06                6849
function.win32-get-last-control-message.php        30-Sep-2022 11:06                7114
function.win32-pause-service.php                   30-Sep-2022 11:06                6416
function.win32-query-service-status.php            30-Sep-2022 11:06                8307
function.win32-send-custom-control.php             30-Sep-2022 11:06                6971
function.win32-set-service-exit-code.php           30-Sep-2022 11:06                5656
function.win32-set-service-exit-mode.php           30-Sep-2022 11:06                5699
function.win32-set-service-status.php              30-Sep-2022 11:06                8124
function.win32-start-service-ctrl-dispatcher.php   30-Sep-2022 11:06               11012
function.win32-start-service.php                   30-Sep-2022 11:06                6420
function.win32-stop-service.php                    30-Sep-2022 11:06                6341
function.wincache-fcache-fileinfo.php              30-Sep-2022 11:06                9178
function.wincache-fcache-meminfo.php               30-Sep-2022 11:06                7110
function.wincache-lock.php                         30-Sep-2022 11:06                8565
function.wincache-ocache-fileinfo.php              30-Sep-2022 11:06                9860
function.wincache-ocache-meminfo.php               30-Sep-2022 11:06                7318
function.wincache-refresh-if-changed.php           30-Sep-2022 11:06                7841
function.wincache-rplist-fileinfo.php              30-Sep-2022 11:06                7544
function.wincache-rplist-meminfo.php               30-Sep-2022 11:06                7225
function.wincache-scache-info.php                  30-Sep-2022 11:06                9447
function.wincache-scache-meminfo.php               30-Sep-2022 11:06                6683
function.wincache-ucache-add.php                   30-Sep-2022 11:06               13256
function.wincache-ucache-cas.php                   30-Sep-2022 11:06                6110
function.wincache-ucache-clear.php                 30-Sep-2022 11:06                7594
function.wincache-ucache-dec.php                   30-Sep-2022 11:06                6132
function.wincache-ucache-delete.php                30-Sep-2022 11:06               11520
function.wincache-ucache-exists.php                30-Sep-2022 11:06                6089
function.wincache-ucache-get.php                   30-Sep-2022 11:06               10565
function.wincache-ucache-inc.php                   30-Sep-2022 11:06                6124
function.wincache-ucache-info.php                  30-Sep-2022 11:06               11166
function.wincache-ucache-meminfo.php               30-Sep-2022 11:06                6887
function.wincache-ucache-set.php                   30-Sep-2022 11:06               13484
function.wincache-unlock.php                       30-Sep-2022 11:06                7934
function.wordwrap.php                              30-Sep-2022 11:06                7946
function.xattr-get.php                             30-Sep-2022 11:06                5839
function.xattr-list.php                            30-Sep-2022 11:06                6454
function.xattr-remove.php                          30-Sep-2022 11:06                6040
function.xattr-set.php                             30-Sep-2022 11:06                7656
function.xattr-supported.php                       30-Sep-2022 11:06                5070
function.xdiff-file-bdiff-size.php                 30-Sep-2022 11:06                4826
function.xdiff-file-bdiff.php                      30-Sep-2022 11:06                5699
function.xdiff-file-bpatch.php                     30-Sep-2022 11:06                6361
function.xdiff-file-diff-binary.php                30-Sep-2022 11:06                6137
function.xdiff-file-diff.php                       30-Sep-2022 11:06                6929
function.xdiff-file-merge3.php                     30-Sep-2022 11:06                6655
function.xdiff-file-patch-binary.php               30-Sep-2022 11:06                6501
function.xdiff-file-patch.php                      30-Sep-2022 11:06                8726
function.xdiff-file-rabdiff.php                    30-Sep-2022 11:06                6255
function.xdiff-string-bdiff-size.php               30-Sep-2022 11:06                5150
function.xdiff-string-bdiff.php                    30-Sep-2022 11:06                3639
function.xdiff-string-bpatch.php                   30-Sep-2022 11:06                3752
function.xdiff-string-diff-binary.php              30-Sep-2022 11:06                4145
function.xdiff-string-diff.php                     30-Sep-2022 11:06                7403
function.xdiff-string-merge3.php                   30-Sep-2022 11:06                4524
function.xdiff-string-patch-binary.php             30-Sep-2022 11:06                4302
function.xdiff-string-patch.php                    30-Sep-2022 11:06                8086
function.xdiff-string-rabdiff.php                  30-Sep-2022 11:06                4256
function.xhprof-disable.php                        30-Sep-2022 11:06                3871
function.xhprof-enable.php                         30-Sep-2022 11:06                7756
function.xhprof-sample-disable.php                 30-Sep-2022 11:06                4677
function.xhprof-sample-enable.php                  30-Sep-2022 11:06                3468
function.xml-error-string.php                      30-Sep-2022 11:06                3123
function.xml-get-current-byte-index.php            30-Sep-2022 11:06                4482
function.xml-get-current-column-number.php         30-Sep-2022 11:06                4322
function.xml-get-current-line-number.php           30-Sep-2022 11:06                4124
function.xml-get-error-code.php                    30-Sep-2022 11:06                3766
function.xml-parse-into-struct.php                 30-Sep-2022 11:06               20979
function.xml-parse.php                             30-Sep-2022 11:06                8017
function.xml-parser-create-ns.php                  30-Sep-2022 11:06                5164
function.xml-parser-create.php                     30-Sep-2022 11:06                4772
function.xml-parser-free.php                       30-Sep-2022 11:06                3907
function.xml-parser-get-option.php                 30-Sep-2022 11:06                4448
function.xml-parser-set-option.php                 30-Sep-2022 11:06                5912
function.xml-set-character-data-handler.php        30-Sep-2022 11:06                5828
function.xml-set-default-handler.php               30-Sep-2022 11:06                5700
function.xml-set-element-handler.php               30-Sep-2022 11:06                8500
function.xml-set-end-namespace-decl-handler.php    30-Sep-2022 11:06                6819
function.xml-set-external-entity-ref-handler.php   30-Sep-2022 11:06                8235
function.xml-set-notation-decl-handler.php         30-Sep-2022 11:06                7579
function.xml-set-object.php                        30-Sep-2022 11:06               10588
function.xml-set-processing-instruction-handler..> 30-Sep-2022 11:06                6828
function.xml-set-start-namespace-decl-handler.php  30-Sep-2022 11:06                7013
function.xml-set-unparsed-entity-decl-handler.php  30-Sep-2022 11:06                8206
function.xmlrpc-decode-request.php                 30-Sep-2022 11:06                2686
function.xmlrpc-decode.php                         30-Sep-2022 11:06                4064
function.xmlrpc-encode-request.php                 30-Sep-2022 11:06                8799
function.xmlrpc-encode.php                         30-Sep-2022 11:06                2385
function.xmlrpc-get-type.php                       30-Sep-2022 11:06                6530
function.xmlrpc-is-fault.php                       30-Sep-2022 11:06                3709
function.xmlrpc-parse-method-descriptions.php      30-Sep-2022 11:06                2483
function.xmlrpc-server-add-introspection-data.php  30-Sep-2022 11:06                2619
function.xmlrpc-server-call-method.php             30-Sep-2022 11:06                3006
function.xmlrpc-server-create.php                  30-Sep-2022 11:06                2257
function.xmlrpc-server-destroy.php                 30-Sep-2022 11:06                2406
function.xmlrpc-server-register-introspection-c..> 30-Sep-2022 11:06                2700
function.xmlrpc-server-register-method.php         30-Sep-2022 11:06                2717
function.xmlrpc-set-type.php                       30-Sep-2022 11:06                5262
function.yaml-emit-file.php                        30-Sep-2022 11:06                5816
function.yaml-emit.php                             30-Sep-2022 11:06               12830
function.yaml-parse-file.php                       30-Sep-2022 11:06                5715
function.yaml-parse-url.php                        30-Sep-2022 11:06                6043
function.yaml-parse.php                            30-Sep-2022 11:06                9994
function.yaz-addinfo.php                           30-Sep-2022 11:06                3291
function.yaz-ccl-conf.php                          30-Sep-2022 11:06                5661
function.yaz-ccl-parse.php                         30-Sep-2022 11:06                6600
function.yaz-close.php                             30-Sep-2022 11:06                3295
function.yaz-connect.php                           30-Sep-2022 11:06                8929
function.yaz-database.php                          30-Sep-2022 11:06                3159
function.yaz-element.php                           30-Sep-2022 11:06                3594
function.yaz-errno.php                             30-Sep-2022 11:06                3527
function.yaz-error.php                             30-Sep-2022 11:06                3280
function.yaz-es-result.php                         30-Sep-2022 11:06                3185
function.yaz-es.php                                30-Sep-2022 11:06                7121
function.yaz-get-option.php                        30-Sep-2022 11:06                3204
function.yaz-hits.php                              30-Sep-2022 11:06                4685
function.yaz-itemorder.php                         30-Sep-2022 11:06                6910
function.yaz-present.php                           30-Sep-2022 11:06                2791
function.yaz-range.php                             30-Sep-2022 11:06                3417
function.yaz-record.php                            30-Sep-2022 11:06               14192
function.yaz-scan-result.php                       30-Sep-2022 11:06                3830
function.yaz-scan.php                              30-Sep-2022 11:06                9716
function.yaz-schema.php                            30-Sep-2022 11:06                3305
function.yaz-search.php                            30-Sep-2022 11:06                8353
function.yaz-set-option.php                        30-Sep-2022 11:06                6665
function.yaz-sort.php                              30-Sep-2022 11:06                5476
function.yaz-syntax.php                            30-Sep-2022 11:06                3263
function.yaz-wait.php                              30-Sep-2022 11:06                4004
function.zend-thread-id.php                        30-Sep-2022 11:06                3749
function.zend-version.php                          30-Sep-2022 11:06                3907
function.zip-close.php                             30-Sep-2022 11:06                3934
function.zip-entry-close.php                       30-Sep-2022 11:06                4082
function.zip-entry-compressedsize.php              30-Sep-2022 11:06                4378
function.zip-entry-compressionmethod.php           30-Sep-2022 11:06                4470
function.zip-entry-filesize.php                    30-Sep-2022 11:06                4302
function.zip-entry-name.php                        30-Sep-2022 11:06                4213
function.zip-entry-open.php                        30-Sep-2022 11:06                5714
function.zip-entry-read.php                        30-Sep-2022 11:06                5031
function.zip-open.php                              30-Sep-2022 11:06                4335
function.zip-read.php                              30-Sep-2022 11:06                4707
function.zlib-decode.php                           30-Sep-2022 11:06                3248
function.zlib-encode.php                           30-Sep-2022 11:06                5021
function.zlib-get-coding-type.php                  30-Sep-2022 11:06                2763
function.zookeeper-dispatch.php                    30-Sep-2022 11:06                8658
functional.parallel.php                            30-Sep-2022 11:06                2552
functions.anonymous.php                            30-Sep-2022 11:06               27446
functions.arguments.php                            30-Sep-2022 11:06               49623
functions.arrow.php                                30-Sep-2022 11:06               11359
functions.first_class_callable_syntax.php          30-Sep-2022 11:06               12606
functions.internal.php                             30-Sep-2022 11:06                8138
functions.returning-values.php                     30-Sep-2022 11:06                6595
functions.user-defined.php                         30-Sep-2022 11:06               10531
functions.variable-functions.php                   30-Sep-2022 11:06               13132
gearman.configuration.php                          30-Sep-2022 11:06                1238
gearman.constants.php                              30-Sep-2022 11:06               17925
gearman.examples-reverse-bg.php                    30-Sep-2022 11:06               11694
gearman.examples-reverse-task.php                  30-Sep-2022 11:06               18873
gearman.examples-reverse.php                       30-Sep-2022 11:06               14315
gearman.examples.php                               30-Sep-2022 11:06                1562
gearman.installation.php                           30-Sep-2022 11:06                1540
gearman.requirements.php                           30-Sep-2022 11:06                1481
gearman.resources.php                              30-Sep-2022 11:06                1211
gearman.setup.php                                  30-Sep-2022 11:06                1578
gearmanclient.addoptions.php                       30-Sep-2022 11:06                2857
gearmanclient.addserver.php                        30-Sep-2022 11:06                4941
gearmanclient.addservers.php                       30-Sep-2022 11:06                4432
gearmanclient.addtask.php                          30-Sep-2022 11:06               15264
gearmanclient.addtaskbackground.php                30-Sep-2022 11:06               21538
gearmanclient.addtaskhigh.php                      30-Sep-2022 11:06               11368
gearmanclient.addtaskhighbackground.php            30-Sep-2022 11:06                5902
gearmanclient.addtasklow.php                       30-Sep-2022 11:06               11350
gearmanclient.addtasklowbackground.php             30-Sep-2022 11:06                5895
gearmanclient.addtaskstatus.php                    30-Sep-2022 11:06                9931
gearmanclient.clearcallbacks.php                   30-Sep-2022 11:06                4341
gearmanclient.clone.php                            30-Sep-2022 11:06                2578
gearmanclient.construct.php                        30-Sep-2022 11:06                2815
gearmanclient.context.php                          30-Sep-2022 11:06                2828
gearmanclient.data.php                             30-Sep-2022 11:06                3096
gearmanclient.do.php                               30-Sep-2022 11:06               23936
gearmanclient.dobackground.php                     30-Sep-2022 11:06                9765
gearmanclient.dohigh.php                           30-Sep-2022 11:06                4777
gearmanclient.dohighbackground.php                 30-Sep-2022 11:06                4604
gearmanclient.dojobhandle.php                      30-Sep-2022 11:06                2885
gearmanclient.dolow.php                            30-Sep-2022 11:06                4763
gearmanclient.dolowbackground.php                  30-Sep-2022 11:06                4586
gearmanclient.donormal.php                         30-Sep-2022 11:06               24324
gearmanclient.dostatus.php                         30-Sep-2022 11:06                8785
gearmanclient.echo.php                             30-Sep-2022 11:06                2762
gearmanclient.error.php                            30-Sep-2022 11:06                2573
gearmanclient.geterrno.php                         30-Sep-2022 11:06                2597
gearmanclient.jobstatus.php                        30-Sep-2022 11:06                8637
gearmanclient.ping.php                             30-Sep-2022 11:06                2735
gearmanclient.removeoptions.php                    30-Sep-2022 11:06                2503
gearmanclient.returncode.php                       30-Sep-2022 11:06                2228
gearmanclient.runtasks.php                         30-Sep-2022 11:06                3560
gearmanclient.setclientcallback.php                30-Sep-2022 11:06                5352
gearmanclient.setcompletecallback.php              30-Sep-2022 11:06                5186
gearmanclient.setcontext.php                       30-Sep-2022 11:06                3062
gearmanclient.setcreatedcallback.php               30-Sep-2022 11:06                4659
gearmanclient.setdata.php                          30-Sep-2022 11:06                3257
gearmanclient.setdatacallback.php                  30-Sep-2022 11:06                4710
gearmanclient.setexceptioncallback.php             30-Sep-2022 11:06                4630
gearmanclient.setfailcallback.php                  30-Sep-2022 11:06                4716
gearmanclient.setoptions.php                       30-Sep-2022 11:06                2489
gearmanclient.setstatuscallback.php                30-Sep-2022 11:06                4716
gearmanclient.settimeout.php                       30-Sep-2022 11:06                2531
gearmanclient.setwarningcallback.php               30-Sep-2022 11:06                4719
gearmanclient.setworkloadcallback.php              30-Sep-2022 11:06                4873
gearmanclient.timeout.php                          30-Sep-2022 11:06                2692
gearmanclient.wait.php                             30-Sep-2022 11:06                2635
gearmanjob.complete.php                            30-Sep-2022 11:06                3391
gearmanjob.construct.php                           30-Sep-2022 11:06                2320
gearmanjob.data.php                                30-Sep-2022 11:06                3351
gearmanjob.exception.php                           30-Sep-2022 11:06                3573
gearmanjob.fail.php                                30-Sep-2022 11:06                3569
gearmanjob.functionname.php                        30-Sep-2022 11:06                2618
gearmanjob.handle.php                              30-Sep-2022 11:06                2505
gearmanjob.returncode.php                          30-Sep-2022 11:06                2552
gearmanjob.sendcomplete.php                        30-Sep-2022 11:06                3109
gearmanjob.senddata.php                            30-Sep-2022 11:06                3076
gearmanjob.sendexception.php                       30-Sep-2022 11:06                3304
gearmanjob.sendfail.php                            30-Sep-2022 11:06                3285
gearmanjob.sendstatus.php                          30-Sep-2022 11:06                3767
gearmanjob.sendwarning.php                         30-Sep-2022 11:06                3300
gearmanjob.setreturn.php                           30-Sep-2022 11:06                2424
gearmanjob.status.php                              30-Sep-2022 11:06                4051
gearmanjob.unique.php                              30-Sep-2022 11:06                2757
gearmanjob.warning.php                             30-Sep-2022 11:06                3584
gearmanjob.workload.php                            30-Sep-2022 11:06                2763
gearmanjob.workloadsize.php                        30-Sep-2022 11:06                2568
gearmantask.construct.php                          30-Sep-2022 11:06                2340
gearmantask.create.php                             30-Sep-2022 11:06                2717
gearmantask.data.php                               30-Sep-2022 11:06                2559
gearmantask.datasize.php                           30-Sep-2022 11:06                2584
gearmantask.function.php                           30-Sep-2022 11:06                2573
gearmantask.functionname.php                       30-Sep-2022 11:06                2262
gearmantask.isknown.php                            30-Sep-2022 11:06                2277
gearmantask.isrunning.php                          30-Sep-2022 11:06                2281
gearmantask.jobhandle.php                          30-Sep-2022 11:06                2654
gearmantask.recvdata.php                           30-Sep-2022 11:06                3247
gearmantask.returncode.php                         30-Sep-2022 11:06                2579
gearmantask.senddata.php                           30-Sep-2022 11:06                3174
gearmantask.sendworkload.php                       30-Sep-2022 11:06                3207
gearmantask.taskdenominator.php                    30-Sep-2022 11:06                2777
gearmantask.tasknumerator.php                      30-Sep-2022 11:06                2749
gearmantask.unique.php                             30-Sep-2022 11:06                3007
gearmantask.uuid.php                               30-Sep-2022 11:06                3299
gearmanworker.addfunction.php                      30-Sep-2022 11:06                7833
gearmanworker.addoptions.php                       30-Sep-2022 11:06                3248
gearmanworker.addserver.php                        30-Sep-2022 11:06                4598
gearmanworker.addservers.php                       30-Sep-2022 11:06                4084
gearmanworker.clone.php                            30-Sep-2022 11:06                2276
gearmanworker.construct.php                        30-Sep-2022 11:06                2788
gearmanworker.echo.php                             30-Sep-2022 11:06                2901
gearmanworker.error.php                            30-Sep-2022 11:06                2526
gearmanworker.geterrno.php                         30-Sep-2022 11:06                2564
gearmanworker.options.php                          30-Sep-2022 11:06                2571
gearmanworker.register.php                         30-Sep-2022 11:06                3619
gearmanworker.removeoptions.php                    30-Sep-2022 11:06                3270
gearmanworker.returncode.php                       30-Sep-2022 11:06                2774
gearmanworker.setid.php                            30-Sep-2022 11:06                3872
gearmanworker.setoptions.php                       30-Sep-2022 11:06                3418
gearmanworker.settimeout.php                       30-Sep-2022 11:06                8085
gearmanworker.timeout.php                          30-Sep-2022 11:06                2671
gearmanworker.unregister.php                       30-Sep-2022 11:06                3237
gearmanworker.unregisterall.php                    30-Sep-2022 11:06                2949
gearmanworker.wait.php                             30-Sep-2022 11:06                8449
gearmanworker.work.php                             30-Sep-2022 11:06                5381
gender-gender.connect.php                          30-Sep-2022 11:06                2420
gender-gender.construct.php                        30-Sep-2022 11:06                2333
gender-gender.country.php                          30-Sep-2022 11:06                3632
gender-gender.get.php                              30-Sep-2022 11:06                2683
gender-gender.isnick.php                           30-Sep-2022 11:06                3144
gender-gender.similarnames.php                     30-Sep-2022 11:06                2796
gender.example.admin.php                           30-Sep-2022 11:06                9315
gender.examples.php                                30-Sep-2022 11:06                1325
gender.installation.php                            30-Sep-2022 11:06                1948
gender.setup.php                                   30-Sep-2022 11:06                1358
generator.current.php                              30-Sep-2022 11:06                2127
generator.getreturn.php                            30-Sep-2022 11:06                3997
generator.key.php                                  30-Sep-2022 11:06                3978
generator.next.php                                 30-Sep-2022 11:06                2350
generator.rewind.php                               30-Sep-2022 11:06                2153
generator.send.php                                 30-Sep-2022 11:06                5792
generator.throw.php                                30-Sep-2022 11:06                5371
generator.valid.php                                30-Sep-2022 11:06                2130
generator.wakeup.php                               30-Sep-2022 11:06                2146
geoip.configuration.php                            30-Sep-2022 11:06                2363
geoip.constants.php                                30-Sep-2022 11:06                4488
geoip.installation.php                             30-Sep-2022 11:06                1670
geoip.requirements.php                             30-Sep-2022 11:06                1684
geoip.resources.php                                30-Sep-2022 11:06                1167
geoip.setup.php                                    30-Sep-2022 11:06                1539
gettext.configuration.php                          30-Sep-2022 11:06                1238
gettext.constants.php                              30-Sep-2022 11:06                1140
gettext.installation.php                           30-Sep-2022 11:06                1443
gettext.requirements.php                           30-Sep-2022 11:06                1383
gettext.resources.php                              30-Sep-2022 11:06                1181
gettext.setup.php                                  30-Sep-2022 11:06                1583
getting-started.php                                30-Sep-2022 11:06                1904
globiterator.construct.php                         30-Sep-2022 11:06                7868
globiterator.count.php                             30-Sep-2022 11:06                4400
gmagick.addimage.php                               30-Sep-2022 11:06                2842
gmagick.addnoiseimage.php                          30-Sep-2022 11:06                2839
gmagick.annotateimage.php                          30-Sep-2022 11:06                4214
gmagick.blurimage.php                              30-Sep-2022 11:06                3123
gmagick.borderimage.php                            30-Sep-2022 11:06                3634
gmagick.charcoalimage.php                          30-Sep-2022 11:06                3131
gmagick.chopimage.php                              30-Sep-2022 11:06                3675
gmagick.clear.php                                  30-Sep-2022 11:06                2586
gmagick.commentimage.php                           30-Sep-2022 11:06                2784
gmagick.compositeimage.php                         30-Sep-2022 11:06                3896
gmagick.configuration.php                          30-Sep-2022 11:06                1247
gmagick.constants.php                              30-Sep-2022 11:06               68511
gmagick.construct.php                              30-Sep-2022 11:06                2541
gmagick.cropimage.php                              30-Sep-2022 11:06                3810
gmagick.cropthumbnailimage.php                     30-Sep-2022 11:06                3168
gmagick.current.php                                30-Sep-2022 11:06                2487
gmagick.cyclecolormapimage.php                     30-Sep-2022 11:06                2912
gmagick.deconstructimages.php                      30-Sep-2022 11:06                2735
gmagick.despeckleimage.php                         30-Sep-2022 11:06                3438
gmagick.destroy.php                                30-Sep-2022 11:06                2572
gmagick.drawimage.php                              30-Sep-2022 11:06                2966
gmagick.edgeimage.php                              30-Sep-2022 11:06                2855
gmagick.embossimage.php                            30-Sep-2022 11:06                3309
gmagick.enhanceimage.php                           30-Sep-2022 11:06                2597
gmagick.equalizeimage.php                          30-Sep-2022 11:06                2556
gmagick.examples.php                               30-Sep-2022 11:06                3677
gmagick.flipimage.php                              30-Sep-2022 11:06                2907
gmagick.flopimage.php                              30-Sep-2022 11:06                2904
gmagick.frameimage.php                             30-Sep-2022 11:06                4351
gmagick.gammaimage.php                             30-Sep-2022 11:06                3066
gmagick.getcopyright.php                           30-Sep-2022 11:06                2518
gmagick.getfilename.php                            30-Sep-2022 11:06                2468
gmagick.getimagebackgroundcolor.php                30-Sep-2022 11:06                2665
gmagick.getimageblueprimary.php                    30-Sep-2022 11:06                2918
gmagick.getimagebordercolor.php                    30-Sep-2022 11:06                2709
gmagick.getimagechanneldepth.php                   30-Sep-2022 11:06                2654
gmagick.getimagecolors.php                         30-Sep-2022 11:06                2506
gmagick.getimagecolorspace.php                     30-Sep-2022 11:06                2464
gmagick.getimagecompose.php                        30-Sep-2022 11:06                2544
gmagick.getimagedelay.php                          30-Sep-2022 11:06                2441
gmagick.getimagedepth.php                          30-Sep-2022 11:06                2411
gmagick.getimagedispose.php                        30-Sep-2022 11:06                2465
gmagick.getimageextrema.php                        30-Sep-2022 11:06                2680
gmagick.getimagefilename.php                       30-Sep-2022 11:06                2547
gmagick.getimageformat.php                         30-Sep-2022 11:06                2530
gmagick.getimagegamma.php                          30-Sep-2022 11:06                2432
gmagick.getimagegreenprimary.php                   30-Sep-2022 11:06                2651
gmagick.getimageheight.php                         30-Sep-2022 11:06                2463
gmagick.getimagehistogram.php                      30-Sep-2022 11:06                2824
gmagick.getimageindex.php                          30-Sep-2022 11:06                2594
gmagick.getimageinterlacescheme.php                30-Sep-2022 11:06                2582
gmagick.getimageiterations.php                     30-Sep-2022 11:06                2509
gmagick.getimagematte.php                          30-Sep-2022 11:06                2643
gmagick.getimagemattecolor.php                     30-Sep-2022 11:06                2615
gmagick.getimageprofile.php                        30-Sep-2022 11:06                2602
gmagick.getimageredprimary.php                     30-Sep-2022 11:06                2672
gmagick.getimagerenderingintent.php                30-Sep-2022 11:06                2593
gmagick.getimageresolution.php                     30-Sep-2022 11:06                2525
gmagick.getimagescene.php                          30-Sep-2022 11:06                2428
gmagick.getimagesignature.php                      30-Sep-2022 11:06                2541
gmagick.getimagetype.php                           30-Sep-2022 11:06                2435
gmagick.getimageunits.php                          30-Sep-2022 11:06                2193
gmagick.getimagewhitepoint.php                     30-Sep-2022 11:06                2648
gmagick.getimagewidth.php                          30-Sep-2022 11:06                2442
gmagick.getpackagename.php                         30-Sep-2022 11:06                2494
gmagick.getquantumdepth.php                        30-Sep-2022 11:06                2673
gmagick.getreleasedate.php                         30-Sep-2022 11:06                2528
gmagick.getsamplingfactors.php                     30-Sep-2022 11:06                2583
gmagick.getsize.php                                30-Sep-2022 11:06                2732
gmagick.getversion.php                             30-Sep-2022 11:06                2473
gmagick.hasnextimage.php                           30-Sep-2022 11:06                2775
gmagick.haspreviousimage.php                       30-Sep-2022 11:06                2819
gmagick.implodeimage.php                           30-Sep-2022 11:06                2936
gmagick.installation.php                           30-Sep-2022 11:06                1915
gmagick.labelimage.php                             30-Sep-2022 11:06                2703
gmagick.levelimage.php                             30-Sep-2022 11:06                4494
gmagick.magnifyimage.php                           30-Sep-2022 11:06                2623
gmagick.mapimage.php                               30-Sep-2022 11:06                3203
gmagick.medianfilterimage.php                      30-Sep-2022 11:06                2959
gmagick.minifyimage.php                            30-Sep-2022 11:06                2616
gmagick.modulateimage.php                          30-Sep-2022 11:06                3705
gmagick.motionblurimage.php                        30-Sep-2022 11:06                3730
gmagick.newimage.php                               30-Sep-2022 11:06                3694
gmagick.nextimage.php                              30-Sep-2022 11:06                2593
gmagick.normalizeimage.php                         30-Sep-2022 11:06                2940
gmagick.oilpaintimage.php                          30-Sep-2022 11:06                2956
gmagick.previousimage.php                          30-Sep-2022 11:06                2588
gmagick.profileimage.php                           30-Sep-2022 11:06                3354
gmagick.quantizeimage.php                          30-Sep-2022 11:06                5065
gmagick.quantizeimages.php                         30-Sep-2022 11:06                5068
gmagick.queryfontmetrics.php                       30-Sep-2022 11:06                2791
gmagick.queryfonts.php                             30-Sep-2022 11:06                2567
gmagick.queryformats.php                           30-Sep-2022 11:06                2914
gmagick.radialblurimage.php                        30-Sep-2022 11:06                3106
gmagick.raiseimage.php                             30-Sep-2022 11:06                4134
gmagick.read.php                                   30-Sep-2022 11:06                2677
gmagick.readimage.php                              30-Sep-2022 11:06                2727
gmagick.readimageblob.php                          30-Sep-2022 11:06                3094
gmagick.readimagefile.php                          30-Sep-2022 11:06                2963
gmagick.reducenoiseimage.php                       30-Sep-2022 11:06                3134
gmagick.removeimage.php                            30-Sep-2022 11:06                2564
gmagick.removeimageprofile.php                     30-Sep-2022 11:06                2779
gmagick.requirements.php                           30-Sep-2022 11:06                1644
gmagick.resampleimage.php                          30-Sep-2022 11:06                3701
gmagick.resizeimage.php                            30-Sep-2022 11:06                3927
gmagick.rollimage.php                              30-Sep-2022 11:06                2885
gmagick.rotateimage.php                            30-Sep-2022 11:06                3159
gmagick.scaleimage.php                             30-Sep-2022 11:06                3317
gmagick.separateimagechannel.php                   30-Sep-2022 11:06                3126
gmagick.setcompressionquality.php                  30-Sep-2022 11:06                4165
gmagick.setfilename.php                            30-Sep-2022 11:06                2857
gmagick.setimagebackgroundcolor.php                30-Sep-2022 11:06                2986
gmagick.setimageblueprimary.php                    30-Sep-2022 11:06                3168
gmagick.setimagebordercolor.php                    30-Sep-2022 11:06                2948
gmagick.setimagechanneldepth.php                   30-Sep-2022 11:06                3315
gmagick.setimagecolorspace.php                     30-Sep-2022 11:06                3011
gmagick.setimagecompose.php                        30-Sep-2022 11:06                2777
gmagick.setimagedelay.php                          30-Sep-2022 11:06                2791
gmagick.setimagedepth.php                          30-Sep-2022 11:06                2789
gmagick.setimagedispose.php                        30-Sep-2022 11:06                2833
gmagick.setimagefilename.php                       30-Sep-2022 11:06                2881
gmagick.setimageformat.php                         30-Sep-2022 11:06                2844
gmagick.setimagegamma.php                          30-Sep-2022 11:06                2783
gmagick.setimagegreenprimary.php                   30-Sep-2022 11:06                3176
gmagick.setimageindex.php                          30-Sep-2022 11:06                2930
gmagick.setimageinterlacescheme.php                30-Sep-2022 11:06                3077
gmagick.setimageiterations.php                     30-Sep-2022 11:06                2886
gmagick.setimageprofile.php                        30-Sep-2022 11:06                3261
gmagick.setimageredprimary.php                     30-Sep-2022 11:06                3079
gmagick.setimagerenderingintent.php                30-Sep-2022 11:06                3108
gmagick.setimageresolution.php                     30-Sep-2022 11:06                3073
gmagick.setimagescene.php                          30-Sep-2022 11:06                2779
gmagick.setimagetype.php                           30-Sep-2022 11:06                2904
gmagick.setimageunits.php                          30-Sep-2022 11:06                2963
gmagick.setimagewhitepoint.php                     30-Sep-2022 11:06                3105
gmagick.setsamplingfactors.php                     30-Sep-2022 11:06                2947
gmagick.setsize.php                                30-Sep-2022 11:06                3212
gmagick.setup.php                                  30-Sep-2022 11:06                1505
gmagick.shearimage.php                             30-Sep-2022 11:06                3848
gmagick.solarizeimage.php                          30-Sep-2022 11:06                3037
gmagick.spreadimage.php                            30-Sep-2022 11:06                2881
gmagick.stripimage.php                             30-Sep-2022 11:06                2544
gmagick.swirlimage.php                             30-Sep-2022 11:06                2962
gmagick.thumbnailimage.php                         30-Sep-2022 11:06                3577
gmagick.trimimage.php                              30-Sep-2022 11:06                3026
gmagick.write.php                                  30-Sep-2022 11:06                1698
gmagick.writeimage.php                             30-Sep-2022 11:06                3274
gmagickdraw.annotate.php                           30-Sep-2022 11:06                3001
gmagickdraw.arc.php                                30-Sep-2022 11:06                4001
gmagickdraw.bezier.php                             30-Sep-2022 11:06                2550
gmagickdraw.ellipse.php                            30-Sep-2022 11:06                3922
gmagickdraw.getfillcolor.php                       30-Sep-2022 11:06                2421
gmagickdraw.getfillopacity.php                     30-Sep-2022 11:06                2314
gmagickdraw.getfont.php                            30-Sep-2022 11:06                2352
gmagickdraw.getfontsize.php                        30-Sep-2022 11:06                2356
gmagickdraw.getfontstyle.php                       30-Sep-2022 11:06                2432
gmagickdraw.getfontweight.php                      30-Sep-2022 11:06                2277
gmagickdraw.getstrokecolor.php                     30-Sep-2022 11:06                2476
gmagickdraw.getstrokeopacity.php                   30-Sep-2022 11:06                2333
gmagickdraw.getstrokewidth.php                     30-Sep-2022 11:06                2352
gmagickdraw.gettextdecoration.php                  30-Sep-2022 11:06                2344
gmagickdraw.gettextencoding.php                    30-Sep-2022 11:06                2480
gmagickdraw.line.php                               30-Sep-2022 11:06                3393
gmagickdraw.point.php                              30-Sep-2022 11:06                2788
gmagickdraw.polygon.php                            30-Sep-2022 11:06                2617
gmagickdraw.polyline.php                           30-Sep-2022 11:06                2652
gmagickdraw.rectangle.php                          30-Sep-2022 11:06                3497
gmagickdraw.rotate.php                             30-Sep-2022 11:06                2608
gmagickdraw.roundrectangle.php                     30-Sep-2022 11:06                4166
gmagickdraw.scale.php                              30-Sep-2022 11:06                2852
gmagickdraw.setfillcolor.php                       30-Sep-2022 11:06                2907
gmagickdraw.setfillopacity.php                     30-Sep-2022 11:06                2706
gmagickdraw.setfont.php                            30-Sep-2022 11:06                2604
gmagickdraw.setfontsize.php                        30-Sep-2022 11:06                2636
gmagickdraw.setfontstyle.php                       30-Sep-2022 11:06                2767
gmagickdraw.setfontweight.php                      30-Sep-2022 11:06                2638
gmagickdraw.setstrokecolor.php                     30-Sep-2022 11:06                2931
gmagickdraw.setstrokeopacity.php                   30-Sep-2022 11:06                2724
gmagickdraw.setstrokewidth.php                     30-Sep-2022 11:06                2684
gmagickdraw.settextdecoration.php                  30-Sep-2022 11:06                2770
gmagickdraw.settextencoding.php                    30-Sep-2022 11:06                2976
gmagickpixel.construct.php                         30-Sep-2022 11:06                2488
gmagickpixel.getcolor.php                          30-Sep-2022 11:06                3718
gmagickpixel.getcolorcount.php                     30-Sep-2022 11:06                2405
gmagickpixel.getcolorvalue.php                     30-Sep-2022 11:06                2756
gmagickpixel.setcolor.php                          30-Sep-2022 11:06                2943
gmagickpixel.setcolorvalue.php                     30-Sep-2022 11:06                3170
gmp.configuration.php                              30-Sep-2022 11:06                1219
gmp.constants.php                                  30-Sep-2022 11:06                3104
gmp.examples.php                                   30-Sep-2022 11:06                3252
gmp.installation.php                               30-Sep-2022 11:06                1311
gmp.requirements.php                               30-Sep-2022 11:06                1775
gmp.serialize.php                                  30-Sep-2022 11:06                2186
gmp.setup.php                                      30-Sep-2022 11:06                1469
gmp.unserialize.php                                30-Sep-2022 11:06                2491
gnupg.configuration.php                            30-Sep-2022 11:06                1222
gnupg.constants.php                                30-Sep-2022 11:06                6356
gnupg.examples-clearsign.php                       30-Sep-2022 11:06                6721
gnupg.examples.php                                 30-Sep-2022 11:06                1344
gnupg.installation.php                             30-Sep-2022 11:06                1521
gnupg.requirements.php                             30-Sep-2022 11:06                1253
gnupg.resources.php                                30-Sep-2022 11:06                1167
gnupg.setup.php                                    30-Sep-2022 11:06                1559
hash.configuration.php                             30-Sep-2022 11:06                1217
hash.constants.php                                 30-Sep-2022 11:06                1711
hash.installation.php                              30-Sep-2022 11:06                1644
hash.requirements.php                              30-Sep-2022 11:06                1198
hash.resources.php                                 30-Sep-2022 11:06                1310
hash.setup.php                                     30-Sep-2022 11:06                1538
hashcontext.construct.php                          30-Sep-2022 11:06                1891
hashcontext.serialize.php                          30-Sep-2022 11:06                2332
hashcontext.unserialize.php                        30-Sep-2022 11:06                2618
history.php                                        30-Sep-2022 11:06                2067
history.php.books.php                              30-Sep-2022 11:06                2700
history.php.php                                    30-Sep-2022 11:06               11046
history.php.publications.php                       30-Sep-2022 11:06                1870
history.php.related.php                            30-Sep-2022 11:06                6403
hrtime-performancecounter.getfrequency.php         30-Sep-2022 11:06                2635
hrtime-performancecounter.getticks.php             30-Sep-2022 11:06                2512
hrtime-performancecounter.gettickssince.php        30-Sep-2022 11:06                2763
hrtime-stopwatch.getelapsedticks.php               30-Sep-2022 11:06                2410
hrtime-stopwatch.getelapsedtime.php                30-Sep-2022 11:06                2752
hrtime-stopwatch.getlastelapsedticks.php           30-Sep-2022 11:06                2482
hrtime-stopwatch.getlastelapsedtime.php            30-Sep-2022 11:06                2776
hrtime-stopwatch.isrunning.php                     30-Sep-2022 11:06                2372
hrtime-stopwatch.start.php                         30-Sep-2022 11:06                2335
hrtime-stopwatch.stop.php                          30-Sep-2022 11:06                2210
hrtime.example.basic.php                           30-Sep-2022 11:06                5960
hrtime.examples.php                                30-Sep-2022 11:06                1329
hrtime.installation.php                            30-Sep-2022 11:06                1925
hrtime.setup.php                                   30-Sep-2022 11:06                1355
ibase.configuration.php                            30-Sep-2022 11:06                7133
ibase.constants.php                                30-Sep-2022 11:06               18155
ibase.installation.php                             30-Sep-2022 11:06                3262
ibase.requirements.php                             30-Sep-2022 11:06                1184
ibase.resources.php                                30-Sep-2022 11:06                1167
ibase.setup.php                                    30-Sep-2022 11:06                1575
ibm-db2.configuration.php                          30-Sep-2022 11:06                9279
ibm-db2.constants.php                              30-Sep-2022 11:06                6830
ibm-db2.installation.php                           30-Sep-2022 11:06                3522
ibm-db2.requirements.php                           30-Sep-2022 11:06                3187
ibm-db2.resources.php                              30-Sep-2022 11:06                1239
ibm-db2.setup.php                                  30-Sep-2022 11:06                1587
iconv.configuration.php                            30-Sep-2022 11:06                4560
iconv.constants.php                                30-Sep-2022 11:06                3144
iconv.installation.php                             30-Sep-2022 11:06                1535
iconv.requirements.php                             30-Sep-2022 11:06                1464
iconv.resources.php                                30-Sep-2022 11:06                1167
iconv.setup.php                                    30-Sep-2022 11:06                1563
igbinary.configuration.php                         30-Sep-2022 11:06                3272
igbinary.installation.php                          30-Sep-2022 11:06                1928
igbinary.requirements.php                          30-Sep-2022 11:06                1205
igbinary.setup.php                                 30-Sep-2022 11:06                1512
image.configuration.php                            30-Sep-2022 11:06                3334
image.constants.php                                30-Sep-2022 11:06               41394
image.examples-png.php                             30-Sep-2022 11:06                5025
image.examples-watermark.php                       30-Sep-2022 11:06                6114
image.examples.merged-watermark.php                30-Sep-2022 11:06                8941
image.examples.php                                 30-Sep-2022 11:06                1578
image.installation.php                             30-Sep-2022 11:06                5706
image.requirements.php                             30-Sep-2022 11:06                4078
image.resources.php                                30-Sep-2022 11:06                2089
image.setup.php                                    30-Sep-2022 11:06                1560
imagick.adaptiveblurimage.php                      30-Sep-2022 11:06                6733
imagick.adaptiveresizeimage.php                    30-Sep-2022 11:06                8874
imagick.adaptivesharpenimage.php                   30-Sep-2022 11:06                6332
imagick.adaptivethresholdimage.php                 30-Sep-2022 11:06                6129
imagick.addimage.php                               30-Sep-2022 11:06                2776
imagick.addnoiseimage.php                          30-Sep-2022 11:06                5472
imagick.affinetransformimage.php                   30-Sep-2022 11:06                6966
imagick.animateimages.php                          30-Sep-2022 11:06                3000
imagick.annotateimage.php                          30-Sep-2022 11:06                8642
imagick.appendimages.php                           30-Sep-2022 11:06                6707
imagick.autolevelimage.php                         30-Sep-2022 11:06                4362
imagick.averageimages.php                          30-Sep-2022 11:06                2718
imagick.blackthresholdimage.php                    30-Sep-2022 11:06                5334
imagick.blueshiftimage.php                         30-Sep-2022 11:06                4431
imagick.blurimage.php                              30-Sep-2022 11:06                5535
imagick.borderimage.php                            30-Sep-2022 11:06                5996
imagick.brightnesscontrastimage.php                30-Sep-2022 11:06                5483
imagick.charcoalimage.php                          30-Sep-2022 11:06                4898
imagick.chopimage.php                              30-Sep-2022 11:06                6861
imagick.clampimage.php                             30-Sep-2022 11:06                2457
imagick.clear.php                                  30-Sep-2022 11:06                2134
imagick.clipimage.php                              30-Sep-2022 11:06                2371
imagick.clipimagepath.php                          30-Sep-2022 11:06                2949
imagick.clippathimage.php                          30-Sep-2022 11:06                3212
imagick.clone.php                                  30-Sep-2022 11:06                4246
imagick.clutimage.php                              30-Sep-2022 11:06                5958
imagick.coalesceimages.php                         30-Sep-2022 11:06                2781
imagick.colorfloodfillimage.php                    30-Sep-2022 11:06                5247
imagick.colorizeimage.php                          30-Sep-2022 11:06                6938
imagick.colormatriximage.php                       30-Sep-2022 11:06                8390
imagick.combineimages.php                          30-Sep-2022 11:06                3221
imagick.commentimage.php                           30-Sep-2022 11:06                4929
imagick.compareimagechannels.php                   30-Sep-2022 11:06                3759
imagick.compareimagelayers.php                     30-Sep-2022 11:06                5504
imagick.compareimages.php                          30-Sep-2022 11:06                5580
imagick.compositeimage.php                         30-Sep-2022 11:06                7807
imagick.configuration.php                          30-Sep-2022 11:06                4022
imagick.constants.php                              30-Sep-2022 11:06              111805
imagick.construct.php                              30-Sep-2022 11:06                2603
imagick.contrastimage.php                          30-Sep-2022 11:06                5051
imagick.contraststretchimage.php                   30-Sep-2022 11:06                3603
imagick.convolveimage.php                          30-Sep-2022 11:06                5959
imagick.count.php                                  30-Sep-2022 11:06                2577
imagick.cropimage.php                              30-Sep-2022 11:06                5957
imagick.cropthumbnailimage.php                     30-Sep-2022 11:06                3167
imagick.current.php                                30-Sep-2022 11:06                2442
imagick.cyclecolormapimage.php                     30-Sep-2022 11:06                2801
imagick.decipherimage.php                          30-Sep-2022 11:06                3092
imagick.deconstructimages.php                      30-Sep-2022 11:06                2597
imagick.deleteimageartifact.php                    30-Sep-2022 11:06                3505
imagick.deleteimageproperty.php                    30-Sep-2022 11:06                2443
imagick.deskewimage.php                            30-Sep-2022 11:06               11663
imagick.despeckleimage.php                         30-Sep-2022 11:06                4246
imagick.destroy.php                                30-Sep-2022 11:06                2272
imagick.displayimage.php                           30-Sep-2022 11:06                2600
imagick.displayimages.php                          30-Sep-2022 11:06                2644
imagick.distortimage.php                           30-Sep-2022 11:06               12915
imagick.drawimage.php                              30-Sep-2022 11:06                2505
imagick.edgeimage.php                              30-Sep-2022 11:06                4610
imagick.embossimage.php                            30-Sep-2022 11:06                5263
imagick.encipherimage.php                          30-Sep-2022 11:06                3088
imagick.enhanceimage.php                           30-Sep-2022 11:06                4213
imagick.equalizeimage.php                          30-Sep-2022 11:06                4180
imagick.evaluateimage.php                          30-Sep-2022 11:06                5741
imagick.examples-1.php                             30-Sep-2022 11:06               32597
imagick.examples.php                               30-Sep-2022 11:06                1346
imagick.exportimagepixels.php                      30-Sep-2022 11:06                7677
imagick.extentimage.php                            30-Sep-2022 11:06                4958
imagick.filter.php                                 30-Sep-2022 11:06                7908
imagick.flattenimages.php                          30-Sep-2022 11:06                2772
imagick.flipimage.php                              30-Sep-2022 11:06                4526
imagick.floodfillpaintimage.php                    30-Sep-2022 11:06               11677
imagick.flopimage.php                              30-Sep-2022 11:06                4558
imagick.forwardfouriertransformimage.php           30-Sep-2022 11:06               12984
imagick.frameimage.php                             30-Sep-2022 11:06                8480
imagick.functionimage.php                          30-Sep-2022 11:06               13741
imagick.fximage.php                                30-Sep-2022 11:06                6091
imagick.gammaimage.php                             30-Sep-2022 11:06                5605
imagick.gaussianblurimage.php                      30-Sep-2022 11:06                6097
imagick.getcolorspace.php                          30-Sep-2022 11:06                2382
imagick.getcompression.php                         30-Sep-2022 11:06                2199
imagick.getcompressionquality.php                  30-Sep-2022 11:06                2273
imagick.getcopyright.php                           30-Sep-2022 11:06                2300
imagick.getfilename.php                            30-Sep-2022 11:06                2359
imagick.getfont.php                                30-Sep-2022 11:06                3003
imagick.getformat.php                              30-Sep-2022 11:06                2321
imagick.getgravity.php                             30-Sep-2022 11:06                2361
imagick.gethomeurl.php                             30-Sep-2022 11:06                2177
imagick.getimage.php                               30-Sep-2022 11:06                2423
imagick.getimagealphachannel.php                   30-Sep-2022 11:06                3294
imagick.getimageartifact.php                       30-Sep-2022 11:06                3454
imagick.getimageattribute.php                      30-Sep-2022 11:06                2700
imagick.getimagebackgroundcolor.php                30-Sep-2022 11:06                2589
imagick.getimageblob.php                           30-Sep-2022 11:06                2615
imagick.getimageblueprimary.php                    30-Sep-2022 11:06                2817
imagick.getimagebordercolor.php                    30-Sep-2022 11:06                2546
imagick.getimagechanneldepth.php                   30-Sep-2022 11:06                3017
imagick.getimagechanneldistortion.php              30-Sep-2022 11:06                3843
imagick.getimagechanneldistortions.php             30-Sep-2022 11:06                4237
imagick.getimagechannelextrema.php                 30-Sep-2022 11:06                3470
imagick.getimagechannelkurtosis.php                30-Sep-2022 11:06                3480
imagick.getimagechannelmean.php                    30-Sep-2022 11:06                3121
imagick.getimagechannelrange.php                   30-Sep-2022 11:06                3333
imagick.getimagechannelstatistics.php              30-Sep-2022 11:06                2478
imagick.getimageclipmask.php                       30-Sep-2022 11:06                2979
imagick.getimagecolormapcolor.php                  30-Sep-2022 11:06                2828
imagick.getimagecolors.php                         30-Sep-2022 11:06                2285
imagick.getimagecolorspace.php                     30-Sep-2022 11:06                2326
imagick.getimagecompose.php                        30-Sep-2022 11:06                2284
imagick.getimagecompression.php                    30-Sep-2022 11:06                2287
imagick.getimagecompressionquality.php             30-Sep-2022 11:06                2381
imagick.getimagedelay.php                          30-Sep-2022 11:06                2354
imagick.getimagedepth.php                          30-Sep-2022 11:06                2132
imagick.getimagedispose.php                        30-Sep-2022 11:06                2394
imagick.getimagedistortion.php                     30-Sep-2022 11:06                3167
imagick.getimageextrema.php                        30-Sep-2022 11:06                2823
imagick.getimagefilename.php                       30-Sep-2022 11:06                2466
imagick.getimageformat.php                         30-Sep-2022 11:06                2448
imagick.getimagegamma.php                          30-Sep-2022 11:06                2349
imagick.getimagegeometry.php                       30-Sep-2022 11:06                4102
imagick.getimagegravity.php                        30-Sep-2022 11:06                2654
imagick.getimagegreenprimary.php                   30-Sep-2022 11:06                2619
imagick.getimageheight.php                         30-Sep-2022 11:06                2380
imagick.getimagehistogram.php                      30-Sep-2022 11:06               19713
imagick.getimageindex.php                          30-Sep-2022 11:06                2930
imagick.getimageinterlacescheme.php                30-Sep-2022 11:06                2433
imagick.getimageinterpolatemethod.php              30-Sep-2022 11:06                2653
imagick.getimageiterations.php                     30-Sep-2022 11:06                2442
imagick.getimagelength.php                         30-Sep-2022 11:06                3355
imagick.getimagematte.php                          30-Sep-2022 11:06                2680
imagick.getimagemattecolor.php                     30-Sep-2022 11:06                2796
imagick.getimagemimetype.php                       30-Sep-2022 11:06                2179
imagick.getimageorientation.php                    30-Sep-2022 11:06                2546
imagick.getimagepage.php                           30-Sep-2022 11:06                2611
imagick.getimagepixelcolor.php                     30-Sep-2022 11:06                3025
imagick.getimageprofile.php                        30-Sep-2022 11:06                2661
imagick.getimageprofiles.php                       30-Sep-2022 11:06                3217
imagick.getimageproperties.php                     30-Sep-2022 11:06                5648
imagick.getimageproperty.php                       30-Sep-2022 11:06                4882
imagick.getimageredprimary.php                     30-Sep-2022 11:06                2696
imagick.getimageregion.php                         30-Sep-2022 11:06                3717
imagick.getimagerenderingintent.php                30-Sep-2022 11:06                2570
imagick.getimageresolution.php                     30-Sep-2022 11:06                2446
imagick.getimagesblob.php                          30-Sep-2022 11:06                2455
imagick.getimagescene.php                          30-Sep-2022 11:06                2336
imagick.getimagesignature.php                      30-Sep-2022 11:06                2463
imagick.getimagesize.php                           30-Sep-2022 11:06                2606
imagick.getimagetickspersecond.php                 30-Sep-2022 11:06                2482
imagick.getimagetotalinkdensity.php                30-Sep-2022 11:06                2419
imagick.getimagetype.php                           30-Sep-2022 11:06                3972
imagick.getimageunits.php                          30-Sep-2022 11:06                2398
imagick.getimagevirtualpixelmethod.php             30-Sep-2022 11:06                2549
imagick.getimagewhitepoint.php                     30-Sep-2022 11:06                2599
imagick.getimagewidth.php                          30-Sep-2022 11:06                2354
imagick.getinterlacescheme.php                     30-Sep-2022 11:06                2500
imagick.getiteratorindex.php                       30-Sep-2022 11:06                6138
imagick.getnumberimages.php                        30-Sep-2022 11:06                2449
imagick.getoption.php                              30-Sep-2022 11:06                2635
imagick.getpackagename.php                         30-Sep-2022 11:06                2420
imagick.getpage.php                                30-Sep-2022 11:06                2433
imagick.getpixeliterator.php                       30-Sep-2022 11:06                6807
imagick.getpixelregioniterator.php                 30-Sep-2022 11:06                6759
imagick.getpointsize.php                           30-Sep-2022 11:06                2711
imagick.getquantum.php                             30-Sep-2022 11:06                2146
imagick.getquantumdepth.php                        30-Sep-2022 11:06                2533
imagick.getquantumrange.php                        30-Sep-2022 11:06                2677
imagick.getregistry.php                            30-Sep-2022 11:06                2367
imagick.getreleasedate.php                         30-Sep-2022 11:06                2444
imagick.getresource.php                            30-Sep-2022 11:06                2796
imagick.getresourcelimit.php                       30-Sep-2022 11:06                3226
imagick.getsamplingfactors.php                     30-Sep-2022 11:06                2510
imagick.getsize.php                                30-Sep-2022 11:06                5852
imagick.getsizeoffset.php                          30-Sep-2022 11:06                2504
imagick.getversion.php                             30-Sep-2022 11:06                2432
imagick.haldclutimage.php                          30-Sep-2022 11:06                6087
imagick.hasnextimage.php                           30-Sep-2022 11:06                2420
imagick.haspreviousimage.php                       30-Sep-2022 11:06                2458
imagick.identifyformat.php                         30-Sep-2022 11:06                4506
imagick.identifyimage.php                          30-Sep-2022 11:06                3836
imagick.implodeimage.php                           30-Sep-2022 11:06                4595
imagick.importimagepixels.php                      30-Sep-2022 11:06               11703
imagick.installation.php                           30-Sep-2022 11:06                2945
imagick.inversefouriertransformimage.php           30-Sep-2022 11:06                3281
imagick.labelimage.php                             30-Sep-2022 11:06                2401
imagick.levelimage.php                             30-Sep-2022 11:06                7683
imagick.linearstretchimage.php                     30-Sep-2022 11:06                5641
imagick.liquidrescaleimage.php                     30-Sep-2022 11:06                4191
imagick.listregistry.php                           30-Sep-2022 11:06                2265
imagick.magnifyimage.php                           30-Sep-2022 11:06                4212
imagick.mapimage.php                               30-Sep-2022 11:06                3079
imagick.mattefloodfillimage.php                    30-Sep-2022 11:06                5485
imagick.medianfilterimage.php                      30-Sep-2022 11:06                5103
imagick.mergeimagelayers.php                       30-Sep-2022 11:06                6618
imagick.minifyimage.php                            30-Sep-2022 11:06                2252
imagick.modulateimage.php                          30-Sep-2022 11:06                5485
imagick.montageimage.php                           30-Sep-2022 11:06                4326
imagick.morphimages.php                            30-Sep-2022 11:06                2731
imagick.morphology.php                             30-Sep-2022 11:06               75811
imagick.mosaicimages.php                           30-Sep-2022 11:06                2675
imagick.motionblurimage.php                        30-Sep-2022 11:06                6612
imagick.negateimage.php                            30-Sep-2022 11:06                5454
imagick.newimage.php                               30-Sep-2022 11:06                6080
imagick.newpseudoimage.php                         30-Sep-2022 11:06                5687
imagick.nextimage.php                              30-Sep-2022 11:06                2184
imagick.normalizeimage.php                         30-Sep-2022 11:06                6461
imagick.oilpaintimage.php                          30-Sep-2022 11:06                4551
imagick.opaquepaintimage.php                       30-Sep-2022 11:06                4773
imagick.optimizeimagelayers.php                    30-Sep-2022 11:06                5340
imagick.orderedposterizeimage.php                  30-Sep-2022 11:06                6814
imagick.paintfloodfillimage.php                    30-Sep-2022 11:06                5520
imagick.paintopaqueimage.php                       30-Sep-2022 11:06                5249
imagick.painttransparentimage.php                  30-Sep-2022 11:06                4469
imagick.pingimage.php                              30-Sep-2022 11:06                2551
imagick.pingimageblob.php                          30-Sep-2022 11:06                6038
imagick.pingimagefile.php                          30-Sep-2022 11:06                5750
imagick.polaroidimage.php                          30-Sep-2022 11:06                4686
imagick.posterizeimage.php                         30-Sep-2022 11:06                5569
imagick.previewimages.php                          30-Sep-2022 11:06                2924
imagick.previousimage.php                          30-Sep-2022 11:06                2239
imagick.profileimage.php                           30-Sep-2022 11:06                3013
imagick.quantizeimage.php                          30-Sep-2022 11:06                6476
imagick.quantizeimages.php                         30-Sep-2022 11:06                3623
imagick.queryfontmetrics.php                       30-Sep-2022 11:06                5556
imagick.queryfonts.php                             30-Sep-2022 11:06                4998
imagick.queryformats.php                           30-Sep-2022 11:06                8223
imagick.radialblurimage.php                        30-Sep-2022 11:06                5534
imagick.raiseimage.php                             30-Sep-2022 11:06                6331
imagick.randomthresholdimage.php                   30-Sep-2022 11:06                6451
imagick.readimage.php                              30-Sep-2022 11:06                2365
imagick.readimageblob.php                          30-Sep-2022 11:06                5416
imagick.readimagefile.php                          30-Sep-2022 11:06                2897
imagick.readimages.php                             30-Sep-2022 11:06                2387
imagick.recolorimage.php                           30-Sep-2022 11:06                6647
imagick.reducenoiseimage.php                       30-Sep-2022 11:06                5153
imagick.remapimage.php                             30-Sep-2022 11:06                3269
imagick.removeimage.php                            30-Sep-2022 11:06                2377
imagick.removeimageprofile.php                     30-Sep-2022 11:06                2656
imagick.render.php                                 30-Sep-2022 11:06                2147
imagick.requirements.php                           30-Sep-2022 11:06                1527
imagick.resampleimage.php                          30-Sep-2022 11:06                5425
imagick.resetimagepage.php                         30-Sep-2022 11:06                2629
imagick.resizeimage.php                            30-Sep-2022 11:06               11871
imagick.resources.php                              30-Sep-2022 11:06                1181
imagick.rollimage.php                              30-Sep-2022 11:06                4705
imagick.rotateimage.php                            30-Sep-2022 11:06                5680
imagick.rotationalblurimage.php                    30-Sep-2022 11:06                5653
imagick.roundcorners.php                           30-Sep-2022 11:06                6397
imagick.sampleimage.php                            30-Sep-2022 11:06                2736
imagick.scaleimage.php                             30-Sep-2022 11:06                6718
imagick.segmentimage.php                           30-Sep-2022 11:06                6599
imagick.selectiveblurimage.php                     30-Sep-2022 11:06                6375
imagick.separateimagechannel.php                   30-Sep-2022 11:06                5340
imagick.sepiatoneimage.php                         30-Sep-2022 11:06                4831
imagick.setbackgroundcolor.php                     30-Sep-2022 11:06                3169
imagick.setcolorspace.php                          30-Sep-2022 11:06                2822
imagick.setcompression.php                         30-Sep-2022 11:06                2584
imagick.setcompressionquality.php                  30-Sep-2022 11:06                7299
imagick.setfilename.php                            30-Sep-2022 11:06                2452
imagick.setfirstiterator.php                       30-Sep-2022 11:06                2233
imagick.setfont.php                                30-Sep-2022 11:06                5535
imagick.setformat.php                              30-Sep-2022 11:06                2354
imagick.setgravity.php                             30-Sep-2022 11:06                2617
imagick.setimage.php                               30-Sep-2022 11:06                4690
imagick.setimagealphachannel.php                   30-Sep-2022 11:06                3514
imagick.setimageartifact.php                       30-Sep-2022 11:06                7374
imagick.setimageattribute.php                      30-Sep-2022 11:06                3096
imagick.setimagebackgroundcolor.php                30-Sep-2022 11:06                3400
imagick.setimagebias.php                           30-Sep-2022 11:06                7031
imagick.setimagebiasquantum.php                    30-Sep-2022 11:06                2852
imagick.setimageblueprimary.php                    30-Sep-2022 11:06                2917
imagick.setimagebordercolor.php                    30-Sep-2022 11:06                3378
imagick.setimagechanneldepth.php                   30-Sep-2022 11:06                2934
imagick.setimageclipmask.php                       30-Sep-2022 11:06                9407
imagick.setimagecolormapcolor.php                  30-Sep-2022 11:06                3015
imagick.setimagecolorspace.php                     30-Sep-2022 11:06                3032
imagick.setimagecompose.php                        30-Sep-2022 11:06                2751
imagick.setimagecompression.php                    30-Sep-2022 11:06                2723
imagick.setimagecompressionquality.php             30-Sep-2022 11:06                4823
imagick.setimagedelay.php                          30-Sep-2022 11:06                6284
imagick.setimagedepth.php                          30-Sep-2022 11:06                2569
imagick.setimagedispose.php                        30-Sep-2022 11:06                2613
imagick.setimageextent.php                         30-Sep-2022 11:06                2834
imagick.setimagefilename.php                       30-Sep-2022 11:06                2663
imagick.setimageformat.php                         30-Sep-2022 11:06                2553
imagick.setimagegamma.php                          30-Sep-2022 11:06                2573
imagick.setimagegravity.php                        30-Sep-2022 11:06                2782
imagick.setimagegreenprimary.php                   30-Sep-2022 11:06                2910
imagick.setimageindex.php                          30-Sep-2022 11:06                3196
imagick.setimageinterlacescheme.php                30-Sep-2022 11:06                2733
imagick.setimageinterpolatemethod.php              30-Sep-2022 11:06                2658
imagick.setimageiterations.php                     30-Sep-2022 11:06                4870
imagick.setimagematte.php                          30-Sep-2022 11:06                2588
imagick.setimagemattecolor.php                     30-Sep-2022 11:06                3616
imagick.setimageopacity.php                        30-Sep-2022 11:06                4975
imagick.setimageorientation.php                    30-Sep-2022 11:06                4680
imagick.setimagepage.php                           30-Sep-2022 11:06                3365
imagick.setimageprofile.php                        30-Sep-2022 11:06                3049
imagick.setimageproperty.php                       30-Sep-2022 11:06                4994
imagick.setimageredprimary.php                     30-Sep-2022 11:06                2906
imagick.setimagerenderingintent.php                30-Sep-2022 11:06                2739
imagick.setimageresolution.php                     30-Sep-2022 11:06                4910
imagick.setimagescene.php                          30-Sep-2022 11:06                2593
imagick.setimagetickspersecond.php                 30-Sep-2022 11:06                8276
imagick.setimagetype.php                           30-Sep-2022 11:06                2389
imagick.setimageunits.php                          30-Sep-2022 11:06                2425
imagick.setimagevirtualpixelmethod.php             30-Sep-2022 11:06                2545
imagick.setimagewhitepoint.php                     30-Sep-2022 11:06                2904
imagick.setinterlacescheme.php                     30-Sep-2022 11:06                2473
imagick.setiteratorindex.php                       30-Sep-2022 11:06                6189
imagick.setlastiterator.php                        30-Sep-2022 11:06                2247
imagick.setoption.php                              30-Sep-2022 11:06               12883
imagick.setpage.php                                30-Sep-2022 11:06                3116
imagick.setpointsize.php                           30-Sep-2022 11:06                5235
imagick.setprogressmonitor.php                     30-Sep-2022 11:06               12729
imagick.setregistry.php                            30-Sep-2022 11:06                2770
imagick.setresolution.php                          30-Sep-2022 11:06                3550
imagick.setresourcelimit.php                       30-Sep-2022 11:06                3449
imagick.setsamplingfactors.php                     30-Sep-2022 11:06                7114
imagick.setsize.php                                30-Sep-2022 11:06                2650
imagick.setsizeoffset.php                          30-Sep-2022 11:06                3117
imagick.settype.php                                30-Sep-2022 11:06                2335
imagick.setup.php                                  30-Sep-2022 11:06                1582
imagick.shadeimage.php                             30-Sep-2022 11:06                5498
imagick.shadowimage.php                            30-Sep-2022 11:06                5236
imagick.sharpenimage.php                           30-Sep-2022 11:06                5470
imagick.shaveimage.php                             30-Sep-2022 11:06                4637
imagick.shearimage.php                             30-Sep-2022 11:06                6416
imagick.sigmoidalcontrastimage.php                 30-Sep-2022 11:06                7785
imagick.sketchimage.php                            30-Sep-2022 11:06                5716
imagick.smushimages.php                            30-Sep-2022 11:06                5805
imagick.solarizeimage.php                          30-Sep-2022 11:06                4804
imagick.sparsecolorimage.php                       30-Sep-2022 11:06               31350
imagick.spliceimage.php                            30-Sep-2022 11:06                5624
imagick.spreadimage.php                            30-Sep-2022 11:06                4606
imagick.statisticimage.php                         30-Sep-2022 11:06                6700
imagick.steganoimage.php                           30-Sep-2022 11:06                2919
imagick.stereoimage.php                            30-Sep-2022 11:06                2702
imagick.stripimage.php                             30-Sep-2022 11:06                2374
imagick.subimagematch.php                          30-Sep-2022 11:06                7651
imagick.swirlimage.php                             30-Sep-2022 11:06                4658
imagick.textureimage.php                           30-Sep-2022 11:06                6380
imagick.thresholdimage.php                         30-Sep-2022 11:06                5176
imagick.thumbnailimage.php                         30-Sep-2022 11:06                7164
imagick.tintimage.php                              30-Sep-2022 11:06                7977
imagick.tostring.php                               30-Sep-2022 11:06                2883
imagick.transformimage.php                         30-Sep-2022 11:06                6019
imagick.transformimagecolorspace.php               30-Sep-2022 11:06                5798
imagick.transparentpaintimage.php                  30-Sep-2022 11:06                7354
imagick.transposeimage.php                         30-Sep-2022 11:06                4611
imagick.transverseimage.php                        30-Sep-2022 11:06                4599
imagick.trimimage.php                              30-Sep-2022 11:06                5713
imagick.uniqueimagecolors.php                      30-Sep-2022 11:06                5655
imagick.unsharpmaskimage.php                       30-Sep-2022 11:06                6462
imagick.valid.php                                  30-Sep-2022 11:06                2127
imagick.vignetteimage.php                          30-Sep-2022 11:06                6451
imagick.waveimage.php                              30-Sep-2022 11:06                6307
imagick.whitethresholdimage.php                    30-Sep-2022 11:06                5246
imagick.writeimage.php                             30-Sep-2022 11:06                2832
imagick.writeimagefile.php                         30-Sep-2022 11:06                3541
imagick.writeimages.php                            30-Sep-2022 11:06                2631
imagick.writeimagesfile.php                        30-Sep-2022 11:06                3591
imagickdraw.affine.php                             30-Sep-2022 11:06               18720
imagickdraw.annotation.php                         30-Sep-2022 11:06                3101
imagickdraw.arc.php                                30-Sep-2022 11:06                9902
imagickdraw.bezier.php                             30-Sep-2022 11:06               19640
imagickdraw.circle.php                             30-Sep-2022 11:06                9265
imagickdraw.clear.php                              30-Sep-2022 11:06                2277
imagickdraw.clone.php                              30-Sep-2022 11:06                2429
imagickdraw.color.php                              30-Sep-2022 11:06                3263
imagickdraw.comment.php                            30-Sep-2022 11:06                2595
imagickdraw.composite.php                          30-Sep-2022 11:06               12275
imagickdraw.construct.php                          30-Sep-2022 11:06                2219
imagickdraw.destroy.php                            30-Sep-2022 11:06                2261
imagickdraw.ellipse.php                            30-Sep-2022 11:06               12498
imagickdraw.getclippath.php                        30-Sep-2022 11:06                2244
imagickdraw.getcliprule.php                        30-Sep-2022 11:06                2367
imagickdraw.getclipunits.php                       30-Sep-2022 11:06                2285
imagickdraw.getfillcolor.php                       30-Sep-2022 11:06                2382
imagickdraw.getfillopacity.php                     30-Sep-2022 11:06                2280
imagickdraw.getfillrule.php                        30-Sep-2022 11:06                2329
imagickdraw.getfont.php                            30-Sep-2022 11:06                2211
imagickdraw.getfontfamily.php                      30-Sep-2022 11:06                2271
imagickdraw.getfontsize.php                        30-Sep-2022 11:06                2349
imagickdraw.getfontstretch.php                     30-Sep-2022 11:06                2249
imagickdraw.getfontstyle.php                       30-Sep-2022 11:06                2492
imagickdraw.getfontweight.php                      30-Sep-2022 11:06                2305
imagickdraw.getgravity.php                         30-Sep-2022 11:06                2401
imagickdraw.getstrokeantialias.php                 30-Sep-2022 11:06                2565
imagickdraw.getstrokecolor.php                     30-Sep-2022 11:06                2781
imagickdraw.getstrokedasharray.php                 30-Sep-2022 11:06                2407
imagickdraw.getstrokedashoffset.php                30-Sep-2022 11:06                2381
imagickdraw.getstrokelinecap.php                   30-Sep-2022 11:06                2522
imagickdraw.getstrokelinejoin.php                  30-Sep-2022 11:06                2551
imagickdraw.getstrokemiterlimit.php                30-Sep-2022 11:06                2643
imagickdraw.getstrokeopacity.php                   30-Sep-2022 11:06                2326
imagickdraw.getstrokewidth.php                     30-Sep-2022 11:06                2335
imagickdraw.gettextalignment.php                   30-Sep-2022 11:06                2413
imagickdraw.gettextantialias.php                   30-Sep-2022 11:06                2446
imagickdraw.gettextdecoration.php                  30-Sep-2022 11:06                2450
imagickdraw.gettextencoding.php                    30-Sep-2022 11:06                2373
imagickdraw.gettextinterlinespacing.php            30-Sep-2022 11:06                2309
imagickdraw.gettextinterwordspacing.php            30-Sep-2022 11:06                2333
imagickdraw.gettextkerning.php                     30-Sep-2022 11:06                2238
imagickdraw.gettextundercolor.php                  30-Sep-2022 11:06                2481
imagickdraw.getvectorgraphics.php                  30-Sep-2022 11:06                2471
imagickdraw.line.php                               30-Sep-2022 11:06                8439
imagickdraw.matte.php                              30-Sep-2022 11:06                8439
imagickdraw.pathclose.php                          30-Sep-2022 11:06                2384
imagickdraw.pathcurvetoabsolute.php                30-Sep-2022 11:06                4525
imagickdraw.pathcurvetoquadraticbezierabsolute.php 30-Sep-2022 11:06               12254
imagickdraw.pathcurvetoquadraticbezierrelative.php 30-Sep-2022 11:06                4014
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 30-Sep-2022 11:06               10820
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 30-Sep-2022 11:06               10973
imagickdraw.pathcurvetorelative.php                30-Sep-2022 11:06                4541
imagickdraw.pathcurvetosmoothabsolute.php          30-Sep-2022 11:06                4386
imagickdraw.pathcurvetosmoothrelative.php          30-Sep-2022 11:06                4393
imagickdraw.pathellipticarcabsolute.php            30-Sep-2022 11:06                5191
imagickdraw.pathellipticarcrelative.php            30-Sep-2022 11:06                5161
imagickdraw.pathfinish.php                         30-Sep-2022 11:06                2217
imagickdraw.pathlinetoabsolute.php                 30-Sep-2022 11:06                3047
imagickdraw.pathlinetohorizontalabsolute.php       30-Sep-2022 11:06                2951
imagickdraw.pathlinetohorizontalrelative.php       30-Sep-2022 11:06                2946
imagickdraw.pathlinetorelative.php                 30-Sep-2022 11:06                3097
imagickdraw.pathlinetoverticalabsolute.php         30-Sep-2022 11:06                2915
imagickdraw.pathlinetoverticalrelative.php         30-Sep-2022 11:06                2920
imagickdraw.pathmovetoabsolute.php                 30-Sep-2022 11:06                3094
imagickdraw.pathmovetorelative.php                 30-Sep-2022 11:06                3030
imagickdraw.pathstart.php                          30-Sep-2022 11:06               12484
imagickdraw.point.php                              30-Sep-2022 11:06                7081
imagickdraw.polygon.php                            30-Sep-2022 11:06                9503
imagickdraw.polyline.php                           30-Sep-2022 11:06                9497
imagickdraw.pop.php                                30-Sep-2022 11:06                2532
imagickdraw.popclippath.php                        30-Sep-2022 11:06                2176
imagickdraw.popdefs.php                            30-Sep-2022 11:06                8114
imagickdraw.poppattern.php                         30-Sep-2022 11:06                2265
imagickdraw.push.php                               30-Sep-2022 11:06                8748
imagickdraw.pushclippath.php                       30-Sep-2022 11:06                2822
imagickdraw.pushdefs.php                           30-Sep-2022 11:06                2475
imagickdraw.pushpattern.php                        30-Sep-2022 11:06               15237
imagickdraw.rectangle.php                          30-Sep-2022 11:06                8680
imagickdraw.render.php                             30-Sep-2022 11:06                2307
imagickdraw.resetvectorgraphics.php                30-Sep-2022 11:06                2270
imagickdraw.rotate.php                             30-Sep-2022 11:06                8027
imagickdraw.roundrectangle.php                     30-Sep-2022 11:06                9392
imagickdraw.scale.php                              30-Sep-2022 11:06                8324
imagickdraw.setclippath.php                        30-Sep-2022 11:06                8767
imagickdraw.setcliprule.php                        30-Sep-2022 11:06                9875
imagickdraw.setclipunits.php                       30-Sep-2022 11:06                9217
imagickdraw.setfillalpha.php                       30-Sep-2022 11:06                8043
imagickdraw.setfillcolor.php                       30-Sep-2022 11:06                8113
imagickdraw.setfillopacity.php                     30-Sep-2022 11:06                8101
imagickdraw.setfillpatternurl.php                  30-Sep-2022 11:06                3048
imagickdraw.setfillrule.php                        30-Sep-2022 11:06               14822
imagickdraw.setfont.php                            30-Sep-2022 11:06                9616
imagickdraw.setfontfamily.php                      30-Sep-2022 11:06               10318
imagickdraw.setfontsize.php                        30-Sep-2022 11:06                8704
imagickdraw.setfontstretch.php                     30-Sep-2022 11:06               10536
imagickdraw.setfontstyle.php                       30-Sep-2022 11:06                9341
imagickdraw.setfontweight.php                      30-Sep-2022 11:06                9532
imagickdraw.setgravity.php                         30-Sep-2022 11:06               11443
imagickdraw.setresolution.php                      30-Sep-2022 11:06                2651
imagickdraw.setstrokealpha.php                     30-Sep-2022 11:06                8753
imagickdraw.setstrokeantialias.php                 30-Sep-2022 11:06                9311
imagickdraw.setstrokecolor.php                     30-Sep-2022 11:06                8870
imagickdraw.setstrokedasharray.php                 30-Sep-2022 11:06               13963
imagickdraw.setstrokedashoffset.php                30-Sep-2022 11:06               10384
imagickdraw.setstrokelinecap.php                   30-Sep-2022 11:06                9035
imagickdraw.setstrokelinejoin.php                  30-Sep-2022 11:06               12616
imagickdraw.setstrokemiterlimit.php                30-Sep-2022 11:06               12208
imagickdraw.setstrokeopacity.php                   30-Sep-2022 11:06               10679
imagickdraw.setstrokepatternurl.php                30-Sep-2022 11:06                2781
imagickdraw.setstrokewidth.php                     30-Sep-2022 11:06                8784
imagickdraw.settextalignment.php                   30-Sep-2022 11:06                9825
imagickdraw.settextantialias.php                   30-Sep-2022 11:06                9288
imagickdraw.settextdecoration.php                  30-Sep-2022 11:06                7721
imagickdraw.settextencoding.php                    30-Sep-2022 11:06                3029
imagickdraw.settextinterlinespacing.php            30-Sep-2022 11:06                2738
imagickdraw.settextinterwordspacing.php            30-Sep-2022 11:06                2557
imagickdraw.settextkerning.php                     30-Sep-2022 11:06                2657
imagickdraw.settextundercolor.php                  30-Sep-2022 11:06                8130
imagickdraw.setvectorgraphics.php                  30-Sep-2022 11:06                9522
imagickdraw.setviewbox.php                         30-Sep-2022 11:06               10920
imagickdraw.skewx.php                              30-Sep-2022 11:06                8538
imagickdraw.skewy.php                              30-Sep-2022 11:06                8527
imagickdraw.translate.php                          30-Sep-2022 11:06                8821
imagickkernel.addkernel.php                        30-Sep-2022 11:06                7622
imagickkernel.addunitykernel.php                   30-Sep-2022 11:06               15977
imagickkernel.frombuiltin.php                      30-Sep-2022 11:06               29676
imagickkernel.frommatrix.php                       30-Sep-2022 11:06               26048
imagickkernel.getmatrix.php                        30-Sep-2022 11:06                8220
imagickkernel.scale.php                            30-Sep-2022 11:06               15177
imagickkernel.separate.php                         30-Sep-2022 11:06               11752
imagickpixel.clear.php                             30-Sep-2022 11:06                2257
imagickpixel.construct.php                         30-Sep-2022 11:06               13843
imagickpixel.destroy.php                           30-Sep-2022 11:06                2346
imagickpixel.getcolor.php                          30-Sep-2022 11:06                7661
imagickpixel.getcolorasstring.php                  30-Sep-2022 11:06                4857
imagickpixel.getcolorcount.php                     30-Sep-2022 11:06                4993
imagickpixel.getcolorquantum.php                   30-Sep-2022 11:06                2774
imagickpixel.getcolorvalue.php                     30-Sep-2022 11:06                8732
imagickpixel.getcolorvaluequantum.php              30-Sep-2022 11:06                6559
imagickpixel.gethsl.php                            30-Sep-2022 11:06                4322
imagickpixel.getindex.php                          30-Sep-2022 11:06                2165
imagickpixel.ispixelsimilar.php                    30-Sep-2022 11:06                3438
imagickpixel.ispixelsimilarquantum.php             30-Sep-2022 11:06                2974
imagickpixel.issimilar.php                         30-Sep-2022 11:06               22829
imagickpixel.setcolor.php                          30-Sep-2022 11:06                7679
imagickpixel.setcolorcount.php                     30-Sep-2022 11:06                2450
imagickpixel.setcolorvalue.php                     30-Sep-2022 11:06                4950
imagickpixel.setcolorvaluequantum.php              30-Sep-2022 11:06                8536
imagickpixel.sethsl.php                            30-Sep-2022 11:06                7503
imagickpixel.setindex.php                          30-Sep-2022 11:06                2385
imagickpixeliterator.clear.php                     30-Sep-2022 11:06                7203
imagickpixeliterator.construct.php                 30-Sep-2022 11:06                6920
imagickpixeliterator.destroy.php                   30-Sep-2022 11:06                2387
imagickpixeliterator.getcurrentiteratorrow.php     30-Sep-2022 11:06                2546
imagickpixeliterator.getiteratorrow.php            30-Sep-2022 11:06                2471
imagickpixeliterator.getnextiteratorrow.php        30-Sep-2022 11:06                8011
imagickpixeliterator.getpreviousiteratorrow.php    30-Sep-2022 11:06                2615
imagickpixeliterator.newpixeliterator.php          30-Sep-2022 11:06                2640
imagickpixeliterator.newpixelregioniterator.php    30-Sep-2022 11:06                4001
imagickpixeliterator.resetiterator.php             30-Sep-2022 11:06               10496
imagickpixeliterator.setiteratorfirstrow.php       30-Sep-2022 11:06                2481
imagickpixeliterator.setiteratorlastrow.php        30-Sep-2022 11:06                2474
imagickpixeliterator.setiteratorrow.php            30-Sep-2022 11:06                7885
imagickpixeliterator.synciterator.php              30-Sep-2022 11:06                2329
imap.configuration.php                             30-Sep-2022 11:06                3158
imap.constants.php                                 30-Sep-2022 11:06               17713
imap.installation.php                              30-Sep-2022 11:06                2712
imap.requirements.php                              30-Sep-2022 11:06                3109
imap.resources.php                                 30-Sep-2022 11:06                1389
imap.setup.php                                     30-Sep-2022 11:06                1551
index.php                                          30-Sep-2022 11:06               14527
indexes.examples.php                               30-Sep-2022 11:06              708698
indexes.functions.php                              30-Sep-2022 11:06             1147435
indexes.php                                        30-Sep-2022 11:06                1467
infiniteiterator.construct.php                     30-Sep-2022 11:06                5152
infiniteiterator.next.php                          30-Sep-2022 11:06                3267
info.configuration.php                             30-Sep-2022 11:06               19238
info.constants.php                                 30-Sep-2022 11:06               16187
info.installation.php                              30-Sep-2022 11:06                1201
info.requirements.php                              30-Sep-2022 11:06                1177
info.resources.php                                 30-Sep-2022 11:06                1160
info.setup.php                                     30-Sep-2022 11:06                1551
ini.core.php                                       30-Sep-2022 11:06               69770
ini.list.php                                       30-Sep-2022 11:06               87787
ini.php                                            30-Sep-2022 11:06                1547
ini.sections.php                                   30-Sep-2022 11:06                4064
inotify.configuration.php                          30-Sep-2022 11:06                1247
inotify.constants.php                              30-Sep-2022 11:06                7808
inotify.install.php                                30-Sep-2022 11:06                1706
inotify.requirements.php                           30-Sep-2022 11:06                1201
inotify.resources.php                              30-Sep-2022 11:06                1296
inotify.setup.php                                  30-Sep-2022 11:06                1586
install.cloud.azure.php                            30-Sep-2022 11:06                4257
install.cloud.ec2.php                              30-Sep-2022 11:06                1402
install.cloud.php                                  30-Sep-2022 11:06                1589
install.fpm.configuration.php                      30-Sep-2022 11:06               33887
install.fpm.install.php                            30-Sep-2022 11:06                3350
install.fpm.php                                    30-Sep-2022 11:06                3882
install.general.php                                30-Sep-2022 11:06                4669
install.macosx.bundled.php                         30-Sep-2022 11:06               10750
install.macosx.compile.php                         30-Sep-2022 11:06                1340
install.macosx.packages.php                        30-Sep-2022 11:06                3065
install.macosx.php                                 30-Sep-2022 11:06                1939
install.pecl.downloads.php                         30-Sep-2022 11:06                3510
install.pecl.intro.php                             30-Sep-2022 11:06                3016
install.pecl.pear.php                              30-Sep-2022 11:06                2894
install.pecl.php                                   30-Sep-2022 11:06                1942
install.pecl.php-config.php                        30-Sep-2022 11:06                3761
install.pecl.phpize.php                            30-Sep-2022 11:06                2971
install.pecl.static.php                            30-Sep-2022 11:06                3056
install.pecl.windows.php                           30-Sep-2022 11:06                8998
install.php                                        30-Sep-2022 11:06                5495
install.problems.bugs.php                          30-Sep-2022 11:06                1836
install.problems.faq.php                           30-Sep-2022 11:06                1277
install.problems.php                               30-Sep-2022 11:06                1561
install.problems.support.php                       30-Sep-2022 11:06                2294
install.unix.apache2.php                           30-Sep-2022 11:06               13465
install.unix.commandline.php                       30-Sep-2022 11:06                3872
install.unix.debian.php                            30-Sep-2022 11:06                7107
install.unix.lighttpd-14.php                       30-Sep-2022 11:06                6161
install.unix.litespeed.php                         30-Sep-2022 11:06                8944
install.unix.nginx.php                             30-Sep-2022 11:06                8983
install.unix.openbsd.php                           30-Sep-2022 11:06                5468
install.unix.php                                   30-Sep-2022 11:06                7653
install.unix.solaris.php                           30-Sep-2022 11:06                3736
install.windows.apache2.php                        30-Sep-2022 11:06                6901
install.windows.building.php                       30-Sep-2022 11:06                1640
install.windows.commandline.php                    30-Sep-2022 11:06                8156
install.windows.manual.php                         30-Sep-2022 11:06                5505
install.windows.pecl.php                           30-Sep-2022 11:06                1532
install.windows.php                                30-Sep-2022 11:06                3074
install.windows.recommended.php                    30-Sep-2022 11:06                4569
install.windows.requirements.php                   30-Sep-2022 11:06                2178
install.windows.tools.php                          30-Sep-2022 11:06                1743
install.windows.troubleshooting.php                30-Sep-2022 11:06                1652
internaliterator.construct.php                     30-Sep-2022 11:06                1950
internaliterator.current.php                       30-Sep-2022 11:06                2297
internaliterator.key.php                           30-Sep-2022 11:06                2286
internaliterator.next.php                          30-Sep-2022 11:06                2216
internaliterator.rewind.php                        30-Sep-2022 11:06                2251
internaliterator.valid.php                         30-Sep-2022 11:06                2186
intl.configuration.php                             30-Sep-2022 11:06                5003
intl.constants.php                                 30-Sep-2022 11:06                7296
intl.examples.basic.php                            30-Sep-2022 11:06                4437
intl.examples.php                                  30-Sep-2022 11:06                1358
intl.installation.php                              30-Sep-2022 11:06                2342
intl.requirements.php                              30-Sep-2022 11:06                1554
intl.resources.php                                 30-Sep-2022 11:06                1160
intl.setup.php                                     30-Sep-2022 11:06                1550
intlbreakiterator.construct.php                    30-Sep-2022 11:06                2426
intlbreakiterator.createcharacterinstance.php      30-Sep-2022 11:06                3132
intlbreakiterator.createcodepointinstance.php      30-Sep-2022 11:06                2769
intlbreakiterator.createlineinstance.php           30-Sep-2022 11:06                3093
intlbreakiterator.createsentenceinstance.php       30-Sep-2022 11:06                3095
intlbreakiterator.createtitleinstance.php          30-Sep-2022 11:06                3075
intlbreakiterator.createwordinstance.php           30-Sep-2022 11:06                3029
intlbreakiterator.current.php                      30-Sep-2022 11:06                2400
intlbreakiterator.first.php                        30-Sep-2022 11:06                2384
intlbreakiterator.following.php                    30-Sep-2022 11:06                2631
intlbreakiterator.geterrorcode.php                 30-Sep-2022 11:06                2872
intlbreakiterator.geterrormessage.php              30-Sep-2022 11:06                3007
intlbreakiterator.getlocale.php                    30-Sep-2022 11:06                2623
intlbreakiterator.getpartsiterator.php             30-Sep-2022 11:06                3425
intlbreakiterator.gettext.php                      30-Sep-2022 11:06                2459
intlbreakiterator.isboundary.php                   30-Sep-2022 11:06                2600
intlbreakiterator.last.php                         30-Sep-2022 11:06                2383
intlbreakiterator.next.php                         30-Sep-2022 11:06                2684
intlbreakiterator.preceding.php                    30-Sep-2022 11:06                2609
intlbreakiterator.previous.php                     30-Sep-2022 11:06                2439
intlbreakiterator.settext.php                      30-Sep-2022 11:06                2617
intlcalendar.add.php                               30-Sep-2022 11:06                8392
intlcalendar.after.php                             30-Sep-2022 11:06                6755
intlcalendar.before.php                            30-Sep-2022 11:06                3993
intlcalendar.clear.php                             30-Sep-2022 11:06               20730
intlcalendar.construct.php                         30-Sep-2022 11:06                2308
intlcalendar.createinstance.php                    30-Sep-2022 11:06               12864
intlcalendar.equals.php                            30-Sep-2022 11:06               10995
intlcalendar.fielddifference.php                   30-Sep-2022 11:06               11332
intlcalendar.fromdatetime.php                      30-Sep-2022 11:06                7462
intlcalendar.get.php                               30-Sep-2022 11:06                8872
intlcalendar.getactualmaximum.php                  30-Sep-2022 11:06                8439
intlcalendar.getactualminimum.php                  30-Sep-2022 11:06                5584
intlcalendar.getavailablelocales.php               30-Sep-2022 11:06                4196
intlcalendar.getdayofweektype.php                  30-Sep-2022 11:06                9848
intlcalendar.geterrorcode.php                      30-Sep-2022 11:06                9048
intlcalendar.geterrormessage.php                   30-Sep-2022 11:06                5964
intlcalendar.getfirstdayofweek.php                 30-Sep-2022 11:06                8502
intlcalendar.getgreatestminimum.php                30-Sep-2022 11:06                4424
intlcalendar.getkeywordvaluesforlocale.php         30-Sep-2022 11:06                7568
intlcalendar.getleastmaximum.php                   30-Sep-2022 11:06                8236
intlcalendar.getlocale.php                         30-Sep-2022 11:06                5950
intlcalendar.getmaximum.php                        30-Sep-2022 11:06                5117
intlcalendar.getminimaldaysinfirstweek.php         30-Sep-2022 11:06                9044
intlcalendar.getminimum.php                        30-Sep-2022 11:06                4368
intlcalendar.getnow.php                            30-Sep-2022 11:06                5333
intlcalendar.getrepeatedwalltimeoption.php         30-Sep-2022 11:06               10319
intlcalendar.getskippedwalltimeoption.php          30-Sep-2022 11:06               12728
intlcalendar.gettime.php                           30-Sep-2022 11:06                6467
intlcalendar.gettimezone.php                       30-Sep-2022 11:06                7546
intlcalendar.gettype.php                           30-Sep-2022 11:06                5606
intlcalendar.getweekendtransition.php              30-Sep-2022 11:06                4709
intlcalendar.indaylighttime.php                    30-Sep-2022 11:06                8815
intlcalendar.isequivalentto.php                    30-Sep-2022 11:06                8504
intlcalendar.islenient.php                         30-Sep-2022 11:06                8340
intlcalendar.isset.php                             30-Sep-2022 11:06                4594
intlcalendar.isweekend.php                         30-Sep-2022 11:06                8750
intlcalendar.roll.php                              30-Sep-2022 11:06                9039
intlcalendar.set.php                               30-Sep-2022 11:06               14085
intlcalendar.setfirstdayofweek.php                 30-Sep-2022 11:06                7894
intlcalendar.setlenient.php                        30-Sep-2022 11:06                4069
intlcalendar.setminimaldaysinfirstweek.php         30-Sep-2022 11:06                4066
intlcalendar.setrepeatedwalltimeoption.php         30-Sep-2022 11:06                5371
intlcalendar.setskippedwalltimeoption.php          30-Sep-2022 11:06                6080
intlcalendar.settime.php                           30-Sep-2022 11:06                8593
intlcalendar.settimezone.php                       30-Sep-2022 11:06               10875
intlcalendar.todatetime.php                        30-Sep-2022 11:06                7175
intlchar.charage.php                               30-Sep-2022 11:06                5560
intlchar.chardigitvalue.php                        30-Sep-2022 11:06                5232
intlchar.chardirection.php                         30-Sep-2022 11:06                8678
intlchar.charfromname.php                          30-Sep-2022 11:06                6708
intlchar.charmirror.php                            30-Sep-2022 11:06                6099
intlchar.charname.php                              30-Sep-2022 11:06                7025
intlchar.chartype.php                              30-Sep-2022 11:06                9216
intlchar.chr.php                                   30-Sep-2022 11:06                5421
intlchar.digit.php                                 30-Sep-2022 11:06                7989
intlchar.enumcharnames.php                         30-Sep-2022 11:06                7700
intlchar.enumchartypes.php                         30-Sep-2022 11:06                5759
intlchar.foldcase.php                              30-Sep-2022 11:06                3493
intlchar.fordigit.php                              30-Sep-2022 11:06                6861
intlchar.getbidipairedbracket.php                  30-Sep-2022 11:06                5697
intlchar.getblockcode.php                          30-Sep-2022 11:06                5308
intlchar.getcombiningclass.php                     30-Sep-2022 11:06                4622
intlchar.getfc-nfkc-closure.php                    30-Sep-2022 11:06                4563
intlchar.getintpropertymaxvalue.php                30-Sep-2022 11:06                6361
intlchar.getintpropertyminvalue.php                30-Sep-2022 11:06                6354
intlchar.getintpropertyvalue.php                   30-Sep-2022 11:06                7723
intlchar.getnumericvalue.php                       30-Sep-2022 11:06                5132
intlchar.getpropertyenum.php                       30-Sep-2022 11:06                6513
intlchar.getpropertyname.php                       30-Sep-2022 11:06                8202
intlchar.getpropertyvalueenum.php                  30-Sep-2022 11:06                7867
intlchar.getpropertyvaluename.php                  30-Sep-2022 11:06                9945
intlchar.getunicodeversion.php                     30-Sep-2022 11:06                3918
intlchar.hasbinaryproperty.php                     30-Sep-2022 11:06                8586
intlchar.isalnum.php                               30-Sep-2022 11:06                5354
intlchar.isalpha.php                               30-Sep-2022 11:06                5242
intlchar.isbase.php                                30-Sep-2022 11:06                5722
intlchar.isblank.php                               30-Sep-2022 11:06                6431
intlchar.iscntrl.php                               30-Sep-2022 11:06                6031
intlchar.isdefined.php                             30-Sep-2022 11:06                6464
intlchar.isdigit.php                               30-Sep-2022 11:06                5580
intlchar.isgraph.php                               30-Sep-2022 11:06                5272
intlchar.isidignorable.php                         30-Sep-2022 11:06                5861
intlchar.isidpart.php                              30-Sep-2022 11:06                6441
intlchar.isidstart.php                             30-Sep-2022 11:06                5945
intlchar.isisocontrol.php                          30-Sep-2022 11:06                5197
intlchar.isjavaidpart.php                          30-Sep-2022 11:06                6537
intlchar.isjavaidstart.php                         30-Sep-2022 11:06                6237
intlchar.isjavaspacechar.php                       30-Sep-2022 11:06                6475
intlchar.islower.php                               30-Sep-2022 11:06                6744
intlchar.ismirrored.php                            30-Sep-2022 11:06                5307
intlchar.isprint.php                               30-Sep-2022 11:06                5551
intlchar.ispunct.php                               30-Sep-2022 11:06                5019
intlchar.isspace.php                               30-Sep-2022 11:06                6118
intlchar.istitle.php                               30-Sep-2022 11:06                6179
intlchar.isualphabetic.php                         30-Sep-2022 11:06                5538
intlchar.isulowercase.php                          30-Sep-2022 11:06                6521
intlchar.isupper.php                               30-Sep-2022 11:06                6742
intlchar.isuuppercase.php                          30-Sep-2022 11:06                6559
intlchar.isuwhitespace.php                         30-Sep-2022 11:06                7065
intlchar.iswhitespace.php                          30-Sep-2022 11:06                7190
intlchar.isxdigit.php                              30-Sep-2022 11:06                6630
intlchar.ord.php                                   30-Sep-2022 11:06                5270
intlchar.tolower.php                               30-Sep-2022 11:06                7275
intlchar.totitle.php                               30-Sep-2022 11:06                7296
intlchar.toupper.php                               30-Sep-2022 11:06                7218
intlcodepointbreakiterator.getlastcodepoint.php    30-Sep-2022 11:06                2642
intldateformatter.create.php                       30-Sep-2022 11:06               27153
intldateformatter.format.php                       30-Sep-2022 11:06               27633
intldateformatter.formatobject.php                 30-Sep-2022 11:06               14006
intldateformatter.getcalendar.php                  30-Sep-2022 11:06                9461
intldateformatter.getcalendarobject.php            30-Sep-2022 11:06                7621
intldateformatter.getdatetype.php                  30-Sep-2022 11:06               12237
intldateformatter.geterrorcode.php                 30-Sep-2022 11:06                9258
intldateformatter.geterrormessage.php              30-Sep-2022 11:06                9166
intldateformatter.getlocale.php                    30-Sep-2022 11:06               12503
intldateformatter.getpattern.php                   30-Sep-2022 11:06               10793
intldateformatter.gettimetype.php                  30-Sep-2022 11:06               12231
intldateformatter.gettimezone.php                  30-Sep-2022 11:06                8767
intldateformatter.gettimezoneid.php                30-Sep-2022 11:06                9125
intldateformatter.islenient.php                    30-Sep-2022 11:06               15891
intldateformatter.localtime.php                    30-Sep-2022 11:06               11749
intldateformatter.parse.php                        30-Sep-2022 11:06               12480
intldateformatter.setcalendar.php                  30-Sep-2022 11:06               14581
intldateformatter.setlenient.php                   30-Sep-2022 11:06               16662
intldateformatter.setpattern.php                   30-Sep-2022 11:06               11875
intldateformatter.settimezone.php                  30-Sep-2022 11:06               11556
intldatepatterngenerator.create.php                30-Sep-2022 11:06                3774
intldatepatterngenerator.getbestpattern.php        30-Sep-2022 11:06                6844
intlgregoriancalendar.construct.php                30-Sep-2022 11:06                5099
intlgregoriancalendar.getgregorianchange.php       30-Sep-2022 11:06                2606
intlgregoriancalendar.isleapyear.php               30-Sep-2022 11:06                2829
intlgregoriancalendar.setgregorianchange.php       30-Sep-2022 11:06                2867
intliterator.current.php                           30-Sep-2022 11:06                2373
intliterator.key.php                               30-Sep-2022 11:06                2342
intliterator.next.php                              30-Sep-2022 11:06                2292
intliterator.rewind.php                            30-Sep-2022 11:06                2320
intliterator.valid.php                             30-Sep-2022 11:06                2263
intlpartsiterator.getbreakiterator.php             30-Sep-2022 11:06                2543
intlrulebasedbreakiterator.construct.php           30-Sep-2022 11:06                3016
intlrulebasedbreakiterator.getbinaryrules.php      30-Sep-2022 11:06                2714
intlrulebasedbreakiterator.getrules.php            30-Sep-2022 11:06                2678
intlrulebasedbreakiterator.getrulestatus.php       30-Sep-2022 11:06                2678
intlrulebasedbreakiterator.getrulestatusvec.php    30-Sep-2022 11:06                2774
intltimezone.construct.php                         30-Sep-2022 11:06                1949
intltimezone.countequivalentids.php                30-Sep-2022 11:06                3384
intltimezone.createdefault.php                     30-Sep-2022 11:06                2995
intltimezone.createenumeration.php                 30-Sep-2022 11:06                4140
intltimezone.createtimezone.php                    30-Sep-2022 11:06                3416
intltimezone.createtimezoneidenumeration.php       30-Sep-2022 11:06                5073
intltimezone.fromdatetimezone.php                  30-Sep-2022 11:06                3657
intltimezone.getcanonicalid.php                    30-Sep-2022 11:06                3887
intltimezone.getdisplayname.php                    30-Sep-2022 11:06                4792
intltimezone.getdstsavings.php                     30-Sep-2022 11:06                3011
intltimezone.getequivalentid.php                   30-Sep-2022 11:06                3674
intltimezone.geterrorcode.php                      30-Sep-2022 11:06                3131
intltimezone.geterrormessage.php                   30-Sep-2022 11:06                3155
intltimezone.getgmt.php                            30-Sep-2022 11:06                2844
intltimezone.getid.php                             30-Sep-2022 11:06                3007
intltimezone.getidforwindowsid.php                 30-Sep-2022 11:06                5240
intltimezone.getoffset.php                         30-Sep-2022 11:06                4524
intltimezone.getrawoffset.php                      30-Sep-2022 11:06                2962
intltimezone.getregion.php                         30-Sep-2022 11:06                3342
intltimezone.gettzdataversion.php                  30-Sep-2022 11:06                3046
intltimezone.getunknown.php                        30-Sep-2022 11:06                3059
intltimezone.getwindowsid.php                      30-Sep-2022 11:06                4099
intltimezone.hassamerules.php                      30-Sep-2022 11:06                3392
intltimezone.todatetimezone.php                    30-Sep-2022 11:06                3376
intltimezone.usedaylighttime.php                   30-Sep-2022 11:06                2986
intro-whatcando.php                                30-Sep-2022 11:06                8980
intro-whatis.php                                   30-Sep-2022 11:06                4525
intro.apache.php                                   30-Sep-2022 11:06                1145
intro.apcu.php                                     30-Sep-2022 11:06                1569
intro.array.php                                    30-Sep-2022 11:06                1987
intro.bc.php                                       30-Sep-2022 11:06                4512
intro.bzip2.php                                    30-Sep-2022 11:06                1180
intro.calendar.php                                 30-Sep-2022 11:06                2274
intro.classobj.php                                 30-Sep-2022 11:06                1766
intro.cmark.php                                    30-Sep-2022 11:06                6346
intro.com.php                                      30-Sep-2022 11:06                3048
intro.componere.php                                30-Sep-2022 11:06                6109
intro.csprng.php                                   30-Sep-2022 11:06                1628
intro.ctype.php                                    30-Sep-2022 11:06                3831
intro.cubrid.php                                   30-Sep-2022 11:06                1436
intro.curl.php                                     30-Sep-2022 11:06                1604
intro.datetime.php                                 30-Sep-2022 11:06                2332
intro.dba.php                                      30-Sep-2022 11:06                1545
intro.dbase.php                                    30-Sep-2022 11:06                6710
intro.dio.php                                      30-Sep-2022 11:06                1721
intro.dom.php                                      30-Sep-2022 11:06                1691
intro.ds.php                                       30-Sep-2022 11:06                1384
intro.eio.php                                      30-Sep-2022 11:06               15578
intro.enchant.php                                  30-Sep-2022 11:06                2569
intro.errorfunc.php                                30-Sep-2022 11:06                2020
intro.ev.php                                       30-Sep-2022 11:06                2265
intro.event.php                                    30-Sep-2022 11:06                1942
intro.exec.php                                     30-Sep-2022 11:06                1791
intro.exif.php                                     30-Sep-2022 11:06                1454
intro.expect.php                                   30-Sep-2022 11:06                1390
intro.fann.php                                     30-Sep-2022 11:06                1379
intro.fdf.php                                      30-Sep-2022 11:06                3907
intro.ffi.php                                      30-Sep-2022 11:06                2809
intro.fileinfo.php                                 30-Sep-2022 11:06                1401
intro.filesystem.php                               30-Sep-2022 11:06                1397
intro.filter.php                                   30-Sep-2022 11:06                2852
intro.fpm.php                                      30-Sep-2022 11:06                1295
intro.ftp.php                                      30-Sep-2022 11:06                1859
intro.funchand.php                                 30-Sep-2022 11:06                1196
intro.gearman.php                                  30-Sep-2022 11:06                1620
intro.gender.php                                   30-Sep-2022 11:06                1307
intro.geoip.php                                    30-Sep-2022 11:06                1528
intro.gettext.php                                  30-Sep-2022 11:06                1592
intro.gmagick.php                                  30-Sep-2022 11:06                1650
intro.gmp.php                                      30-Sep-2022 11:06                3140
intro.gnupg.php                                    30-Sep-2022 11:06                1189
intro.hash.php                                     30-Sep-2022 11:06                1272
intro.hrtime.php                                   30-Sep-2022 11:06                1624
intro.ibase.php                                    30-Sep-2022 11:06                3178
intro.ibm-db2.php                                  30-Sep-2022 11:06                1237
intro.iconv.php                                    30-Sep-2022 11:06                1913
intro.igbinary.php                                 30-Sep-2022 11:06                1632
intro.image.php                                    30-Sep-2022 11:06                6405
intro.imagick.php                                  30-Sep-2022 11:06                1669
intro.imap.php                                     30-Sep-2022 11:06                1712
intro.info.php                                     30-Sep-2022 11:06                1576
intro.inotify.php                                  30-Sep-2022 11:06                2299
intro.intl.php                                     30-Sep-2022 11:06                4975
intro.json.php                                     30-Sep-2022 11:06                1613
intro.ldap.php                                     30-Sep-2022 11:06                4508
intro.libxml.php                                   30-Sep-2022 11:06                1728
intro.lua.php                                      30-Sep-2022 11:06                1225
intro.luasandbox.php                               30-Sep-2022 11:06                2322
intro.lzf.php                                      30-Sep-2022 11:06                1378
intro.mail.php                                     30-Sep-2022 11:06                1185
intro.mailparse.php                                30-Sep-2022 11:06                1897
intro.math.php                                     30-Sep-2022 11:06                1980
intro.mbstring.php                                 30-Sep-2022 11:06                2730
intro.mcrypt.php                                   30-Sep-2022 11:06                2353
intro.memcache.php                                 30-Sep-2022 11:06                1657
intro.memcached.php                                30-Sep-2022 11:06                1834
intro.mhash.php                                    30-Sep-2022 11:06                2746
intro.misc.php                                     30-Sep-2022 11:06                1125
intro.mqseries.php                                 30-Sep-2022 11:06                1701
intro.mysql-xdevapi.php                            30-Sep-2022 11:06                1837
intro.mysql.php                                    30-Sep-2022 11:06                1931
intro.mysqli.php                                   30-Sep-2022 11:06                2166
intro.mysqlnd.php                                  30-Sep-2022 11:06                1899
intro.network.php                                  30-Sep-2022 11:06                1151
intro.oauth.php                                    30-Sep-2022 11:06                1291
intro.oci8.php                                     30-Sep-2022 11:06                1511
intro.opcache.php                                  30-Sep-2022 11:06                1501
intro.openal.php                                   30-Sep-2022 11:06                1210
intro.openssl.php                                  30-Sep-2022 11:06                1666
intro.outcontrol.php                               30-Sep-2022 11:06                1852
intro.parallel.php                                 30-Sep-2022 11:06                6821
intro.parle.php                                    30-Sep-2022 11:06                3396
intro.password.php                                 30-Sep-2022 11:06                1406
intro.pcntl.php                                    30-Sep-2022 11:06                2833
intro.pcre.php                                     30-Sep-2022 11:06                2915
intro.pdo.php                                      30-Sep-2022 11:06                2236
intro.pgsql.php                                    30-Sep-2022 11:06                1602
intro.phar.php                                     30-Sep-2022 11:06               10077
intro.phpdbg.php                                   30-Sep-2022 11:06                5998
intro.posix.php                                    30-Sep-2022 11:06                1715
intro.ps.php                                       30-Sep-2022 11:06                1719
intro.pspell.php                                   30-Sep-2022 11:06                1189
intro.pthreads.php                                 30-Sep-2022 11:06                9092
intro.quickhash.php                                30-Sep-2022 11:06                1224
intro.radius.php                                   30-Sep-2022 11:06                2125
intro.rar.php                                      30-Sep-2022 11:06                1507
intro.readline.php                                 30-Sep-2022 11:06                2110
intro.recode.php                                   30-Sep-2022 11:06                2402
intro.reflection.php                               30-Sep-2022 11:06                1848
intro.rpminfo.php                                  30-Sep-2022 11:06                1183
intro.rrd.php                                      30-Sep-2022 11:06                1393
intro.runkit7.php                                  30-Sep-2022 11:06                1436
intro.scoutapm.php                                 30-Sep-2022 11:06                1441
intro.seaslog.php                                  30-Sep-2022 11:06                4130
intro.sem.php                                      30-Sep-2022 11:06                3761
intro.session.php                                  30-Sep-2022 11:06                5071
intro.shmop.php                                    30-Sep-2022 11:06                1239
intro.simplexml.php                                30-Sep-2022 11:06                1319
intro.snmp.php                                     30-Sep-2022 11:06                1698
intro.soap.php                                     30-Sep-2022 11:06                1457
intro.sockets.php                                  30-Sep-2022 11:06                2721
intro.sodium.php                                   30-Sep-2022 11:06                1287
intro.solr.php                                     30-Sep-2022 11:06                1881
intro.spl.php                                      30-Sep-2022 11:06                1587
intro.sqlite3.php                                  30-Sep-2022 11:06                1118
intro.sqlsrv.php                                   30-Sep-2022 11:06                2123
intro.ssdeep.php                                   30-Sep-2022 11:06                1716
intro.ssh2.php                                     30-Sep-2022 11:06                1351
intro.stats.php                                    30-Sep-2022 11:06                1468
intro.stomp.php                                    30-Sep-2022 11:06                1301
intro.stream.php                                   30-Sep-2022 11:06                3857
intro.strings.php                                  30-Sep-2022 11:06                1714
intro.svm.php                                      30-Sep-2022 11:06                1199
intro.svn.php                                      30-Sep-2022 11:06                1795
intro.swoole.php                                   30-Sep-2022 11:06                1620
intro.sync.php                                     30-Sep-2022 11:06                2312
intro.taint.php                                    30-Sep-2022 11:06                4505
intro.tcpwrap.php                                  30-Sep-2022 11:06                1230
intro.tidy.php                                     30-Sep-2022 11:06                1366
intro.tokenizer.php                                30-Sep-2022 11:06                1521
intro.trader.php                                   30-Sep-2022 11:06                2345
intro.ui.php                                       30-Sep-2022 11:06                1168
intro.uodbc.php                                    30-Sep-2022 11:06                2807
intro.uopz.php                                     30-Sep-2022 11:06                2362
intro.url.php                                      30-Sep-2022 11:06                1096
intro.v8js.php                                     30-Sep-2022 11:06                1190
intro.var.php                                      30-Sep-2022 11:06                1286
intro.var_representation.php                       30-Sep-2022 11:06                1386
intro.varnish.php                                  30-Sep-2022 11:06                1275
intro.wddx.php                                     30-Sep-2022 11:06                2138
intro.win32service.php                             30-Sep-2022 11:06                1358
intro.wincache.php                                 30-Sep-2022 11:06                4932
intro.wkhtmltox.php                                30-Sep-2022 11:06                1234
intro.xattr.php                                    30-Sep-2022 11:06                1147
intro.xdiff.php                                    30-Sep-2022 11:06                2569
intro.xhprof.php                                   30-Sep-2022 11:06                2751
intro.xlswriter.php                                30-Sep-2022 11:06                1147
intro.xml.php                                      30-Sep-2022 11:06                2228
intro.xmldiff.php                                  30-Sep-2022 11:06                1368
intro.xmlreader.php                                30-Sep-2022 11:06                1571
intro.xmlrpc.php                                   30-Sep-2022 11:06                1877
intro.xmlwriter.php                                30-Sep-2022 11:06                1551
intro.xsl.php                                      30-Sep-2022 11:06                1316
intro.yac.php                                      30-Sep-2022 11:06                1159
intro.yaconf.php                                   30-Sep-2022 11:06                2531
intro.yaf.php                                      30-Sep-2022 11:06                1507
intro.yaml.php                                     30-Sep-2022 11:06                1363
intro.yar.php                                      30-Sep-2022 11:06                1228
intro.yaz.php                                      30-Sep-2022 11:06                2487
intro.zip.php                                      30-Sep-2022 11:06                1179
intro.zlib.php                                     30-Sep-2022 11:06                1728
intro.zmq.php                                      30-Sep-2022 11:06                1344
intro.zookeeper.php                                30-Sep-2022 11:06                1405
introduction.php                                   30-Sep-2022 11:06                1408
iterator.current.php                               30-Sep-2022 11:06                2178
iterator.key.php                                   30-Sep-2022 11:06                2546
iterator.next.php                                  30-Sep-2022 11:06                2417
iterator.rewind.php                                30-Sep-2022 11:06                2603
iterator.valid.php                                 30-Sep-2022 11:06                2573
iteratoraggregate.getiterator.php                  30-Sep-2022 11:06                2832
iteratoriterator.construct.php                     30-Sep-2022 11:06                2944
iteratoriterator.current.php                       30-Sep-2022 11:06                2742
iteratoriterator.getinneriterator.php              30-Sep-2022 11:06                3056
iteratoriterator.key.php                           30-Sep-2022 11:06                2690
iteratoriterator.next.php                          30-Sep-2022 11:06                2801
iteratoriterator.rewind.php                        30-Sep-2022 11:06                2820
iteratoriterator.valid.php                         30-Sep-2022 11:06                2847
json.configuration.php                             30-Sep-2022 11:06                1217
json.constants.php                                 30-Sep-2022 11:06               13712
json.installation.php                              30-Sep-2022 11:06                1745
json.requirements.php                              30-Sep-2022 11:06                1198
json.resources.php                                 30-Sep-2022 11:06                1160
json.setup.php                                     30-Sep-2022 11:06                1522
jsonserializable.jsonserialize.php                 30-Sep-2022 11:06               13182
langref.php                                        30-Sep-2022 11:06               18935
language.attributes.classes.php                    30-Sep-2022 11:06                5486
language.attributes.overview.php                   30-Sep-2022 11:06               11504
language.attributes.php                            30-Sep-2022 11:06                1683
language.attributes.reflection.php                 30-Sep-2022 11:06                8615
language.attributes.syntax.php                     30-Sep-2022 11:06                5075
language.basic-syntax.comments.php                 30-Sep-2022 11:06                4452
language.basic-syntax.instruction-separation.php   30-Sep-2022 11:06                4496
language.basic-syntax.php                          30-Sep-2022 11:06                1635
language.basic-syntax.phpmode.php                  30-Sep-2022 11:06                4935
language.basic-syntax.phptags.php                  30-Sep-2022 11:06                5578
language.constants.magic.php                       30-Sep-2022 11:06                5454
language.constants.php                             30-Sep-2022 11:06                6727
language.constants.predefined.php                  30-Sep-2022 11:06                1572
language.constants.syntax.php                      30-Sep-2022 11:06               11061
language.control-structures.php                    30-Sep-2022 11:06                2736
language.enumerations.backed.php                   30-Sep-2022 11:06               10168
language.enumerations.basics.php                   30-Sep-2022 11:06                7504
language.enumerations.constants.php                30-Sep-2022 11:06                2371
language.enumerations.examples.php                 30-Sep-2022 11:06                7800
language.enumerations.expressions.php              30-Sep-2022 11:06                5804
language.enumerations.listing.php                  30-Sep-2022 11:06                2184
language.enumerations.methods.php                  30-Sep-2022 11:06               15832
language.enumerations.object-differences.php       30-Sep-2022 11:06                4851
language.enumerations.overview.php                 30-Sep-2022 11:06                2176
language.enumerations.php                          30-Sep-2022 11:06                2331
language.enumerations.serialization.php            30-Sep-2022 11:06                4879
language.enumerations.static-methods.php           30-Sep-2022 11:06                3661
language.enumerations.traits.php                   30-Sep-2022 11:06                4953
language.errors.basics.php                         30-Sep-2022 11:06                5359
language.errors.php                                30-Sep-2022 11:06                1818
language.errors.php7.php                           30-Sep-2022 11:06                5924
language.exceptions.extending.php                  30-Sep-2022 11:06               24876
language.exceptions.php                            30-Sep-2022 11:06               31217
language.expressions.php                           30-Sep-2022 11:06               17064
language.fibers.php                                30-Sep-2022 11:06                6220
language.functions.php                             30-Sep-2022 11:06                1924
language.generators.comparison.php                 30-Sep-2022 11:06               10730
language.generators.overview.php                   30-Sep-2022 11:06               10498
language.generators.php                            30-Sep-2022 11:06                1557
language.generators.syntax.php                     30-Sep-2022 11:06               27752
language.namespaces.basics.php                     30-Sep-2022 11:06               13273
language.namespaces.definition.php                 30-Sep-2022 11:06                4560
language.namespaces.definitionmultiple.php         30-Sep-2022 11:06                9955
language.namespaces.dynamic.php                    30-Sep-2022 11:06                9020
language.namespaces.fallback.php                   30-Sep-2022 11:06                7009
language.namespaces.faq.php                        30-Sep-2022 11:06               36085
language.namespaces.global.php                     30-Sep-2022 11:06                3144
language.namespaces.importing.php                  30-Sep-2022 11:06               19180
language.namespaces.nested.php                     30-Sep-2022 11:06                3027
language.namespaces.nsconstants.php                30-Sep-2022 11:06               10115
language.namespaces.php                            30-Sep-2022 11:06                2493
language.namespaces.rationale.php                  30-Sep-2022 11:06                7337
language.namespaces.rules.php                      30-Sep-2022 11:06               18131
language.oop5.abstract.php                         30-Sep-2022 11:06               12403
language.oop5.anonymous.php                        30-Sep-2022 11:06               12326
language.oop5.autoload.php                         30-Sep-2022 11:06                6981
language.oop5.basic.php                            30-Sep-2022 11:06               50310
language.oop5.changelog.php                        30-Sep-2022 11:06               13831
language.oop5.cloning.php                          30-Sep-2022 11:06                9660
language.oop5.constants.php                        30-Sep-2022 11:06                9721
language.oop5.decon.php                            30-Sep-2022 11:06               30762
language.oop5.final.php                            30-Sep-2022 11:06                6930
language.oop5.inheritance.php                      30-Sep-2022 11:06               14735
language.oop5.interfaces.php                       30-Sep-2022 11:06               24078
language.oop5.iterations.php                       30-Sep-2022 11:06                6453
language.oop5.late-static-bindings.php             30-Sep-2022 11:06               16972
language.oop5.magic.php                            30-Sep-2022 11:06               45252
language.oop5.object-comparison.php                30-Sep-2022 11:06                9690
language.oop5.overloading.php                      30-Sep-2022 11:06               26635
language.oop5.paamayim-nekudotayim.php             30-Sep-2022 11:06                9173
language.oop5.php                                  30-Sep-2022 11:06                3346
language.oop5.properties.php                       30-Sep-2022 11:06               29237
language.oop5.references.php                       30-Sep-2022 11:06                6360
language.oop5.serialization.php                    30-Sep-2022 11:06                7866
language.oop5.static.php                           30-Sep-2022 11:06                9757
language.oop5.traits.php                           30-Sep-2022 11:06               35732
language.oop5.variance.php                         30-Sep-2022 11:06               17588
language.oop5.visibility.php                       30-Sep-2022 11:06               28964
language.operators.arithmetic.php                  30-Sep-2022 11:06                6157
language.operators.array.php                       30-Sep-2022 11:06                9399
language.operators.assignment.php                  30-Sep-2022 11:06               12482
language.operators.bitwise.php                     30-Sep-2022 11:06               48386
language.operators.comparison.php                  30-Sep-2022 11:06               44706
language.operators.errorcontrol.php                30-Sep-2022 11:06                6379
language.operators.execution.php                   30-Sep-2022 11:06                3656
language.operators.increment.php                   30-Sep-2022 11:06               11750
language.operators.logical.php                     30-Sep-2022 11:06                8055
language.operators.php                             30-Sep-2022 11:06                4068
language.operators.precedence.php                  30-Sep-2022 11:06               21300
language.operators.string.php                      30-Sep-2022 11:06                3374
language.operators.type.php                        30-Sep-2022 11:06               19536
language.references.arent.php                      30-Sep-2022 11:06                3279
language.references.pass.php                       30-Sep-2022 11:06                7253
language.references.php                            30-Sep-2022 11:06                1885
language.references.return.php                     30-Sep-2022 11:06                7798
language.references.spot.php                       30-Sep-2022 11:06                2469
language.references.unset.php                      30-Sep-2022 11:06                2367
language.references.whatare.php                    30-Sep-2022 11:06                2054
language.references.whatdo.php                     30-Sep-2022 11:06               19835
language.types.array.php                           30-Sep-2022 11:06              112524
language.types.boolean.php                         30-Sep-2022 11:06                9448
language.types.callable.php                        30-Sep-2022 11:06               12930
language.types.declarations.php                    30-Sep-2022 11:06               53126
language.types.enumerations.php                    30-Sep-2022 11:06                3567
language.types.float.php                           30-Sep-2022 11:06                9494
language.types.integer.php                         30-Sep-2022 11:06               19933
language.types.intro.php                           30-Sep-2022 11:06                7932
language.types.iterable.php                        30-Sep-2022 11:06                6683
language.types.null.php                            30-Sep-2022 11:06                3551
language.types.numeric-strings.php                 30-Sep-2022 11:06               10707
language.types.object.php                          30-Sep-2022 11:06                5629
language.types.php                                 30-Sep-2022 11:06                2328
language.types.resource.php                        30-Sep-2022 11:06                2832
language.types.string.php                          30-Sep-2022 11:06               87267
language.types.type-juggling.php                   30-Sep-2022 11:06               18157
language.variables.basics.php                      30-Sep-2022 11:06               15287
language.variables.external.php                    30-Sep-2022 11:06               18773
language.variables.php                             30-Sep-2022 11:06                1695
language.variables.predefined.php                  30-Sep-2022 11:06                2983
language.variables.scope.php                       30-Sep-2022 11:06               30401
language.variables.superglobals.php                30-Sep-2022 11:06                4570
language.variables.variable.php                    30-Sep-2022 11:06               10716
ldap.configuration.php                             30-Sep-2022 11:06                2312
ldap.constants.php                                 30-Sep-2022 11:06               25709
ldap.controls.php                                  30-Sep-2022 11:06                8692
ldap.examples-basic.php                            30-Sep-2022 11:06                9575
ldap.examples-controls.php                         30-Sep-2022 11:06               19245
ldap.examples.php                                  30-Sep-2022 11:06                1397
ldap.installation.php                              30-Sep-2022 11:06                2926
ldap.requirements.php                              30-Sep-2022 11:06                1483
ldap.resources.php                                 30-Sep-2022 11:06                1450
ldap.setup.php                                     30-Sep-2022 11:06                1551
ldap.using.php                                     30-Sep-2022 11:06                2305
libxml.configuration.php                           30-Sep-2022 11:06                1231
libxml.constants.php                               30-Sep-2022 11:06               10022
libxml.installation.php                            30-Sep-2022 11:06                2477
libxml.requirements.php                            30-Sep-2022 11:06                1239
libxml.resources.php                               30-Sep-2022 11:06                1174
libxml.setup.php                                   30-Sep-2022 11:06                1564
limititerator.construct.php                        30-Sep-2022 11:06                7303
limititerator.current.php                          30-Sep-2022 11:06                3594
limititerator.getinneriterator.php                 30-Sep-2022 11:06                3125
limititerator.getposition.php                      30-Sep-2022 11:06                5964
limititerator.key.php                              30-Sep-2022 11:06                3700
limititerator.next.php                             30-Sep-2022 11:06                3311
limititerator.rewind.php                           30-Sep-2022 11:06                3479
limititerator.seek.php                             30-Sep-2022 11:06                4044
limititerator.valid.php                            30-Sep-2022 11:06                3405
locale.acceptfromhttp.php                          30-Sep-2022 11:06                5847
locale.canonicalize.php                            30-Sep-2022 11:06                2883
locale.composelocale.php                           30-Sep-2022 11:06               13856
locale.filtermatches.php                           30-Sep-2022 11:06                8575
locale.getallvariants.php                          30-Sep-2022 11:06                6203
locale.getdefault.php                              30-Sep-2022 11:06                5781
locale.getdisplaylanguage.php                      30-Sep-2022 11:06                9347
locale.getdisplayname.php                          30-Sep-2022 11:06                9331
locale.getdisplayregion.php                        30-Sep-2022 11:06                9295
locale.getdisplayscript.php                        30-Sep-2022 11:06                9302
locale.getdisplayvariant.php                       30-Sep-2022 11:06                9343
locale.getkeywords.php                             30-Sep-2022 11:06                7024
locale.getprimarylanguage.php                      30-Sep-2022 11:06                5669
locale.getregion.php                               30-Sep-2022 11:06                5559
locale.getscript.php                               30-Sep-2022 11:06                5336
locale.lookup.php                                  30-Sep-2022 11:06                9271
locale.parselocale.php                             30-Sep-2022 11:06                7251
locale.setdefault.php                              30-Sep-2022 11:06                5087
lua.assign.php                                     30-Sep-2022 11:06                4562
lua.call.php                                       30-Sep-2022 11:06                7430
lua.configuration.php                              30-Sep-2022 11:06                1210
lua.construct.php                                  30-Sep-2022 11:06                2330
lua.eval.php                                       30-Sep-2022 11:06                3672
lua.getversion.php                                 30-Sep-2022 11:06                2203
lua.include.php                                    30-Sep-2022 11:06                2572
lua.installation.php                               30-Sep-2022 11:06                1990
lua.registercallback.php                           30-Sep-2022 11:06                4484
lua.requirements.php                               30-Sep-2022 11:06                1249
lua.resources.php                                  30-Sep-2022 11:06                1154
lua.setup.php                                      30-Sep-2022 11:06                1509
luaclosure.invoke.php                              30-Sep-2022 11:06                4252
luasandbox.callfunction.php                        30-Sep-2022 11:06                4882
luasandbox.configuration.php                       30-Sep-2022 11:06                1259
luasandbox.disableprofiler.php                     30-Sep-2022 11:06                2852
luasandbox.enableprofiler.php                      30-Sep-2022 11:06                3391
luasandbox.examples-basic.php                      30-Sep-2022 11:06                7408
luasandbox.examples.php                            30-Sep-2022 11:06                1433
luasandbox.getcpuusage.php                         30-Sep-2022 11:06                3578
luasandbox.getmemoryusage.php                      30-Sep-2022 11:06                3155
luasandbox.getpeakmemoryusage.php                  30-Sep-2022 11:06                3205
luasandbox.getprofilerfunctionreport.php           30-Sep-2022 11:06                5651
luasandbox.getversioninfo.php                      30-Sep-2022 11:06                2903
luasandbox.installation.php                        30-Sep-2022 11:06                2056
luasandbox.loadbinary.php                          30-Sep-2022 11:06                3506
luasandbox.loadstring.php                          30-Sep-2022 11:06                5640
luasandbox.pauseusagetimer.php                     30-Sep-2022 11:06               10301
luasandbox.registerlibrary.php                     30-Sep-2022 11:06                6890
luasandbox.requirements.php                        30-Sep-2022 11:06                1735
luasandbox.resources.php                           30-Sep-2022 11:06                1219
luasandbox.setcpulimit.php                         30-Sep-2022 11:06                6009
luasandbox.setmemorylimit.php                      30-Sep-2022 11:06                5661
luasandbox.setup.php                               30-Sep-2022 11:06                1600
luasandbox.unpauseusagetimer.php                   30-Sep-2022 11:06                3148
luasandbox.wrapphpfunction.php                     30-Sep-2022 11:06                4324
luasandboxfunction.call.php                        30-Sep-2022 11:06                6851
luasandboxfunction.construct.php                   30-Sep-2022 11:06                2661
luasandboxfunction.dump.php                        30-Sep-2022 11:06                2362
lzf.configuration.php                              30-Sep-2022 11:06                1210
lzf.constants.php                                  30-Sep-2022 11:06                1104
lzf.installation.php                               30-Sep-2022 11:06                2442
lzf.requirements.php                               30-Sep-2022 11:06                1170
lzf.resources.php                                  30-Sep-2022 11:06                1153
lzf.setup.php                                      30-Sep-2022 11:06                1530
mail.configuration.php                             30-Sep-2022 11:06                7718
mail.constants.php                                 30-Sep-2022 11:06                1113
mail.installation.php                              30-Sep-2022 11:06                1201
mail.requirements.php                              30-Sep-2022 11:06                1896
mail.resources.php                                 30-Sep-2022 11:06                1160
mail.setup.php                                     30-Sep-2022 11:06                1545
mailparse.configuration.php                        30-Sep-2022 11:06                2432
mailparse.constants.php                            30-Sep-2022 11:06                1971
mailparse.installation.php                         30-Sep-2022 11:06                2428
mailparse.requirements.php                         30-Sep-2022 11:06                1212
mailparse.resources.php                            30-Sep-2022 11:06                1518
mailparse.setup.php                                30-Sep-2022 11:06                1608
manual.php                                         30-Sep-2022 11:06                1230
math.configuration.php                             30-Sep-2022 11:06                1217
math.constants.php                                 30-Sep-2022 11:06                6074
math.installation.php                              30-Sep-2022 11:06                1201
math.requirements.php                              30-Sep-2022 11:06                1177
math.resources.php                                 30-Sep-2022 11:06                1160
math.setup.php                                     30-Sep-2022 11:06                1538
mbstring.configuration.php                         30-Sep-2022 11:06               14258
mbstring.constants.php                             30-Sep-2022 11:06                5380
mbstring.encodings.php                             30-Sep-2022 11:06               15379
mbstring.http.php                                  30-Sep-2022 11:06                5197
mbstring.installation.php                          30-Sep-2022 11:06                3292
mbstring.ja-basic.php                              30-Sep-2022 11:06                3656
mbstring.overload.php                              30-Sep-2022 11:06                7224
mbstring.php4.req.php                              30-Sep-2022 11:06                3965
mbstring.requirements.php                          30-Sep-2022 11:06                1205
mbstring.resources.php                             30-Sep-2022 11:06                1188
mbstring.setup.php                                 30-Sep-2022 11:06                1608
mbstring.supported-encodings.php                   30-Sep-2022 11:06                8147
mcrypt.ciphers.php                                 30-Sep-2022 11:06                6399
mcrypt.configuration.php                           30-Sep-2022 11:06                3476
mcrypt.constants.php                               30-Sep-2022 11:06                6029
mcrypt.installation.php                            30-Sep-2022 11:06                1729
mcrypt.requirements.php                            30-Sep-2022 11:06                2108
mcrypt.resources.php                               30-Sep-2022 11:06                1293
mcrypt.setup.php                                   30-Sep-2022 11:06                1579
memcache.add.php                                   30-Sep-2022 11:06                6958
memcache.addserver.php                             30-Sep-2022 11:06               13195
memcache.close.php                                 30-Sep-2022 11:06                5139
memcache.connect.php                               30-Sep-2022 11:06                7214
memcache.constants.php                             30-Sep-2022 11:06                4237
memcache.decrement.php                             30-Sep-2022 11:06                7214
memcache.delete.php                                30-Sep-2022 11:06                6403
memcache.examples-overview.php                     30-Sep-2022 11:06                6788
memcache.examples.php                              30-Sep-2022 11:06                1390
memcache.flush.php                                 30-Sep-2022 11:06                4497
memcache.get.php                                   30-Sep-2022 11:06                8636
memcache.getextendedstats.php                      30-Sep-2022 11:06                8048
memcache.getserverstatus.php                       30-Sep-2022 11:06                6123
memcache.getstats.php                              30-Sep-2022 11:06                4544
memcache.getversion.php                            30-Sep-2022 11:06                5014
memcache.increment.php                             30-Sep-2022 11:06                7009
memcache.ini.php                                   30-Sep-2022 11:06               10073
memcache.installation.php                          30-Sep-2022 11:06                2070
memcache.pconnect.php                              30-Sep-2022 11:06                6190
memcache.replace.php                               30-Sep-2022 11:06                7061
memcache.requirements.php                          30-Sep-2022 11:06                1363
memcache.resources.php                             30-Sep-2022 11:06                1253
memcache.set.php                                   30-Sep-2022 11:06                9674
memcache.setcompressthreshold.php                  30-Sep-2022 11:06                5842
memcache.setserverparams.php                       30-Sep-2022 11:06               10897
memcache.setup.php                                 30-Sep-2022 11:06                1596
memcached.add.php                                  30-Sep-2022 11:06                4424
memcached.addbykey.php                             30-Sep-2022 11:06                5395
memcached.addserver.php                            30-Sep-2022 11:06                7261
memcached.addservers.php                           30-Sep-2022 11:06                5338
memcached.append.php                               30-Sep-2022 11:06                6825
memcached.appendbykey.php                          30-Sep-2022 11:06                4557
memcached.callbacks.php                            30-Sep-2022 11:06                1474
memcached.callbacks.read-through.php               30-Sep-2022 11:06                4561
memcached.callbacks.result.php                     30-Sep-2022 11:06                5009
memcached.cas.php                                  30-Sep-2022 11:06                9693
memcached.casbykey.php                             30-Sep-2022 11:06                5428
memcached.configuration.php                        30-Sep-2022 11:06               23097
memcached.constants.php                            30-Sep-2022 11:06               23066
memcached.construct.php                            30-Sep-2022 11:06                4419
memcached.decrement.php                            30-Sep-2022 11:06                8938
memcached.decrementbykey.php                       30-Sep-2022 11:06                5680
memcached.delete.php                               30-Sep-2022 11:06                5807
memcached.deletebykey.php                          30-Sep-2022 11:06                4793
memcached.deletemulti.php                          30-Sep-2022 11:06                4834
memcached.deletemultibykey.php                     30-Sep-2022 11:06                4856
memcached.expiration.php                           30-Sep-2022 11:06                1879
memcached.fetch.php                                30-Sep-2022 11:06                6558
memcached.fetchall.php                             30-Sep-2022 11:06                6500
memcached.flush.php                                30-Sep-2022 11:06                4564
memcached.get.php                                  30-Sep-2022 11:06               10136
memcached.getallkeys.php                           30-Sep-2022 11:06                2708
memcached.getbykey.php                             30-Sep-2022 11:06                6073
memcached.getdelayed.php                           30-Sep-2022 11:06                8359
memcached.getdelayedbykey.php                      30-Sep-2022 11:06                5269
memcached.getmulti.php                             30-Sep-2022 11:06               21180
memcached.getmultibykey.php                        30-Sep-2022 11:06                5395
memcached.getoption.php                            30-Sep-2022 11:06                5132
memcached.getresultcode.php                        30-Sep-2022 11:06                4265
memcached.getresultmessage.php                     30-Sep-2022 11:06                4677
memcached.getserverbykey.php                       30-Sep-2022 11:06                7282
memcached.getserverlist.php                        30-Sep-2022 11:06                4608
memcached.getstats.php                             30-Sep-2022 11:06                5086
memcached.getversion.php                           30-Sep-2022 11:06                3816
memcached.increment.php                            30-Sep-2022 11:06                8258
memcached.incrementbykey.php                       30-Sep-2022 11:06                5613
memcached.installation.php                         30-Sep-2022 11:06                2562
memcached.ispersistent.php                         30-Sep-2022 11:06                2776
memcached.ispristine.php                           30-Sep-2022 11:06                2707
memcached.prepend.php                              30-Sep-2022 11:06                6834
memcached.prependbykey.php                         30-Sep-2022 11:06                4564
memcached.quit.php                                 30-Sep-2022 11:06                2284
memcached.replace.php                              30-Sep-2022 11:06                4496
memcached.replacebykey.php                         30-Sep-2022 11:06                5482
memcached.requirements.php                         30-Sep-2022 11:06                1499
memcached.resetserverlist.php                      30-Sep-2022 11:06                3025
memcached.resources.php                            30-Sep-2022 11:06                1195
memcached.sessions.php                             30-Sep-2022 11:06                2265
memcached.set.php                                  30-Sep-2022 11:06                9058
memcached.setbykey.php                             30-Sep-2022 11:06                6951
memcached.setmulti.php                             30-Sep-2022 11:06                6194
memcached.setmultibykey.php                        30-Sep-2022 11:06                4775
memcached.setoption.php                            30-Sep-2022 11:06                7300
memcached.setoptions.php                           30-Sep-2022 11:06                6866
memcached.setsaslauthdata.php                      30-Sep-2022 11:06                3179
memcached.setup.php                                30-Sep-2022 11:06                1608
memcached.touch.php                                30-Sep-2022 11:06                3494
memcached.touchbykey.php                           30-Sep-2022 11:06                4420
messageformatter.create.php                        30-Sep-2022 11:06               10821
messageformatter.format.php                        30-Sep-2022 11:06                9754
messageformatter.formatmessage.php                 30-Sep-2022 11:06                9906
messageformatter.geterrorcode.php                  30-Sep-2022 11:06                3883
messageformatter.geterrormessage.php               30-Sep-2022 11:06                7799
messageformatter.getlocale.php                     30-Sep-2022 11:06                5421
messageformatter.getpattern.php                    30-Sep-2022 11:06               10372
messageformatter.parse.php                         30-Sep-2022 11:06                9761
messageformatter.parsemessage.php                  30-Sep-2022 11:06               10350
messageformatter.setpattern.php                    30-Sep-2022 11:06               10797
mhash.configuration.php                            30-Sep-2022 11:06                1224
mhash.constants.php                                30-Sep-2022 11:06                4897
mhash.examples.php                                 30-Sep-2022 11:06                3445
mhash.installation.php                             30-Sep-2022 11:06                1573
mhash.requirements.php                             30-Sep-2022 11:06                1306
mhash.resources.php                                30-Sep-2022 11:06                1167
mhash.setup.php                                    30-Sep-2022 11:06                1556
migration56.changed-functions.php                  30-Sep-2022 11:06                6817
migration56.constants.php                          30-Sep-2022 11:06                5210
migration56.deprecated.php                         30-Sep-2022 11:06                6300
migration56.extensions.php                         30-Sep-2022 11:06                4550
migration56.incompatible.php                       30-Sep-2022 11:06                8989
migration56.new-features.php                       30-Sep-2022 11:06               31744
migration56.new-functions.php                      30-Sep-2022 11:06                7518
migration56.openssl.php                            30-Sep-2022 11:06               27483
migration56.php                                    30-Sep-2022 11:06                2573
migration70.changed-functions.php                  30-Sep-2022 11:06                5590
migration70.classes.php                            30-Sep-2022 11:06                3883
migration70.constants.php                          30-Sep-2022 11:06                7073
migration70.deprecated.php                         30-Sep-2022 11:06                5984
migration70.incompatible.php                       30-Sep-2022 11:06               65312
migration70.new-features.php                       30-Sep-2022 11:06               45558
migration70.new-functions.php                      30-Sep-2022 11:06                7402
migration70.other-changes.php                      30-Sep-2022 11:06                3786
migration70.php                                    30-Sep-2022 11:06                2947
migration70.removed-exts-sapis.php                 30-Sep-2022 11:06                3166
migration70.sapi-changes.php                       30-Sep-2022 11:06                2079
migration71.changed-functions.php                  30-Sep-2022 11:06                7784
migration71.constants.php                          30-Sep-2022 11:06                7215
migration71.deprecated.php                         30-Sep-2022 11:06                2310
migration71.incompatible.php                       30-Sep-2022 11:06               34018
migration71.new-features.php                       30-Sep-2022 11:06               29217
migration71.new-functions.php                      30-Sep-2022 11:06                5039
migration71.other-changes.php                      30-Sep-2022 11:06                8850
migration71.php                                    30-Sep-2022 11:06                2546
migration71.windows-support.php                    30-Sep-2022 11:06                7792
migration72.constants.php                          30-Sep-2022 11:06               24681
migration72.deprecated.php                         30-Sep-2022 11:06               10903
migration72.incompatible.php                       30-Sep-2022 11:06               20840
migration72.new-features.php                       30-Sep-2022 11:06               19518
migration72.new-functions.php                      30-Sep-2022 11:06               24382
migration72.other-changes.php                      30-Sep-2022 11:06                5967
migration72.php                                    30-Sep-2022 11:06                2447
migration73.constants.php                          30-Sep-2022 11:06               17696
migration73.deprecated.php                         30-Sep-2022 11:06                8876
migration73.incompatible.php                       30-Sep-2022 11:06               19723
migration73.new-features.php                       30-Sep-2022 11:06               17556
migration73.new-functions.php                      30-Sep-2022 11:06                7363
migration73.other-changes.php                      30-Sep-2022 11:06               16474
migration73.php                                    30-Sep-2022 11:06                2574
migration73.windows-support.php                    30-Sep-2022 11:06                1898
migration74.constants.php                          30-Sep-2022 11:06                5887
migration74.deprecated.php                         30-Sep-2022 11:06               16500
migration74.incompatible.php                       30-Sep-2022 11:06               18279
migration74.new-classes.php                        30-Sep-2022 11:06                1486
migration74.new-features.php                       30-Sep-2022 11:06               23496
migration74.new-functions.php                      30-Sep-2022 11:06                3706
migration74.other-changes.php                      30-Sep-2022 11:06               22427
migration74.php                                    30-Sep-2022 11:06                2799
migration74.removed-extensions.php                 30-Sep-2022 11:06                1945
migration74.windows-support.php                    30-Sep-2022 11:06                4041
migration80.deprecated.php                         30-Sep-2022 11:06               19728
migration80.incompatible.php                       30-Sep-2022 11:06              103850
migration80.new-features.php                       30-Sep-2022 11:06               35125
migration80.other-changes.php                      30-Sep-2022 11:06               15399
migration80.php                                    30-Sep-2022 11:06                2413
migration81.constants.php                          30-Sep-2022 11:06                6237
migration81.deprecated.php                         30-Sep-2022 11:06               19174
migration81.incompatible.php                       30-Sep-2022 11:06               24161
migration81.new-classes.php                        30-Sep-2022 11:06                2120
migration81.new-features.php                       30-Sep-2022 11:06               24942
migration81.new-functions.php                      30-Sep-2022 11:06                8471
migration81.other-changes.php                      30-Sep-2022 11:06               10336
migration81.php                                    30-Sep-2022 11:06                2638
migration82.constants.php                          30-Sep-2022 11:06               16108
migration82.deprecated.php                         30-Sep-2022 11:06                6000
migration82.incompatible.php                       30-Sep-2022 11:06                8188
migration82.new-features.php                       30-Sep-2022 11:06                6780
migration82.new-functions.php                      30-Sep-2022 11:06                3401
migration82.other-changes.php                      30-Sep-2022 11:06               24982
migration82.php                                    30-Sep-2022 11:06                2640
migration82.windows-support.php                    30-Sep-2022 11:06                2291
misc.configuration.php                             30-Sep-2022 11:06                5357
misc.constants.php                                 30-Sep-2022 11:06                2110
misc.installation.php                              30-Sep-2022 11:06                1201
misc.requirements.php                              30-Sep-2022 11:06                1177
misc.resources.php                                 30-Sep-2022 11:06                1160
misc.setup.php                                     30-Sep-2022 11:06                1530
mongodb-bson-binary.construct.php                  30-Sep-2022 11:06                7091
mongodb-bson-binary.getdata.php                    30-Sep-2022 11:06                4672
mongodb-bson-binary.gettype.php                    30-Sep-2022 11:06                4656
mongodb-bson-binary.jsonserialize.php              30-Sep-2022 11:06                5512
mongodb-bson-binary.serialize.php                  30-Sep-2022 11:06                3476
mongodb-bson-binary.tostring.php                   30-Sep-2022 11:06                4456
mongodb-bson-binary.unserialize.php                30-Sep-2022 11:06                4332
mongodb-bson-binaryinterface.getdata.php           30-Sep-2022 11:06                2776
mongodb-bson-binaryinterface.gettype.php           30-Sep-2022 11:06                2788
mongodb-bson-binaryinterface.tostring.php          30-Sep-2022 11:06                3260
mongodb-bson-dbpointer.construct.php               30-Sep-2022 11:06                2662
mongodb-bson-dbpointer.jsonserialize.php           30-Sep-2022 11:06                5581
mongodb-bson-dbpointer.serialize.php               30-Sep-2022 11:06                3551
mongodb-bson-dbpointer.tostring.php                30-Sep-2022 11:06                2618
mongodb-bson-dbpointer.unserialize.php             30-Sep-2022 11:06                3801
mongodb-bson-decimal128.construct.php              30-Sep-2022 11:06                6147
mongodb-bson-decimal128.jsonserialize.php          30-Sep-2022 11:06                5602
mongodb-bson-decimal128.serialize.php              30-Sep-2022 11:06                3576
mongodb-bson-decimal128.tostring.php               30-Sep-2022 11:06                4953
mongodb-bson-decimal128.unserialize.php            30-Sep-2022 11:06                4424
mongodb-bson-decimal128interface.tostring.php      30-Sep-2022 11:06                2939
mongodb-bson-int64.construct.php                   30-Sep-2022 11:06                2610
mongodb-bson-int64.jsonserialize.php               30-Sep-2022 11:06                5256
mongodb-bson-int64.serialize.php                   30-Sep-2022 11:06                3453
mongodb-bson-int64.tostring.php                    30-Sep-2022 11:06                3857
mongodb-bson-int64.unserialize.php                 30-Sep-2022 11:06                4303
mongodb-bson-javascript.construct.php              30-Sep-2022 11:06                7191
mongodb-bson-javascript.getcode.php                30-Sep-2022 11:06                4520
mongodb-bson-javascript.getscope.php               30-Sep-2022 11:06                5588
mongodb-bson-javascript.jsonserialize.php          30-Sep-2022 11:06                5598
mongodb-bson-javascript.serialize.php              30-Sep-2022 11:06                3576
mongodb-bson-javascript.tostring.php               30-Sep-2022 11:06                4326
mongodb-bson-javascript.unserialize.php            30-Sep-2022 11:06                4416
mongodb-bson-javascriptinterface.getcode.php       30-Sep-2022 11:06                2870
mongodb-bson-javascriptinterface.getscope.php      30-Sep-2022 11:06                2979
mongodb-bson-javascriptinterface.tostring.php      30-Sep-2022 11:06                3358
mongodb-bson-maxkey.construct.php                  30-Sep-2022 11:06                3801
mongodb-bson-maxkey.jsonserialize.php              30-Sep-2022 11:06                5518
mongodb-bson-maxkey.serialize.php                  30-Sep-2022 11:06                3480
mongodb-bson-maxkey.unserialize.php                30-Sep-2022 11:06                3734
mongodb-bson-minkey.construct.php                  30-Sep-2022 11:06                3801
mongodb-bson-minkey.jsonserialize.php              30-Sep-2022 11:06                5518
mongodb-bson-minkey.serialize.php                  30-Sep-2022 11:06                3480
mongodb-bson-minkey.unserialize.php                30-Sep-2022 11:06                3738
mongodb-bson-objectid.construct.php                30-Sep-2022 11:06                5404
mongodb-bson-objectid.gettimestamp.php             30-Sep-2022 11:06                5750
mongodb-bson-objectid.jsonserialize.php            30-Sep-2022 11:06                5564
mongodb-bson-objectid.serialize.php                30-Sep-2022 11:06                3528
mongodb-bson-objectid.tostring.php                 30-Sep-2022 11:06                4445
mongodb-bson-objectid.unserialize.php              30-Sep-2022 11:06                4370
mongodb-bson-objectidinterface.gettimestamp.php    30-Sep-2022 11:06                2941
mongodb-bson-objectidinterface.tostring.php        30-Sep-2022 11:06                2923
mongodb-bson-regex.construct.php                   30-Sep-2022 11:06                6984
mongodb-bson-regex.getflags.php                    30-Sep-2022 11:06                4626
mongodb-bson-regex.getpattern.php                  30-Sep-2022 11:06                4473
mongodb-bson-regex.jsonserialize.php               30-Sep-2022 11:06                5497
mongodb-bson-regex.serialize.php                   30-Sep-2022 11:06                3451
mongodb-bson-regex.tostring.php                    30-Sep-2022 11:06                3998
mongodb-bson-regex.unserialize.php                 30-Sep-2022 11:06                4307
mongodb-bson-regexinterface.getflags.php           30-Sep-2022 11:06                2775
mongodb-bson-regexinterface.getpattern.php         30-Sep-2022 11:06                2818
mongodb-bson-regexinterface.tostring.php           30-Sep-2022 11:06                2849
mongodb-bson-serializable.bsonserialize.php        30-Sep-2022 11:06               16281
mongodb-bson-symbol.construct.php                  30-Sep-2022 11:06                2602
mongodb-bson-symbol.jsonserialize.php              30-Sep-2022 11:06                5518
mongodb-bson-symbol.serialize.php                  30-Sep-2022 11:06                3476
mongodb-bson-symbol.tostring.php                   30-Sep-2022 11:06                2596
mongodb-bson-symbol.unserialize.php                30-Sep-2022 11:06                3740
mongodb-bson-timestamp.construct.php               30-Sep-2022 11:06                4770
mongodb-bson-timestamp.getincrement.php            30-Sep-2022 11:06                4260
mongodb-bson-timestamp.gettimestamp.php            30-Sep-2022 11:06                4245
mongodb-bson-timestamp.jsonserialize.php           30-Sep-2022 11:06                5585
mongodb-bson-timestamp.serialize.php               30-Sep-2022 11:06                3551
mongodb-bson-timestamp.tostring.php                30-Sep-2022 11:06                4133
mongodb-bson-timestamp.unserialize.php             30-Sep-2022 11:06                4403
mongodb-bson-timestampinterface.getincrement.php   30-Sep-2022 11:06                3305
mongodb-bson-timestampinterface.gettimestamp.php   30-Sep-2022 11:06                3320
mongodb-bson-timestampinterface.tostring.php       30-Sep-2022 11:06                2941
mongodb-bson-undefined.construct.php               30-Sep-2022 11:06                2662
mongodb-bson-undefined.jsonserialize.php           30-Sep-2022 11:06                5581
mongodb-bson-undefined.serialize.php               30-Sep-2022 11:06                3551
mongodb-bson-undefined.tostring.php                30-Sep-2022 11:06                2618
mongodb-bson-undefined.unserialize.php             30-Sep-2022 11:06                3802
mongodb-bson-unserializable.bsonunserialize.php    30-Sep-2022 11:06                7574
mongodb-bson-utcdatetime.construct.php             30-Sep-2022 11:06                8130
mongodb-bson-utcdatetime.jsonserialize.php         30-Sep-2022 11:06                5623
mongodb-bson-utcdatetime.serialize.php             30-Sep-2022 11:06                3603
mongodb-bson-utcdatetime.todatetime.php            30-Sep-2022 11:06                6007
mongodb-bson-utcdatetime.tostring.php              30-Sep-2022 11:06                4091
mongodb-bson-utcdatetime.unserialize.php           30-Sep-2022 11:06                4435
mongodb-bson-utcdatetimeinterface.todatetime.php   30-Sep-2022 11:06                3278
mongodb-bson-utcdatetimeinterface.tostring.php     30-Sep-2022 11:06                2957
mongodb-driver-bulkwrite.construct.php             30-Sep-2022 11:06               20295
mongodb-driver-bulkwrite.count.php                 30-Sep-2022 11:06                7124
mongodb-driver-bulkwrite.delete.php                30-Sep-2022 11:06               11712
mongodb-driver-bulkwrite.insert.php                30-Sep-2022 11:06               10079
mongodb-driver-bulkwrite.update.php                30-Sep-2022 11:06               14969
mongodb-driver-clientencryption.construct.php      30-Sep-2022 11:06                8797
mongodb-driver-clientencryption.createdatakey.php  30-Sep-2022 11:06               10223
mongodb-driver-clientencryption.decrypt.php        30-Sep-2022 11:06                4265
mongodb-driver-clientencryption.encrypt.php        30-Sep-2022 11:06                9868
mongodb-driver-command.construct.php               30-Sep-2022 11:06               15429
mongodb-driver-commandexception.getresultdocume..> 30-Sep-2022 11:06                3191
mongodb-driver-cursor.construct.php                30-Sep-2022 11:06                3381
mongodb-driver-cursor.current.php                  30-Sep-2022 11:06                2874
mongodb-driver-cursor.getid.php                    30-Sep-2022 11:06                8361
mongodb-driver-cursor.getserver.php                30-Sep-2022 11:06                8009
mongodb-driver-cursor.isdead.php                   30-Sep-2022 11:06               11137
mongodb-driver-cursor.key.php                      30-Sep-2022 11:06                2606
mongodb-driver-cursor.next.php                     30-Sep-2022 11:06                3547
mongodb-driver-cursor.rewind.php                   30-Sep-2022 11:06                3953
mongodb-driver-cursor.settypemap.php               30-Sep-2022 11:06                8434
mongodb-driver-cursor.toarray.php                  30-Sep-2022 11:06                8106
mongodb-driver-cursor.valid.php                    30-Sep-2022 11:06                2697
mongodb-driver-cursorid.construct.php              30-Sep-2022 11:06                2824
mongodb-driver-cursorid.serialize.php              30-Sep-2022 11:06                3574
mongodb-driver-cursorid.tostring.php               30-Sep-2022 11:06                7540
mongodb-driver-cursorid.unserialize.php            30-Sep-2022 11:06                4442
mongodb-driver-cursorinterface.getid.php           30-Sep-2022 11:06                4056
mongodb-driver-cursorinterface.getserver.php       30-Sep-2022 11:06                4142
mongodb-driver-cursorinterface.isdead.php          30-Sep-2022 11:06                3988
mongodb-driver-cursorinterface.settypemap.php      30-Sep-2022 11:06                4008
mongodb-driver-cursorinterface.toarray.php         30-Sep-2022 11:06                3888
mongodb-driver-manager.addsubscriber.php           30-Sep-2022 11:06                5131
mongodb-driver-manager.construct.php               30-Sep-2022 11:06               73556
mongodb-driver-manager.createclientencryption.php  30-Sep-2022 11:06               10624
mongodb-driver-manager.executebulkwrite.php        30-Sep-2022 11:06               24092
mongodb-driver-manager.executecommand.php          30-Sep-2022 11:06               26460
mongodb-driver-manager.executequery.php            30-Sep-2022 11:06               17274
mongodb-driver-manager.executereadcommand.php      30-Sep-2022 11:06               10142
mongodb-driver-manager.executereadwritecommand.php 30-Sep-2022 11:06               11127
mongodb-driver-manager.executewritecommand.php     30-Sep-2022 11:06               11205
mongodb-driver-manager.getencryptedfieldsmap.php   30-Sep-2022 11:06                3699
mongodb-driver-manager.getreadconcern.php          30-Sep-2022 11:06                6239
mongodb-driver-manager.getreadpreference.php       30-Sep-2022 11:06                6834
mongodb-driver-manager.getservers.php              30-Sep-2022 11:06                8151
mongodb-driver-manager.getwriteconcern.php         30-Sep-2022 11:06                6292
mongodb-driver-manager.removesubscriber.php        30-Sep-2022 11:06                4991
mongodb-driver-manager.selectserver.php            30-Sep-2022 11:06                7058
mongodb-driver-manager.startsession.php            30-Sep-2022 11:06               11917
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                3668
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                3763
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                3652
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                4823
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                3962
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                4234
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                4220
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                3868
mongodb-driver-monitoring-commandfailedevent.ge..> 30-Sep-2022 11:06                3710
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:06                3969
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:06                3700
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:06                3602
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:06                5147
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:06                4710
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:06                4526
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:06                3888
mongodb-driver-monitoring-commandstartedevent.g..> 30-Sep-2022 11:06                3730
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:06                4955
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:06                5005
mongodb-driver-monitoring-commandsubscriber.com..> 30-Sep-2022 11:06                5020
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:06                3725
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:06                3832
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:06                4910
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:06                4019
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:06                4297
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:06                4755
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:06                3928
mongodb-driver-monitoring-commandsucceededevent..> 30-Sep-2022 11:06                3756
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:06                4823
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:06                4793
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:06                5360
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:06                5405
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:06                5436
mongodb-driver-monitoring-sdamsubscriber.server..> 30-Sep-2022 11:06                4823
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:06                4898
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:06                4835
mongodb-driver-monitoring-sdamsubscriber.topolo..> 30-Sep-2022 11:06                4818
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:06                3122
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:06                3498
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:06                3192
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:06                3575
mongodb-driver-monitoring-serverchangedevent.ge..> 30-Sep-2022 11:06                3298
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:06                3084
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:06                3136
mongodb-driver-monitoring-serverclosedevent.get..> 30-Sep-2022 11:06                3254
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:06                3572
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:06                3482
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:06                3259
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:06                3290
mongodb-driver-monitoring-serverheartbeatfailed..> 30-Sep-2022 11:06                3541
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:06                3264
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:06                3308
mongodb-driver-monitoring-serverheartbeatstarte..> 30-Sep-2022 11:06                3561
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:06                3624
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:06                3331
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:06                3342
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:06                4156
mongodb-driver-monitoring-serverheartbeatsuccee..> 30-Sep-2022 11:06                3577
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:06                3102
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:06                3154
mongodb-driver-monitoring-serveropeningevent.ge..> 30-Sep-2022 11:06                3286
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:06                3567
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:06                3645
mongodb-driver-monitoring-topologychangedevent...> 30-Sep-2022 11:06                3306
mongodb-driver-monitoring-topologyclosedevent.g..> 30-Sep-2022 11:06                3251
mongodb-driver-monitoring-topologyopeningevent...> 30-Sep-2022 11:06                3261
mongodb-driver-query.construct.php                 30-Sep-2022 11:06               31637
mongodb-driver-readconcern.bsonserialize.php       30-Sep-2022 11:06                7788
mongodb-driver-readconcern.construct.php           30-Sep-2022 11:06                6525
mongodb-driver-readconcern.getlevel.php            30-Sep-2022 11:06                6450
mongodb-driver-readconcern.isdefault.php           30-Sep-2022 11:06                8728
mongodb-driver-readconcern.serialize.php           30-Sep-2022 11:06                3651
mongodb-driver-readconcern.unserialize.php         30-Sep-2022 11:06                4493
mongodb-driver-readpreference.bsonserialize.php    30-Sep-2022 11:06               12445
mongodb-driver-readpreference.construct.php        30-Sep-2022 11:06               18291
mongodb-driver-readpreference.gethedge.php         30-Sep-2022 11:06                3320
mongodb-driver-readpreference.getmaxstalenessse..> 30-Sep-2022 11:06                9624
mongodb-driver-readpreference.getmode.php          30-Sep-2022 11:06                8969
mongodb-driver-readpreference.getmodestring.php    30-Sep-2022 11:06                9173
mongodb-driver-readpreference.gettagsets.php       30-Sep-2022 11:06                9170
mongodb-driver-readpreference.serialize.php        30-Sep-2022 11:06                3728
mongodb-driver-readpreference.unserialize.php      30-Sep-2022 11:06                4572
mongodb-driver-runtimeexception.haserrorlabel.php  30-Sep-2022 11:06                4171
mongodb-driver-server.construct.php                30-Sep-2022 11:06                3383
mongodb-driver-server.executebulkwrite.php         30-Sep-2022 11:06               11066
mongodb-driver-server.executecommand.php           30-Sep-2022 11:06               13054
mongodb-driver-server.executequery.php             30-Sep-2022 11:06                8357
mongodb-driver-server.executereadcommand.php       30-Sep-2022 11:06               10467
mongodb-driver-server.executereadwritecommand.php  30-Sep-2022 11:06               11647
mongodb-driver-server.executewritecommand.php      30-Sep-2022 11:06               11691
mongodb-driver-server.gethost.php                  30-Sep-2022 11:06                5891
mongodb-driver-server.getinfo.php                  30-Sep-2022 11:06               10910
mongodb-driver-server.getlatency.php               30-Sep-2022 11:06                7404
mongodb-driver-server.getport.php                  30-Sep-2022 11:06                5935
mongodb-driver-server.getserverdescription.php     30-Sep-2022 11:06                3422
mongodb-driver-server.gettags.php                  30-Sep-2022 11:06                3563
mongodb-driver-server.gettype.php                  30-Sep-2022 11:06                3674
mongodb-driver-server.isarbiter.php                30-Sep-2022 11:06                3488
mongodb-driver-server.ishidden.php                 30-Sep-2022 11:06                3482
mongodb-driver-server.ispassive.php                30-Sep-2022 11:06                3550
mongodb-driver-server.isprimary.php                30-Sep-2022 11:06                3495
mongodb-driver-server.issecondary.php              30-Sep-2022 11:06                3530
mongodb-driver-serverapi.bsonserialize.php         30-Sep-2022 11:06                3262
mongodb-driver-serverapi.construct.php             30-Sep-2022 11:06                3119
mongodb-driver-serverapi.serialize.php             30-Sep-2022 11:06                3604
mongodb-driver-serverapi.unserialize.php           30-Sep-2022 11:06                4460
mongodb-driver-serverdescription.gethellorespon..> 30-Sep-2022 11:06                5183
mongodb-driver-serverdescription.gethost.php       30-Sep-2022 11:06                3399
mongodb-driver-serverdescription.getlastupdatet..> 30-Sep-2022 11:06                3542
mongodb-driver-serverdescription.getport.php       30-Sep-2022 11:06                3456
mongodb-driver-serverdescription.getroundtripti..> 30-Sep-2022 11:06                3799
mongodb-driver-serverdescription.gettype.php       30-Sep-2022 11:06                3669
mongodb-driver-session.aborttransaction.php        30-Sep-2022 11:06                4243
mongodb-driver-session.advanceclustertime.php      30-Sep-2022 11:06                4774
mongodb-driver-session.advanceoperationtime.php    30-Sep-2022 11:06                4832
mongodb-driver-session.committransaction.php       30-Sep-2022 11:06                5651
mongodb-driver-session.construct.php               30-Sep-2022 11:06                2891
mongodb-driver-session.endsession.php              30-Sep-2022 11:06                4378
mongodb-driver-session.getclustertime.php          30-Sep-2022 11:06                3769
mongodb-driver-session.getlogicalsessionid.php     30-Sep-2022 11:06                3072
mongodb-driver-session.getoperationtime.php        30-Sep-2022 11:06                3909
mongodb-driver-session.getserver.php               30-Sep-2022 11:06                3789
mongodb-driver-session.gettransactionoptions.php   30-Sep-2022 11:06                3619
mongodb-driver-session.gettransactionstate.php     30-Sep-2022 11:06                3701
mongodb-driver-session.isdirty.php                 30-Sep-2022 11:06                2958
mongodb-driver-session.isintransaction.php         30-Sep-2022 11:06                3646
mongodb-driver-session.starttransaction.php        30-Sep-2022 11:06                9034
mongodb-driver-topologydescription.getservers.php  30-Sep-2022 11:06                3401
mongodb-driver-topologydescription.gettype.php     30-Sep-2022 11:06                3327
mongodb-driver-topologydescription.hasreadables..> 30-Sep-2022 11:06                3806
mongodb-driver-topologydescription.haswritables..> 30-Sep-2022 11:06                3168
mongodb-driver-writeconcern.bsonserialize.php      30-Sep-2022 11:06                8243
mongodb-driver-writeconcern.construct.php          30-Sep-2022 11:06               10657
mongodb-driver-writeconcern.getjournal.php         30-Sep-2022 11:06                6369
mongodb-driver-writeconcern.getw.php               30-Sep-2022 11:06                5565
mongodb-driver-writeconcern.getwtimeout.php        30-Sep-2022 11:06                6308
mongodb-driver-writeconcern.isdefault.php          30-Sep-2022 11:06                8227
mongodb-driver-writeconcern.serialize.php          30-Sep-2022 11:06                3676
mongodb-driver-writeconcern.unserialize.php        30-Sep-2022 11:06                4532
mongodb-driver-writeconcernerror.getcode.php       30-Sep-2022 11:06                7036
mongodb-driver-writeconcernerror.getinfo.php       30-Sep-2022 11:06                7253
mongodb-driver-writeconcernerror.getmessage.php    30-Sep-2022 11:06                7125
mongodb-driver-writeerror.getcode.php              30-Sep-2022 11:06                6207
mongodb-driver-writeerror.getindex.php             30-Sep-2022 11:06                6748
mongodb-driver-writeerror.getinfo.php              30-Sep-2022 11:06                2962
mongodb-driver-writeerror.getmessage.php           30-Sep-2022 11:06                6341
mongodb-driver-writeexception.getwriteresult.php   30-Sep-2022 11:06                8752
mongodb-driver-writeresult.getdeletedcount.php     30-Sep-2022 11:06                8479
mongodb-driver-writeresult.getinsertedcount.php    30-Sep-2022 11:06                8561
mongodb-driver-writeresult.getmatchedcount.php     30-Sep-2022 11:06                9139
mongodb-driver-writeresult.getmodifiedcount.php    30-Sep-2022 11:06                9386
mongodb-driver-writeresult.getserver.php           30-Sep-2022 11:06                7187
mongodb-driver-writeresult.getupsertedcount.php    30-Sep-2022 11:06                8716
mongodb-driver-writeresult.getupsertedids.php      30-Sep-2022 11:06                9249
mongodb-driver-writeresult.getwriteconcernerror..> 30-Sep-2022 11:06                7880
mongodb-driver-writeresult.getwriteerrors.php      30-Sep-2022 11:06               14510
mongodb-driver-writeresult.isacknowledged.php      30-Sep-2022 11:06                8867
mongodb.architecture.php                           30-Sep-2022 11:06                1922
mongodb.configuration.php                          30-Sep-2022 11:06                3861
mongodb.connection-handling.php                    30-Sep-2022 11:06                9474
mongodb.constants.php                              30-Sep-2022 11:06                1876
mongodb.exceptions.php                             30-Sep-2022 11:06                5149
mongodb.exceptions.tree.php                        30-Sep-2022 11:06                5559
mongodb.installation.homebrew.php                  30-Sep-2022 11:06                1975
mongodb.installation.manual.php                    30-Sep-2022 11:06                6518
mongodb.installation.pecl.php                      30-Sep-2022 11:06                3601
mongodb.installation.php                           30-Sep-2022 11:06                1774
mongodb.installation.windows.php                   30-Sep-2022 11:06                2909
mongodb.monitoring.php                             30-Sep-2022 11:06               18569
mongodb.overview.php                               30-Sep-2022 11:06                7234
mongodb.persistence.deserialization.php            30-Sep-2022 11:06               20740
mongodb.persistence.php                            30-Sep-2022 11:06                1809
mongodb.persistence.serialization.php              30-Sep-2022 11:06               23894
mongodb.requirements.php                           30-Sep-2022 11:06                3118
mongodb.security.php                               30-Sep-2022 11:06                1484
mongodb.security.request_injection.php             30-Sep-2022 11:06                3004
mongodb.security.script_injection.php              30-Sep-2022 11:06               10544
mongodb.setup.php                                  30-Sep-2022 11:06                2023
mongodb.tutorial.apm.php                           30-Sep-2022 11:06               24275
mongodb.tutorial.library.php                       30-Sep-2022 11:06               11315
mongodb.tutorial.php                               30-Sep-2022 11:06                1698
mqseries.configure.php                             30-Sep-2022 11:06                2768
mqseries.constants.php                             30-Sep-2022 11:06                2122
mqseries.ini.php                                   30-Sep-2022 11:06                1293
mqseries.requirements.php                          30-Sep-2022 11:06                1593
mqseries.resources.php                             30-Sep-2022 11:06                1638
mqseries.setup.php                                 30-Sep-2022 11:06                1593
multipleiterator.attachiterator.php                30-Sep-2022 11:06                4188
multipleiterator.construct.php                     30-Sep-2022 11:06                8156
multipleiterator.containsiterator.php              30-Sep-2022 11:06                3353
multipleiterator.countiterators.php                30-Sep-2022 11:06                3015
multipleiterator.current.php                       30-Sep-2022 11:06                4285
multipleiterator.detachiterator.php                30-Sep-2022 11:06                3223
multipleiterator.getflags.php                      30-Sep-2022 11:06                3183
multipleiterator.key.php                           30-Sep-2022 11:06                4151
multipleiterator.next.php                          30-Sep-2022 11:06                2846
multipleiterator.rewind.php                        30-Sep-2022 11:06                2864
multipleiterator.setflags.php                      30-Sep-2022 11:06                3496
multipleiterator.valid.php                         30-Sep-2022 11:06                2927
mysql-xdevapi-baseresult.getwarnings.php           30-Sep-2022 11:06                7066
mysql-xdevapi-baseresult.getwarningscount.php      30-Sep-2022 11:06                6798
mysql-xdevapi-client.close.php                     30-Sep-2022 11:06                2325
mysql-xdevapi-client.construct.php                 30-Sep-2022 11:06                3612
mysql-xdevapi-client.getsession.php                30-Sep-2022 11:06                2391
mysql-xdevapi-collection.add.php                   30-Sep-2022 11:06                9950
mysql-xdevapi-collection.addorreplaceone.php       30-Sep-2022 11:06                8569
mysql-xdevapi-collection.construct.php             30-Sep-2022 11:06                6809
mysql-xdevapi-collection.count.php                 30-Sep-2022 11:06                6922
mysql-xdevapi-collection.createindex.php           30-Sep-2022 11:06               10056
mysql-xdevapi-collection.dropindex.php             30-Sep-2022 11:06                6945
mysql-xdevapi-collection.existsindatabase.php      30-Sep-2022 11:06                6174
mysql-xdevapi-collection.find.php                  30-Sep-2022 11:06               10218
mysql-xdevapi-collection.getname.php               30-Sep-2022 11:06                5247
mysql-xdevapi-collection.getone.php                30-Sep-2022 11:06                7481
mysql-xdevapi-collection.getschema.php             30-Sep-2022 11:06                5454
mysql-xdevapi-collection.getsession.php            30-Sep-2022 11:06                5729
mysql-xdevapi-collection.modify.php                30-Sep-2022 11:06                8538
mysql-xdevapi-collection.remove.php                30-Sep-2022 11:06                8868
mysql-xdevapi-collection.removeone.php             30-Sep-2022 11:06                8127
mysql-xdevapi-collection.replaceone.php            30-Sep-2022 11:06                8384
mysql-xdevapi-collectionadd.construct.php          30-Sep-2022 11:06                8421
mysql-xdevapi-collectionadd.execute.php            30-Sep-2022 11:06                8395
mysql-xdevapi-collectionfind.bind.php              30-Sep-2022 11:06                8285
mysql-xdevapi-collectionfind.construct.php         30-Sep-2022 11:06                7280
mysql-xdevapi-collectionfind.execute.php           30-Sep-2022 11:06                7464
mysql-xdevapi-collectionfind.fields.php            30-Sep-2022 11:06                7887
mysql-xdevapi-collectionfind.groupby.php           30-Sep-2022 11:06                4347
mysql-xdevapi-collectionfind.having.php            30-Sep-2022 11:06                4591
mysql-xdevapi-collectionfind.limit.php             30-Sep-2022 11:06                8552
mysql-xdevapi-collectionfind.lockexclusive.php     30-Sep-2022 11:06                6711
mysql-xdevapi-collectionfind.lockshared.php        30-Sep-2022 11:06                6514
mysql-xdevapi-collectionfind.offset.php            30-Sep-2022 11:06                8299
mysql-xdevapi-collectionfind.sort.php              30-Sep-2022 11:06                8409
mysql-xdevapi-collectionmodify.arrayappend.php     30-Sep-2022 11:06                8368
mysql-xdevapi-collectionmodify.arrayinsert.php     30-Sep-2022 11:06                8787
mysql-xdevapi-collectionmodify.bind.php            30-Sep-2022 11:06                8512
mysql-xdevapi-collectionmodify.construct.php       30-Sep-2022 11:06                7155
mysql-xdevapi-collectionmodify.execute.php         30-Sep-2022 11:06                3283
mysql-xdevapi-collectionmodify.limit.php           30-Sep-2022 11:06                8963
mysql-xdevapi-collectionmodify.patch.php           30-Sep-2022 11:06                4200
mysql-xdevapi-collectionmodify.replace.php         30-Sep-2022 11:06                8185
mysql-xdevapi-collectionmodify.set.php             30-Sep-2022 11:06                8127
mysql-xdevapi-collectionmodify.skip.php            30-Sep-2022 11:06                4869
mysql-xdevapi-collectionmodify.sort.php            30-Sep-2022 11:06                4912
mysql-xdevapi-collectionmodify.unset.php           30-Sep-2022 11:06                4500
mysql-xdevapi-collectionremove.bind.php            30-Sep-2022 11:06                5161
mysql-xdevapi-collectionremove.construct.php       30-Sep-2022 11:06                7655
mysql-xdevapi-collectionremove.execute.php         30-Sep-2022 11:06                4065
mysql-xdevapi-collectionremove.limit.php           30-Sep-2022 11:06                4501
mysql-xdevapi-collectionremove.sort.php            30-Sep-2022 11:06                4579
mysql-xdevapi-columnresult.construct.php           30-Sep-2022 11:06               10027
mysql-xdevapi-columnresult.getcharactersetname.php 30-Sep-2022 11:06                3265
mysql-xdevapi-columnresult.getcollationname.php    30-Sep-2022 11:06                3244
mysql-xdevapi-columnresult.getcolumnlabel.php      30-Sep-2022 11:06                3210
mysql-xdevapi-columnresult.getcolumnname.php       30-Sep-2022 11:06                3205
mysql-xdevapi-columnresult.getfractionaldigits.php 30-Sep-2022 11:06                3316
mysql-xdevapi-columnresult.getlength.php           30-Sep-2022 11:06                3160
mysql-xdevapi-columnresult.getschemaname.php       30-Sep-2022 11:06                3234
mysql-xdevapi-columnresult.gettablelabel.php       30-Sep-2022 11:06                3189
mysql-xdevapi-columnresult.gettablename.php        30-Sep-2022 11:06                3199
mysql-xdevapi-columnresult.gettype.php             30-Sep-2022 11:06                3116
mysql-xdevapi-columnresult.isnumbersigned.php      30-Sep-2022 11:06                3362
mysql-xdevapi-columnresult.ispadded.php            30-Sep-2022 11:06                3203
mysql-xdevapi-crudoperationbindable.bind.php       30-Sep-2022 11:06                5811
mysql-xdevapi-crudoperationlimitable.limit.php     30-Sep-2022 11:06                5902
mysql-xdevapi-crudoperationskippable.skip.php      30-Sep-2022 11:06                4573
mysql-xdevapi-crudoperationsortable.sort.php       30-Sep-2022 11:06                4609
mysql-xdevapi-databaseobject.existsindatabase.php  30-Sep-2022 11:06                3500
mysql-xdevapi-databaseobject.getname.php           30-Sep-2022 11:06                3436
mysql-xdevapi-databaseobject.getsession.php        30-Sep-2022 11:06                3539
mysql-xdevapi-docresult.construct.php              30-Sep-2022 11:06                7820
mysql-xdevapi-docresult.fetchall.php               30-Sep-2022 11:06                8270
mysql-xdevapi-docresult.fetchone.php               30-Sep-2022 11:06                7912
mysql-xdevapi-docresult.getwarnings.php            30-Sep-2022 11:06                8933
mysql-xdevapi-docresult.getwarningscount.php       30-Sep-2022 11:06                8745
mysql-xdevapi-executable.execute.php               30-Sep-2022 11:06                6772
mysql-xdevapi-executionstatus.construct.php        30-Sep-2022 11:06                2988
mysql-xdevapi-expression.construct.php             30-Sep-2022 11:06                3081
mysql-xdevapi-result.construct.php                 30-Sep-2022 11:06                7370
mysql-xdevapi-result.getaffecteditemscount.php     30-Sep-2022 11:06                6168
mysql-xdevapi-result.getautoincrementvalue.php     30-Sep-2022 11:06                7707
mysql-xdevapi-result.getgeneratedids.php           30-Sep-2022 11:06                6985
mysql-xdevapi-result.getwarnings.php               30-Sep-2022 11:06                6948
mysql-xdevapi-result.getwarningscount.php          30-Sep-2022 11:06                6644
mysql-xdevapi-rowresult.construct.php              30-Sep-2022 11:06                5023
mysql-xdevapi-rowresult.fetchall.php               30-Sep-2022 11:06                6718
mysql-xdevapi-rowresult.fetchone.php               30-Sep-2022 11:06                6902
mysql-xdevapi-rowresult.getcolumncount.php         30-Sep-2022 11:06                6196
mysql-xdevapi-rowresult.getcolumnnames.php         30-Sep-2022 11:06                6229
mysql-xdevapi-rowresult.getcolumns.php             30-Sep-2022 11:06                7190
mysql-xdevapi-rowresult.getwarnings.php            30-Sep-2022 11:06                6995
mysql-xdevapi-rowresult.getwarningscount.php       30-Sep-2022 11:06                6690
mysql-xdevapi-schema.construct.php                 30-Sep-2022 11:06                5548
mysql-xdevapi-schema.createcollection.php          30-Sep-2022 11:06               10334
mysql-xdevapi-schema.dropcollection.php            30-Sep-2022 11:06                6681
mysql-xdevapi-schema.existsindatabase.php          30-Sep-2022 11:06                6541
mysql-xdevapi-schema.getcollection.php             30-Sep-2022 11:06                5698
mysql-xdevapi-schema.getcollectionastable.php      30-Sep-2022 11:06                7330
mysql-xdevapi-schema.getcollections.php            30-Sep-2022 11:06                6432
mysql-xdevapi-schema.getname.php                   30-Sep-2022 11:06                4834
mysql-xdevapi-schema.getsession.php                30-Sep-2022 11:06                5332
mysql-xdevapi-schema.gettable.php                  30-Sep-2022 11:06                6897
mysql-xdevapi-schema.gettables.php                 30-Sep-2022 11:06                7131
mysql-xdevapi-schemaobject.getschema.php           30-Sep-2022 11:06                4101
mysql-xdevapi-session.close.php                    30-Sep-2022 11:06                3974
mysql-xdevapi-session.commit.php                   30-Sep-2022 11:06                4775
mysql-xdevapi-session.construct.php                30-Sep-2022 11:06                3137
mysql-xdevapi-session.createschema.php             30-Sep-2022 11:06                5000
mysql-xdevapi-session.dropschema.php               30-Sep-2022 11:06                4086
mysql-xdevapi-session.generateuuid.php             30-Sep-2022 11:06                4009
mysql-xdevapi-session.getdefaultschema.php         30-Sep-2022 11:06                4175
mysql-xdevapi-session.getschema.php                30-Sep-2022 11:06                4276
mysql-xdevapi-session.getschemas.php               30-Sep-2022 11:06                4102
mysql-xdevapi-session.getserverversion.php         30-Sep-2022 11:06                3945
mysql-xdevapi-session.listclients.php              30-Sep-2022 11:06                4269
mysql-xdevapi-session.quotename.php                30-Sep-2022 11:06                5377
mysql-xdevapi-session.releasesavepoint.php         30-Sep-2022 11:06                5701
mysql-xdevapi-session.rollback.php                 30-Sep-2022 11:06                5401
mysql-xdevapi-session.rollbackto.php               30-Sep-2022 11:06                5780
mysql-xdevapi-session.setsavepoint.php             30-Sep-2022 11:06                6014
mysql-xdevapi-session.sql.php                      30-Sep-2022 11:06                3944
mysql-xdevapi-session.starttransaction.php         30-Sep-2022 11:06                5477
mysql-xdevapi-sqlstatement.bind.php                30-Sep-2022 11:06                3367
mysql-xdevapi-sqlstatement.construct.php           30-Sep-2022 11:06                2926
mysql-xdevapi-sqlstatement.execute.php             30-Sep-2022 11:06                3214
mysql-xdevapi-sqlstatement.getnextresult.php       30-Sep-2022 11:06                3266
mysql-xdevapi-sqlstatement.getresult.php           30-Sep-2022 11:06                3235
mysql-xdevapi-sqlstatement.hasmoreresults.php      30-Sep-2022 11:06                3285
mysql-xdevapi-sqlstatementresult.construct.php     30-Sep-2022 11:06                3046
mysql-xdevapi-sqlstatementresult.fetchall.php      30-Sep-2022 11:06                7146
mysql-xdevapi-sqlstatementresult.fetchone.php      30-Sep-2022 11:06                6975
mysql-xdevapi-sqlstatementresult.getaffectedite..> 30-Sep-2022 11:06                3400
mysql-xdevapi-sqlstatementresult.getcolumncount..> 30-Sep-2022 11:06                3928
mysql-xdevapi-sqlstatementresult.getcolumnnames..> 30-Sep-2022 11:06                3316
mysql-xdevapi-sqlstatementresult.getcolumns.php    30-Sep-2022 11:06                3272
mysql-xdevapi-sqlstatementresult.getgeneratedid..> 30-Sep-2022 11:06                3430
mysql-xdevapi-sqlstatementresult.getlastinserti..> 30-Sep-2022 11:06                3373